-{"seqs":[{"name":"FER_CAPAN/3-34","start":3,"svid":"1.0","end":34,"id":"1665704504","seq":"SVSATMISTSFMPRKPAVTSL-KPIPNVGE--ALF","order":1},{"name":"FER1_SOLLC/3-34","start":3,"svid":"1.0","end":34,"id":"1003594867","seq":"SISGTMISTSFLPRKPAVTSL-KAISNVGE--ALF","order":2},{"name":"Q93XJ9_SOLTU/3-34","start":3,"svid":"1.0","end":34,"id":"1332961135","seq":"SISGTMISTSFLPRKPVVTSL-KAISNVGE--ALF","order":3},{"name":"FER1_PEA/6-37","start":6,"svid":"1.0","end":37,"id":"1335040546","seq":"ALYGTAVSTSFLRTQPMPMSV-TTTKAFSN--GFL","order":4},{"name":"Q7XA98_TRIPR/6-39","start":6,"svid":"1.0","end":39,"id":"1777084554","seq":"ALYGTAVSTSFMRRQPVPMSV-ATTTTTKAFPSGF","order":5},{"name":"FER_TOCH/3-34","start":3,"svid":"1.0","end":34,"id":"823528539","seq":"FILGTMISKSFLFRKPAVTSL-KAISNVGE--ALF","order":6}],"appSettings":{"globalColorScheme":"zappo","webStartUrl":"www.jalview.org/services/launchApp","application":"Jalview","hiddenSeqs":"823528539","showSeqFeatures":"true","version":"2.9","hiddenCols":"32-33;34-34"},"seqGroups":[{"displayText":true,"startRes":21,"groupName":"JGroup:1883305585","endRes":29,"colourText":false,"sequenceRefs":["1003594867","1332961135","1335040546","1777084554"],"svid":"1.0","showNonconserved":false,"colourScheme":"Zappo","displayBoxes":true}],"alignAnnotation":[{"svid":"1.0","annotations":[{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"α","value":0,"secondaryStructure":"H"},{"displayCharacter":"α","value":0,"secondaryStructure":"H"},{"displayCharacter":"α","value":0,"secondaryStructure":"H"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"β","value":0,"secondaryStructure":"E"},{"displayCharacter":"β","value":0,"secondaryStructure":"E"},{"displayCharacter":"β","value":0,"secondaryStructure":"E"},{"displayCharacter":"β","value":0,"secondaryStructure":"E"},{"displayCharacter":"β","value":0,"secondaryStructure":"E"},{"displayCharacter":"β","value":0,"secondaryStructure":"E"},{"displayCharacter":"β","value":0,"secondaryStructure":"E"},{"displayCharacter":"β","value":0,"secondaryStructure":"E"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"α","value":0,"secondaryStructure":"H"},{"displayCharacter":"α","value":0,"secondaryStructure":"H"},{"displayCharacter":"α","value":0,"secondaryStructure":"H"},{"displayCharacter":"α","value":0,"secondaryStructure":"H"},{"displayCharacter":"α","value":0,"secondaryStructure":"H"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"}],"description":"New description","label":"Secondary Structure"}],"svid":"1.0","seqFeatures":[{"fillColor":"#7d1633","score":0,"sequenceRef":"1332961135","featureGroup":"Jalview","svid":"1.0","description":"desciption","xStart":3,"xEnd":13,"type":"feature_x"},{"fillColor":"#7d1633","score":0,"sequenceRef":"1335040546","featureGroup":"Jalview","svid":"1.0","description":"desciption","xStart":3,"xEnd":13,"type":"feature_x"},{"fillColor":"#7d1633","score":0,"sequenceRef":"1777084554","featureGroup":"Jalview","svid":"1.0","description":"desciption","xStart":3,"xEnd":13,"type":"feature_x"}]}
\ No newline at end of file
+{"seqs":[{"name":"FER_CAPAN/3-34","start":3,"svid":"1.0","end":34,"id":"1665704504","seq":"SVSATMISTSFMPRKPAVTSL-KPIPNVGE--ALF","order":1},{"name":"FER1_SOLLC/3-34","start":3,"svid":"1.0","end":34,"id":"1003594867","seq":"SISGTMISTSFLPRKPAVTSL-KAISNVGE--ALF","order":2},{"name":"Q93XJ9_SOLTU/3-34","start":3,"svid":"1.0","end":34,"id":"1332961135","seq":"SISGTMISTSFLPRKPVVTSL-KAISNVGE--ALF","order":3},{"name":"FER1_PEA/6-37","start":6,"svid":"1.0","end":37,"id":"1335040546","seq":"ALYGTAVSTSFLRTQPMPMSV-TTTKAFSN--GFL","order":4},{"name":"Q7XA98_TRIPR/6-39","start":6,"svid":"1.0","end":39,"id":"1777084554","seq":"ALYGTAVSTSFMRRQPVPMSV-ATTTTTKAFPSGF","order":5},{"name":"FER_TOCH/3-34","start":3,"svid":"1.0","end":34,"id":"823528539","seq":"FILGTMISKSFLFRKPAVTSL-KAISNVGE--ALF","order":6}],"appSettings":{"globalColorScheme":"zappo","webStartUrl":"www.jalview.org/services/launchApp","application":"Jalview","hiddenSeqs":"823528539","showSeqFeatures":"true","version":"2.9","hiddenCols":"32-33;34-34"},"seqGroups":[{"displayText":true,"startRes":21,"groupName":"JGroup:1883305585","endRes":29,"colourText":false,"sequenceRefs":["1003594867","1332961135","1335040546","1777084554"],"svid":"1.0","showNonconserved":false,"colourScheme":"Zappo","displayBoxes":true}],"alignAnnotation":[{"svid":"1.0","annotations":[{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"α","value":0,"secondaryStructure":"H"},{"displayCharacter":"α","value":0,"secondaryStructure":"H"},{"displayCharacter":"α","value":0,"secondaryStructure":"H"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"β","value":0,"secondaryStructure":"E"},{"displayCharacter":"β","value":0,"secondaryStructure":"E"},{"displayCharacter":"β","value":0,"secondaryStructure":"E"},{"displayCharacter":"β","value":0,"secondaryStructure":"E"},{"displayCharacter":"β","value":0,"secondaryStructure":"E"},{"displayCharacter":"β","value":0,"secondaryStructure":"E"},{"displayCharacter":"β","value":0,"secondaryStructure":"E"},{"displayCharacter":"β","value":0,"secondaryStructure":"E"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"α","value":0,"secondaryStructure":"H"},{"displayCharacter":"α","value":0,"secondaryStructure":"H"},{"displayCharacter":"α","value":0,"secondaryStructure":"H"},{"displayCharacter":"α","value":0,"secondaryStructure":"H"},{"displayCharacter":"α","value":0,"secondaryStructure":"H"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"}],"description":"New description","label":"Secondary Structure"}],"svid":"1.0","seqFeatures":[{"fillColor":"#7d1633","score":0,"sequenceRef":"1332961135","featureGroup":"Pfam","svid":"1.0","description":"My description","xStart":0,"xEnd":0,"type":"Domain"},{"fillColor":"#7d1633","score":0,"sequenceRef":"1332961135","featureGroup":"Jalview","svid":"1.0","description":"desciption","xStart":3,"xEnd":13,"type":"feature_x"},{"fillColor":"#7d1633","score":0,"sequenceRef":"1335040546","featureGroup":"Jalview","svid":"1.0","description":"desciption","xStart":3,"xEnd":13,"type":"feature_x"},{"fillColor":"#7d1633","score":0,"sequenceRef":"1777084554","featureGroup":"Jalview","svid":"1.0","description":"desciption","xStart":3,"xEnd":13,"type":"feature_x"}]}
