X-Git-Url: http://source.jalview.org/gitweb/?a=blobdiff_plain;f=test%2Fjalview%2Fstructure%2FMapping.java;fp=test%2Fjalview%2Fstructure%2FMapping.java;h=db0ea49ecbe7fa3b5539fbe9ddc5ab6c509f98d3;hb=c9df5bd6e95c23c9b560c0a59003d1f4043f8055;hp=cc8138c1dacfe2cb3511b917a438ca1470ddcfb2;hpb=f59ae49cdd2bb8f6721424ea6ce167e8245e7d15;p=jalview.git

diff --git a/test/jalview/structure/Mapping.java b/test/jalview/structure/Mapping.java
index cc8138c..db0ea49 100644
--- a/test/jalview/structure/Mapping.java
+++ b/test/jalview/structure/Mapping.java
@@ -1,14 +1,7 @@
 package jalview.structure;
 
-import static org.junit.Assert.assertEquals;
-import static org.junit.Assert.assertTrue;
-import static org.junit.Assert.fail;
-
-import org.junit.Assert;
-import org.junit.Ignore;
-import org.junit.Test;
-
-import MCview.PDBfile;
+import static org.testng.AssertJUnit.assertEquals;
+import static org.testng.AssertJUnit.assertTrue;
 
 import jalview.datamodel.AlignmentAnnotation;
 import jalview.datamodel.Annotation;
@@ -18,6 +11,12 @@ import jalview.gui.AlignFrame;
 import jalview.io.FileLoader;
 import jalview.io.FormatAdapter;
 
+import org.testng.Assert;
+import org.testng.AssertJUnit;
+import org.testng.annotations.Test;
+
+import MCview.PDBfile;
+
 public class Mapping
 {
 
@@ -28,11 +27,10 @@ public class Mapping
    * 115 in PDB Res Numbering secondary structure numbers in jmol seem to be in
    * msd numbering, not pdb res numbering.
    */
-  @Test
-  @Ignore
+  @Test(enabled = false)
   public void pdbEntryPositionMap() throws Exception
   {
-    fail("This test intentionally left to fail");
+    Assert.fail("This test intentionally left to fail");
     for (int offset = 0; offset < 20; offset += 6)
     {
       // check we put the secondary structure in the right position
@@ -111,11 +109,10 @@ public class Mapping
     }
   }
 
-  @Test
-  @Ignore
+  @Test(enabled = false)
   public void testPDBentryMapping() throws Exception
   {
-    fail("This test intentionally left to fail");
+    Assert.fail("This test intentionally left to fail");
     Sequence sq = new Sequence(
             "1GAQ A subseq 126 to 219",
             "EIVKGVCSNFLCDLQPGDNVQITGPVGKEMLMPKDPNATIIMLATGTGIAPFRSFLWKMFFEKHDDYKFNGLGWLFLGVPTSSSLLYKEEFGKM");
@@ -228,7 +225,7 @@ public class Mapping
             jalview.io.FormatAdapter.FILE);
     if (pmap == null)
     {
-      Assert.fail("Couldn't make a mapping for 3W5V to FER1_MAIZE");
+      AssertJUnit.fail("Couldn't make a mapping for 3W5V to FER1_MAIZE");
     }
   }