\ No newline at end of file
error.not_implemented = Not implemented
error.no_such_method_as_clone1_for = No such method as clone1 for {0}
error.null_from_clone1 = Null from clone1!
-error.implementation_error_sortbyfeature = Implementation Error - sortByFeature method must be one of FEATURE_SCORE, FEATURE_LABEL or FEATURE_DENSITY.
error.not_yet_implemented = Not yet implemented
error.unknown_type_dna_or_pep = Unknown Type {0} - dna or pep are the only allowed values.
error.implementation_error_dont_know_threshold_annotationcolourgradient = Implementation error: don't know about threshold setting for current AnnotationColourGradient.
error.not_implemented = No implementado
error.no_such_method_as_clone1_for = No existe ese método como un clone1 de {0}
error.null_from_clone1 = Nulo de clone1!
-error.implementation_error_sortbyfeature = Error de implementación - sortByFeature debe ser uno de FEATURE_SCORE, FEATURE_LABEL o FEATURE_DENSITY.
error.not_yet_implemented = No se ha implementado todavía
error.unknown_type_dna_or_pep = Tipo desconocido {0} - dna o pep son los únicos valores permitidos
error.implementation_error_dont_know_threshold_annotationcolourgradient = Error de implementación: no se conoce el valor umbral para el AnnotationColourGradient actual.
if (features[i].getFeatureGroup() != null
&& features[i].getFeatureGroup().equals(pdbid))
{
- SequenceFeature tx = new SequenceFeature(features[i]);
- tx.setBegin(1 + residues.elementAt(tx.getBegin() - offset).atoms
- .elementAt(0).alignmentMapping);
- tx.setEnd(1 + residues.elementAt(tx.getEnd() - offset).atoms
- .elementAt(0).alignmentMapping);
+ int newBegin = 1 + residues.elementAt(features[i].getBegin()
+ - offset).atoms
+ .elementAt(0).alignmentMapping;
+ int newEnd = 1 + residues.elementAt(features[i].getEnd() - offset).atoms
+ .elementAt(0).alignmentMapping;
+ SequenceFeature tx = new SequenceFeature(features[i], newBegin,
+ newEnd, features[i].getFeatureGroup());
tx.setStatus(status
+ ((tx.getStatus() == null || tx.getStatus().length() == 0) ? ""
: ":" + tx.getStatus()));
import jalview.datamodel.SequenceGroup;
import jalview.datamodel.SequenceI;
import jalview.datamodel.SequenceNode;
-import jalview.util.MessageManager;
import jalview.util.QuickSort;
import java.util.ArrayList;
-import java.util.Arrays;
+import java.util.Collections;
+import java.util.Iterator;
import java.util.List;
/**
*/
public class AlignmentSorter
{
- /**
+ /*
* todo: refactor searches to follow a basic pattern: (search property, last
* search state, current sort direction)
*/
static boolean sortTreeAscending = true;
- /**
- * last Annotation Label used by sortByScore
+ /*
+ * last Annotation Label used for sort by Annotation score
*/
- private static String lastSortByScore;
-
- private static boolean sortByScoreAscending = true;
+ private static String lastSortByAnnotation;
- /**
- * compact representation of last arguments to SortByFeatureScore
+ /*
+ * string hash of last arguments to sortByFeature
+ * (sort order toggles if this is unchanged between sorts)
*/
- private static String lastSortByFeatureScore;
+ private static String sortByFeatureCriteria;
- private static boolean sortByFeatureScoreAscending = true;
+ private static boolean sortByFeatureAscending = true;
private static boolean sortLengthAscending;
}
jalview.util.QuickSort.sort(scores, seqs);
- if (lastSortByScore != scoreLabel)
+ if (lastSortByAnnotation != scoreLabel)
{
- lastSortByScore = scoreLabel;
+ lastSortByAnnotation = scoreLabel;
setOrder(alignment, seqs);
}
else
public static String FEATURE_DENSITY = "density";
- /**
- * sort the alignment using the features on each sequence found between start
- * and stop with the given featureLabel (and optional group qualifier)
- *
- * @param featureLabel
- * (may not be null)
- * @param groupLabel
- * (may be null)
- * @param start
- * (-1 to include non-positional features)
- * @param stop
- * (-1 to only sort on non-positional features)
- * @param alignment
- * - aligned sequences containing features
- * @param method
- * - one of the string constants FEATURE_SCORE, FEATURE_LABEL,
- * FEATURE_DENSITY
- */
- public static void sortByFeature(String featureLabel, String groupLabel,
- int start, int stop, AlignmentI alignment, String method)
- {
- sortByFeature(
- featureLabel == null ? null
- : Arrays.asList(new String[] { featureLabel }),
- groupLabel == null ? null : Arrays
- .asList(new String[] { groupLabel }), start, stop,
- alignment, method);
- }
-
private static boolean containsIgnoreCase(final String lab,
final List<String> labs)
{
return false;
}
- public static void sortByFeature(List<String> featureLabels,
- List<String> groupLabels, int start, int stop,
+ /**
+ * Sort sequences by feature score or density, optionally restricted by
+ * feature types, feature groups, or alignment start/end positions.
+ * <p>
+ * If the sort is repeated for the same combination of types and groups, sort
+ * order is reversed.
+ *
+ * @param featureTypes
+ * a list of feature types to include (or null for all)
+ * @param groups
+ * a list of feature groups to include (or null for all)
+ * @param startCol
+ * start column position to include (base zero)
+ * @param endCol
+ * end column position to include (base zero)
+ * @param alignment
+ * the alignment to be sorted
+ * @param method
+ * either "average_score" or "density" ("text" not yet implemented)
+ */
+ public static void sortByFeature(List<String> featureTypes,
+ List<String> groups, final int startCol, final int endCol,
AlignmentI alignment, String method)
{
if (method != FEATURE_SCORE && method != FEATURE_LABEL
&& method != FEATURE_DENSITY)
{
- throw new Error(
- MessageManager
- .getString("error.implementation_error_sortbyfeature"));
- }
-
- boolean ignoreScore = method != FEATURE_SCORE;
- StringBuffer scoreLabel = new StringBuffer();
- scoreLabel.append(start + stop + method);
- // This doesn't quite work yet - we'd like to have a canonical ordering that
- // can be preserved from call to call
- if (featureLabels != null)
- {
- for (String label : featureLabels)
- {
- scoreLabel.append(label);
- }
- }
- if (groupLabels != null)
- {
- for (String label : groupLabels)
- {
- scoreLabel.append(label);
- }
+ String msg = String
+ .format("Implementation Error - sortByFeature method must be either '%s' or '%s'",
+ FEATURE_SCORE, FEATURE_DENSITY);
+ System.err.println(msg);
+ return;
}
- /*
- * if resorting the same feature, toggle sort order
- */
- if (lastSortByFeatureScore == null
- || !scoreLabel.toString().equals(lastSortByFeatureScore))
- {
- sortByFeatureScoreAscending = true;
- }
- else
- {
- sortByFeatureScoreAscending = !sortByFeatureScoreAscending;
- }
- lastSortByFeatureScore = scoreLabel.toString();
+ flipFeatureSortIfUnchanged(method, featureTypes, groups, startCol, endCol);
SequenceI[] seqs = alignment.getSequencesArray();
int hasScores = 0; // number of scores present on set
double[] scores = new double[seqs.length];
int[] seqScores = new int[seqs.length];
- Object[] feats = new Object[seqs.length];
- double min = 0, max = 0;
+ Object[][] feats = new Object[seqs.length][];
+ double min = 0d;
+ double max = 0d;
+
for (int i = 0; i < seqs.length; i++)
{
- SequenceFeature[] sf = seqs[i].getSequenceFeatures();
- if (sf == null)
- {
- sf = new SequenceFeature[0];
- }
- else
- {
- SequenceFeature[] tmp = new SequenceFeature[sf.length];
- for (int s = 0; s < tmp.length; s++)
- {
- tmp[s] = sf[s];
- }
- sf = tmp;
- }
- int sstart = (start == -1) ? start : seqs[i].findPosition(start);
- int sstop = (stop == -1) ? stop : seqs[i].findPosition(stop);
+ /*
+ * get sequence residues overlapping column region
+ * and features for residue positions and specified types
+ */
+ // TODO new method findPositions(startCol, endCol)? JAL-2544
+ int startResidue = seqs[i].findPosition(startCol);
+ int endResidue = seqs[i].findPosition(endCol);
+ String[] types = featureTypes == null ? null : featureTypes
+ .toArray(new String[featureTypes.size()]);
+ List<SequenceFeature> sfs = seqs[i].getFeatures().findFeatures(
+ startResidue, endResidue, types);
+
seqScores[i] = 0;
scores[i] = 0.0;
- int n = sf.length;
- for (int f = 0; f < sf.length; f++)
+
+ Iterator<SequenceFeature> it = sfs.listIterator();
+ while (it.hasNext())
{
- // filter for selection criteria
- SequenceFeature feature = sf[f];
+ SequenceFeature sf = it.next();
/*
* double-check feature overlaps columns (JAL-2544)
* (could avoid this with a findPositions(fromCol, toCol) method)
* findIndex returns base 1 column values, startCol/endCol are base 0
*/
- boolean noOverlap = seqs[i].findIndex(feature.getBegin()) > stop + 1
- || seqs[i].findIndex(feature.getEnd()) < start + 1;
- boolean skipFeatureType = featureLabels != null
- && !AlignmentSorter.containsIgnoreCase(feature.type,
- featureLabels);
- boolean skipFeatureGroup = groupLabels != null
- && (feature.getFeatureGroup() != null && !AlignmentSorter
- .containsIgnoreCase(feature.getFeatureGroup(),
- groupLabels));
- if (noOverlap || skipFeatureType || skipFeatureGroup)
+ if (seqs[i].findIndex(sf.getBegin()) > endCol + 1
+ || seqs[i].findIndex(sf.getEnd()) < startCol + 1)
+ {
+ it.remove();
+ continue;
+ }
+
+ String featureGroup = sf.getFeatureGroup();
+ if (groups != null && featureGroup != null
+ && !groups.contains(featureGroup))
{
- // forget about this feature
- sf[f] = null;
- n--;
+ it.remove();
}
else
{
- // or, also take a look at the scores if necessary.
- if (!ignoreScore && !Float.isNaN(feature.getScore()))
+ float score = sf.getScore();
+ if (FEATURE_SCORE.equals(method) && !Float.isNaN(score))
{
if (seqScores[i] == 0)
{
}
seqScores[i]++;
hasScore[i] = true;
- scores[i] += feature.getScore(); // take the first instance of this
- // score.
+ scores[i] += score;
+ // take the first instance of this score // ??
}
}
}
- SequenceFeature[] fs;
- feats[i] = fs = new SequenceFeature[n];
- if (n > 0)
+
+ feats[i] = sfs.toArray(new SequenceFeature[sfs.size()]);
+ if (!sfs.isEmpty())
{
- n = 0;
- for (int f = 0; f < sf.length; f++)
- {
- if (sf[f] != null)
- {
- ((SequenceFeature[]) feats[i])[n++] = sf[f];
- }
- }
if (method == FEATURE_LABEL)
{
- // order the labels by alphabet
- String[] labs = new String[fs.length];
- for (int l = 0; l < labs.length; l++)
+ // order the labels by alphabet (not yet implemented)
+ String[] labs = new String[sfs.size()];
+ for (int l = 0; l < sfs.size(); l++)
{
- labs[l] = (fs[l].getDescription() != null ? fs[l]
- .getDescription() : fs[l].getType());
+ SequenceFeature sf = sfs.get(l);
+ String description = sf.getDescription();
+ labs[l] = (description != null ? description : sf.getType());
}
- QuickSort.sort(labs, ((Object[]) feats[i]));
+ QuickSort.sort(labs, feats[i]);
}
}
if (hasScore[i])
// update the score bounds.
if (hasScores == 1)
{
- max = min = scores[i];
+ min = scores[i];
+ max = min;
}
else
{
- if (max < scores[i])
- {
- max = scores[i];
- }
- if (min > scores[i])
- {
- min = scores[i];
- }
+ max = Math.max(max, scores[i]);
+ min = Math.min(min, scores[i]);
}
}
}
- if (method == FEATURE_SCORE)
+ if (FEATURE_SCORE.equals(method))
{
if (hasScores == 0)
{
}
}
}
- QuickSort.sortByDouble(scores, seqs, sortByFeatureScoreAscending);
+ QuickSort.sortByDouble(scores, seqs, sortByFeatureAscending);
}
- else if (method == FEATURE_DENSITY)
+ else if (FEATURE_DENSITY.equals(method))
{
for (int i = 0; i < seqs.length; i++)
{
// System.err.println("Sorting on Density: seq "+seqs[i].getName()+
// " Feats: "+featureCount+" Score : "+scores[i]);
}
- QuickSort.sortByDouble(scores, seqs, sortByFeatureScoreAscending);
+ QuickSort.sortByDouble(scores, seqs, sortByFeatureAscending);
}
- else
+
+ setOrder(alignment, seqs);
+ }
+
+ /**
+ * Builds a string hash of criteria for sorting, and if unchanged from last
+ * time, reverse the sort order
+ *
+ * @param method
+ * @param featureTypes
+ * @param groups
+ * @param startCol
+ * @param endCol
+ */
+ protected static void flipFeatureSortIfUnchanged(String method,
+ List<String> featureTypes, List<String> groups,
+ final int startCol, final int endCol)
+ {
+ StringBuilder sb = new StringBuilder(64);
+ sb.append(startCol).append(method).append(endCol);
+ if (featureTypes != null)
{
- if (method == FEATURE_LABEL)
- {
- throw new Error(
- MessageManager.getString("error.not_yet_implemented"));
- }
+ Collections.sort(featureTypes);
+ sb.append(featureTypes.toString());
}
+ if (groups != null)
+ {
+ Collections.sort(groups);
+ sb.append(groups.toString());
+ }
+ String scoreCriteria = sb.toString();
- setOrder(alignment, seqs);
+ /*
+ * if resorting on the same criteria, toggle sort order
+ */
+ if (sortByFeatureCriteria == null
+ || !scoreCriteria.equals(sortByFeatureCriteria))
+ {
+ sortByFeatureAscending = true;
+ }
+ else
+ {
+ sortByFeatureAscending = !sortByFeatureAscending;
+ }
+ sortByFeatureCriteria = scoreCriteria;
}
}
import jalview.datamodel.SequenceFeature;
import jalview.datamodel.SequenceGroup;
import jalview.datamodel.SequenceI;
-import jalview.io.gff.SequenceOntologyFactory;
+import jalview.datamodel.features.SequenceFeatures;
import jalview.io.gff.SequenceOntologyI;
import jalview.schemes.ResidueProperties;
import jalview.util.Comparison;
import jalview.util.DBRefUtils;
+import jalview.util.IntRangeComparator;
import jalview.util.MapList;
import jalview.util.MappingUtils;
-import jalview.util.RangeComparator;
import jalview.util.StringUtils;
import java.io.UnsupportedEncodingException;
import java.util.Arrays;
import java.util.Collection;
import java.util.Collections;
-import java.util.Comparator;
import java.util.HashMap;
import java.util.HashSet;
import java.util.Iterator;
*
* @param fromSeq
* @param toSeq
+ * @param mapping
+ * the mapping from 'fromSeq' to 'toSeq'
* @param select
* if not null, only features of this type are copied (including
* subtypes in the Sequence Ontology)
- * @param mapping
- * the mapping from 'fromSeq' to 'toSeq'
* @param omitting
*/
public static int transferFeatures(SequenceI fromSeq, SequenceI toSeq,
copyTo = copyTo.getDatasetSequence();
}
- SequenceOntologyI so = SequenceOntologyFactory.getInstance();
+ /*
+ * get features, optionally restricted by an ontology term
+ */
+ List<SequenceFeature> sfs = select == null ? fromSeq.getFeatures()
+ .getPositionalFeatures() : fromSeq.getFeatures()
+ .getFeaturesByOntology(select);
+
int count = 0;
- SequenceFeature[] sfs = fromSeq.getSequenceFeatures();
- if (sfs != null)
+ for (SequenceFeature sf : sfs)
{
- for (SequenceFeature sf : sfs)
+ String type = sf.getType();
+ boolean omit = false;
+ for (String toOmit : omitting)
{
- String type = sf.getType();
- if (select != null && !so.isA(type, select))
+ if (type.equals(toOmit))
{
- continue;
- }
- boolean omit = false;
- for (String toOmit : omitting)
- {
- if (type.equals(toOmit))
- {
- omit = true;
- }
- }
- if (omit)
- {
- continue;
+ omit = true;
}
+ }
+ if (omit)
+ {
+ continue;
+ }
- /*
- * locate the mapped range - null if either start or end is
- * not mapped (no partial overlaps are calculated)
- */
- int start = sf.getBegin();
- int end = sf.getEnd();
- int[] mappedTo = mapping.locateInTo(start, end);
- /*
- * if whole exon range doesn't map, try interpreting it
- * as 5' or 3' exon overlapping the CDS range
- */
- if (mappedTo == null)
- {
- mappedTo = mapping.locateInTo(end, end);
- if (mappedTo != null)
- {
- /*
- * end of exon is in CDS range - 5' overlap
- * to a range from the start of the peptide
- */
- mappedTo[0] = 1;
- }
- }
- if (mappedTo == null)
+ /*
+ * locate the mapped range - null if either start or end is
+ * not mapped (no partial overlaps are calculated)
+ */
+ int start = sf.getBegin();
+ int end = sf.getEnd();
+ int[] mappedTo = mapping.locateInTo(start, end);
+ /*
+ * if whole exon range doesn't map, try interpreting it
+ * as 5' or 3' exon overlapping the CDS range
+ */
+ if (mappedTo == null)
+ {
+ mappedTo = mapping.locateInTo(end, end);
+ if (mappedTo != null)
{
- mappedTo = mapping.locateInTo(start, start);
- if (mappedTo != null)
- {
- /*
- * start of exon is in CDS range - 3' overlap
- * to a range up to the end of the peptide
- */
- mappedTo[1] = toSeq.getLength();
- }
+ /*
+ * end of exon is in CDS range - 5' overlap
+ * to a range from the start of the peptide
+ */
+ mappedTo[0] = 1;
}
+ }
+ if (mappedTo == null)
+ {
+ mappedTo = mapping.locateInTo(start, start);
if (mappedTo != null)
{
- SequenceFeature copy = new SequenceFeature(sf);
- copy.setBegin(Math.min(mappedTo[0], mappedTo[1]));
- copy.setEnd(Math.max(mappedTo[0], mappedTo[1]));
- copyTo.addSequenceFeature(copy);
- count++;
+ /*
+ * start of exon is in CDS range - 3' overlap
+ * to a range up to the end of the peptide
+ */
+ mappedTo[1] = toSeq.getLength();
}
}
+ if (mappedTo != null)
+ {
+ int newBegin = Math.min(mappedTo[0], mappedTo[1]);
+ int newEnd = Math.max(mappedTo[0], mappedTo[1]);
+ SequenceFeature copy = new SequenceFeature(sf, newBegin, newEnd,
+ sf.getFeatureGroup());
+ copyTo.addSequenceFeature(copy);
+ count++;
+ }
}
return count;
}
public static List<int[]> findCdsPositions(SequenceI dnaSeq)
{
List<int[]> result = new ArrayList<int[]>();
- SequenceFeature[] sfs = dnaSeq.getSequenceFeatures();
- if (sfs == null)
+
+ List<SequenceFeature> sfs = dnaSeq.getFeatures().getFeaturesByOntology(
+ SequenceOntologyI.CDS);
+ if (sfs.isEmpty())
{
return result;
}
-
- SequenceOntologyI so = SequenceOntologyFactory.getInstance();
+ SequenceFeatures.sortFeatures(sfs, true);
int startPhase = 0;
for (SequenceFeature sf : sfs)
{
+ int phase = 0;
+ try
+ {
+ phase = Integer.parseInt(sf.getPhase());
+ } catch (NumberFormatException e)
+ {
+ // ignore
+ }
/*
- * process a CDS feature (or a sub-type of CDS)
+ * phase > 0 on first codon means 5' incomplete - skip to the start
+ * of the next codon; example ENST00000496384
*/
- if (so.isA(sf.getType(), SequenceOntologyI.CDS))
+ int begin = sf.getBegin();
+ int end = sf.getEnd();
+ if (result.isEmpty())
{
- int phase = 0;
- try
+ begin += phase;
+ if (begin > end)
{
- phase = Integer.parseInt(sf.getPhase());
- } catch (NumberFormatException e)
- {
- // ignore
- }
- /*
- * phase > 0 on first codon means 5' incomplete - skip to the start
- * of the next codon; example ENST00000496384
- */
- int begin = sf.getBegin();
- int end = sf.getEnd();
- if (result.isEmpty())
- {
- begin += phase;
- if (begin > end)
- {
- // shouldn't happen!
- System.err
- .println("Error: start phase extends beyond start CDS in "
- + dnaSeq.getName());
- }
+ // shouldn't happen!
+ System.err
+ .println("Error: start phase extends beyond start CDS in "
+ + dnaSeq.getName());
}
- result.add(new int[] { begin, end });
}
+ result.add(new int[] { begin, end });
}
/*
* ranges are assembled in order. Other cases should not use this method,
* but instead construct an explicit mapping for CDS (e.g. EMBL parsing).
*/
- Collections.sort(result, new RangeComparator(true));
+ Collections.sort(result, IntRangeComparator.ASCENDING);
return result;
}
count += computePeptideVariants(peptide, peptidePos, codonVariants);
}
- /*
- * sort to get sequence features in start position order
- * - would be better to store in Sequence as a TreeSet or NCList?
- */
- if (peptide.getSequenceFeatures() != null)
- {
- Arrays.sort(peptide.getSequenceFeatures(),
- new Comparator<SequenceFeature>()
- {
- @Override
- public int compare(SequenceFeature o1, SequenceFeature o2)
- {
- int c = Integer.compare(o1.getBegin(), o2.getBegin());
- return c == 0 ? Integer.compare(o1.getEnd(), o2.getEnd())
- : c;
- }
- });
- }
return count;
}
* LinkedHashMap ensures we keep the peptide features in sequence order
*/
LinkedHashMap<Integer, List<DnaVariant>[]> variants = new LinkedHashMap<Integer, List<DnaVariant>[]>();
- SequenceOntologyI so = SequenceOntologyFactory.getInstance();
- SequenceFeature[] dnaFeatures = dnaSeq.getSequenceFeatures();
- if (dnaFeatures == null)
+ List<SequenceFeature> dnaFeatures = dnaSeq.getFeatures()
+ .getFeaturesByOntology(SequenceOntologyI.SEQUENCE_VARIANT);
+ if (dnaFeatures.isEmpty())
{
return variants;
}
// not handling multi-locus variant features
continue;
}
- if (so.isA(sf.getType(), SequenceOntologyI.SEQUENCE_VARIANT))
+ int[] mapsTo = dnaToProtein.locateInTo(dnaCol, dnaCol);
+ if (mapsTo == null)
{
- int[] mapsTo = dnaToProtein.locateInTo(dnaCol, dnaCol);
- if (mapsTo == null)
- {
- // feature doesn't lie within coding region
- continue;
- }
- int peptidePosition = mapsTo[0];
- List<DnaVariant>[] codonVariants = variants.get(peptidePosition);
- if (codonVariants == null)
- {
- codonVariants = new ArrayList[CODON_LENGTH];
- codonVariants[0] = new ArrayList<DnaVariant>();
- codonVariants[1] = new ArrayList<DnaVariant>();
- codonVariants[2] = new ArrayList<DnaVariant>();
- variants.put(peptidePosition, codonVariants);
- }
+ // feature doesn't lie within coding region
+ continue;
+ }
+ int peptidePosition = mapsTo[0];
+ List<DnaVariant>[] codonVariants = variants.get(peptidePosition);
+ if (codonVariants == null)
+ {
+ codonVariants = new ArrayList[CODON_LENGTH];
+ codonVariants[0] = new ArrayList<DnaVariant>();
+ codonVariants[1] = new ArrayList<DnaVariant>();
+ codonVariants[2] = new ArrayList<DnaVariant>();
+ variants.put(peptidePosition, codonVariants);
+ }
- /*
- * extract dna variants to a string array
- */
- String alls = (String) sf.getValue("alleles");
- if (alls == null)
- {
- continue;
- }
- String[] alleles = alls.toUpperCase().split(",");
- int i = 0;
- for (String allele : alleles)
- {
- alleles[i++] = allele.trim(); // lose any space characters "A, G"
- }
+ /*
+ * extract dna variants to a string array
+ */
+ String alls = (String) sf.getValue("alleles");
+ if (alls == null)
+ {
+ continue;
+ }
+ String[] alleles = alls.toUpperCase().split(",");
+ int i = 0;
+ for (String allele : alleles)
+ {
+ alleles[i++] = allele.trim(); // lose any space characters "A, G"
+ }
- /*
- * get this peptide's codon positions e.g. [3, 4, 5] or [4, 7, 10]
- */
- int[] codon = peptidePosition == lastPeptidePostion ? lastCodon
- : MappingUtils.flattenRanges(dnaToProtein.locateInFrom(
- peptidePosition, peptidePosition));
- lastPeptidePostion = peptidePosition;
- lastCodon = codon;
+ /*
+ * get this peptide's codon positions e.g. [3, 4, 5] or [4, 7, 10]
+ */
+ int[] codon = peptidePosition == lastPeptidePostion ? lastCodon
+ : MappingUtils.flattenRanges(dnaToProtein.locateInFrom(
+ peptidePosition, peptidePosition));
+ lastPeptidePostion = peptidePosition;
+ lastCodon = codon;
- /*
- * save nucleotide (and any variant) for each codon position
- */
- for (int codonPos = 0; codonPos < CODON_LENGTH; codonPos++)
+ /*
+ * save nucleotide (and any variant) for each codon position
+ */
+ for (int codonPos = 0; codonPos < CODON_LENGTH; codonPos++)
+ {
+ String nucleotide = String.valueOf(
+ dnaSeq.getCharAt(codon[codonPos] - dnaStart)).toUpperCase();
+ List<DnaVariant> codonVariant = codonVariants[codonPos];
+ if (codon[codonPos] == dnaCol)
{
- String nucleotide = String.valueOf(
- dnaSeq.getCharAt(codon[codonPos] - dnaStart))
- .toUpperCase();
- List<DnaVariant> codonVariant = codonVariants[codonPos];
- if (codon[codonPos] == dnaCol)
+ if (!codonVariant.isEmpty()
+ && codonVariant.get(0).variant == null)
{
- if (!codonVariant.isEmpty()
- && codonVariant.get(0).variant == null)
- {
- /*
- * already recorded base value, add this variant
- */
- codonVariant.get(0).variant = sf;
- }
- else
- {
- /*
- * add variant with base value
- */
- codonVariant.add(new DnaVariant(nucleotide, sf));
- }
+ /*
+ * already recorded base value, add this variant
+ */
+ codonVariant.get(0).variant = sf;
}
- else if (codonVariant.isEmpty())
+ else
{
/*
- * record (possibly non-varying) base value
+ * add variant with base value
*/
- codonVariant.add(new DnaVariant(nucleotide));
+ codonVariant.add(new DnaVariant(nucleotide, sf));
}
}
+ else if (codonVariant.isEmpty())
+ {
+ /*
+ * record (possibly non-varying) base value
+ */
+ codonVariant.add(new DnaVariant(nucleotide));
+ }
}
}
return variants;
import jalview.util.MessageManager;
import java.util.ArrayList;
+import java.util.HashMap;
import java.util.Hashtable;
import java.util.List;
+import java.util.Map;
import java.util.Stack;
-import java.util.Vector;
public class Rna
{
* @return
* @throw {@link WUSSParseException}
*/
- public static Vector<SimpleBP> getSimpleBPs(CharSequence line)
+ protected static List<SimpleBP> getSimpleBPs(CharSequence line)
throws WUSSParseException
{
Hashtable<Character, Stack<Integer>> stacks = new Hashtable<Character, Stack<Integer>>();
- Vector<SimpleBP> pairs = new Vector<SimpleBP>();
+ List<SimpleBP> pairs = new ArrayList<SimpleBP>();
int i = 0;
while (i < line.length())
{
return pairs;
}
- public static SequenceFeature[] getBasePairs(List<SimpleBP> bps)
- throws WUSSParseException
- {
- SequenceFeature[] outPairs = new SequenceFeature[bps.size()];
- for (int p = 0; p < bps.size(); p++)
- {
- SimpleBP bp = bps.get(p);
- outPairs[p] = new SequenceFeature("RNA helix", "", "", bp.getBP5(),
- bp.getBP3(), "");
- }
- return outPairs;
- }
+
- public static List<SimpleBP> getModeleBP(CharSequence line)
- throws WUSSParseException
- {
- Vector<SimpleBP> bps = getSimpleBPs(line);
- return new ArrayList<SimpleBP>(bps);
- }
+
/**
* Function to get the end position corresponding to a given start position
*/
/**
- * Figures out which helix each position belongs to and stores the helix
- * number in the 'featureGroup' member of a SequenceFeature Based off of RALEE
- * code ralee-helix-map.
- *
- * @param pairs
- * Array of SequenceFeature (output from Rna.GetBasePairs)
- */
- public static void HelixMap(SequenceFeature[] pairs)
- {
-
- int helix = 0; // Number of helices/current helix
- int lastopen = 0; // Position of last open bracket reviewed
- int lastclose = 9999999; // Position of last close bracket reviewed
- int i = pairs.length; // Number of pairs
-
- int open; // Position of an open bracket under review
- int close; // Position of a close bracket under review
- int j; // Counter
-
- Hashtable<Integer, Integer> helices = new Hashtable<Integer, Integer>();
- // Keep track of helix number for each position
-
- // Go through each base pair and assign positions a helix
- for (i = 0; i < pairs.length; i++)
- {
-
- open = pairs[i].getBegin();
- close = pairs[i].getEnd();
-
- // System.out.println("open " + open + " close " + close);
- // System.out.println("lastclose " + lastclose + " lastopen " + lastopen);
-
- // we're moving from right to left based on closing pair
- /*
- * catch things like <<..>>..<<..>> |
- */
- if (open > lastclose)
- {
- helix++;
- }
-
- /*
- * catch things like <<..<<..>>..<<..>>>> |
- */
- j = pairs.length - 1;
- while (j >= 0)
- {
- int popen = pairs[j].getBegin();
-
- // System.out.println("j " + j + " popen " + popen + " lastopen "
- // +lastopen + " open " + open);
- if ((popen < lastopen) && (popen > open))
- {
- if (helices.containsValue(popen)
- && ((helices.get(popen)) == helix))
- {
- continue;
- }
- else
- {
- helix++;
- break;
- }
- }
-
- j -= 1;
- }
-
- // Put positions and helix information into the hashtable
- helices.put(open, helix);
- helices.put(close, helix);
-
- // Record helix as featuregroup
- pairs[i].setFeatureGroup(Integer.toString(helix));
-
- lastopen = open;
- lastclose = close;
-
- }
- }
-
- /**
* Answers true if the character is a recognised symbol for RNA secondary
* structure. Currently accepts a-z, A-Z, ()[]{}<>.
*
return c;
}
}
+
+ public static SequenceFeature[] getHelixMap(CharSequence rnaAnnotation)
+ throws WUSSParseException
+ {
+ List<SequenceFeature> result = new ArrayList<SequenceFeature>();
+
+ int helix = 0; // Number of helices/current helix
+ int lastopen = 0; // Position of last open bracket reviewed
+ int lastclose = 9999999; // Position of last close bracket reviewed
+
+ Map<Integer, Integer> helices = new HashMap<Integer, Integer>();
+ // Keep track of helix number for each position
+
+ // Go through each base pair and assign positions a helix
+ List<SimpleBP> bps = getSimpleBPs(rnaAnnotation);
+ for (SimpleBP basePair : bps)
+ {
+ final int open = basePair.getBP5();
+ final int close = basePair.getBP3();
+
+ // System.out.println("open " + open + " close " + close);
+ // System.out.println("lastclose " + lastclose + " lastopen " + lastopen);
+
+ // we're moving from right to left based on closing pair
+ /*
+ * catch things like <<..>>..<<..>> |
+ */
+ if (open > lastclose)
+ {
+ helix++;
+ }
+
+ /*
+ * catch things like <<..<<..>>..<<..>>>> |
+ */
+ int j = bps.size() - 1;
+ while (j >= 0)
+ {
+ int popen = bps.get(j).getBP5();
+
+ // System.out.println("j " + j + " popen " + popen + " lastopen "
+ // +lastopen + " open " + open);
+ if ((popen < lastopen) && (popen > open))
+ {
+ if (helices.containsValue(popen)
+ && ((helices.get(popen)) == helix))
+ {
+ continue;
+ }
+ else
+ {
+ helix++;
+ break;
+ }
+ }
+ j -= 1;
+ }
+
+ // Put positions and helix information into the hashtable
+ helices.put(open, helix);
+ helices.put(close, helix);
+
+ // Record helix as featuregroup
+ result.add(new SequenceFeature("RNA helix", "", "", open, close,
+ String.valueOf(helix)));
+
+ lastopen = open;
+ lastclose = close;
+ }
+
+ return result.toArray(new SequenceFeature[result.size()]);
+ }
}
package jalview.api;
import java.util.Collection;
-import java.util.Iterator;
+import java.util.Set;
public interface FeaturesDisplayedI
{
- Iterator<String> getVisibleFeatures();
+ /**
+ * answers an unmodifiable view of the set of visible feature types
+ */
+ Set<String> getVisibleFeatures();
boolean isVisible(String featureType);
void setVisible(String featureType);
+ /**
+ * Sets all the specified feature types to visible. Visibility of other
+ * feature types is not changed.
+ *
+ * @param featureTypes
+ */
void setAllVisible(Collection<String> featureTypes);
boolean isRegistered(String type);
import jalview.api.FeatureColourI;
import jalview.api.FeatureSettingsControllerI;
import jalview.datamodel.AlignmentI;
-import jalview.datamodel.SequenceFeature;
+import jalview.datamodel.SequenceI;
import jalview.util.MessageManager;
import java.awt.BorderLayout;
import java.awt.event.MouseMotionListener;
import java.awt.event.WindowAdapter;
import java.awt.event.WindowEvent;
+import java.util.ArrayList;
import java.util.Arrays;
-import java.util.Enumeration;
import java.util.HashSet;
import java.util.List;
import java.util.Map;
import java.util.Set;
-import java.util.Vector;
public class FeatureSettings extends Panel implements ItemListener,
MouseListener, MouseMotionListener, ActionListener,
// Group selection states
void resetTable(boolean groupsChanged)
{
- SequenceFeature[] tmpfeatures;
- String group = null, type;
- Vector<String> visibleChecks = new Vector<String>();
+ List<String> displayableTypes = new ArrayList<String>();
Set<String> foundGroups = new HashSet<String>();
+
AlignmentI alignment = av.getAlignment();
for (int i = 0; i < alignment.getHeight(); i++)
{
- if (alignment.getSequenceAt(i).getSequenceFeatures() == null)
- {
- continue;
- }
+ SequenceI seq = alignment.getSequenceAt(i);
- tmpfeatures = alignment.getSequenceAt(i).getSequenceFeatures();
- int index = 0;
- while (index < tmpfeatures.length)
+ /*
+ * get the sequence's groups for positional features
+ * and keep track of which groups are visible
+ */
+ Set<String> groups = seq.getFeatures().getFeatureGroups(true);
+ Set<String> visibleGroups = new HashSet<String>();
+ for (String group : groups)
{
- group = tmpfeatures[index].featureGroup;
- foundGroups.add(group);
-
- if (group == null || checkGroupState(group))
+ if (group == null || fr.checkGroupVisibility(group, true))
{
- type = tmpfeatures[index].getType();
- if (!visibleChecks.contains(type))
- {
- visibleChecks.addElement(type);
- }
+ visibleGroups.add(group);
}
- index++;
}
+
+ /*
+ * get distinct feature types for visible groups
+ * record distinct visible types
+ */
+ Set<String> types = seq.getFeatures().getFeatureTypesForGroups(true,
+ visibleGroups.toArray(new String[visibleGroups.size()]));
+ displayableTypes.addAll(types);
}
/*
{
comps = featurePanel.getComponents();
check = (MyCheckbox) comps[i];
- if (!visibleChecks.contains(check.type))
+ if (!displayableTypes.contains(check.type))
{
featurePanel.remove(i);
cSize--;
{
String item = rol.get(ro);
- if (!visibleChecks.contains(item))
+ if (!displayableTypes.contains(item))
{
continue;
}
- visibleChecks.removeElement(item);
+ displayableTypes.remove(item);
addCheck(false, item);
}
}
- // now add checkboxes which should be visible,
- // if they have not already been added
- Enumeration<String> en = visibleChecks.elements();
-
- while (en.hasMoreElements())
+ /*
+ * now add checkboxes which should be visible,
+ * if they have not already been added
+ */
+ for (String type : displayableTypes)
{
- addCheck(groupsChanged, en.nextElement().toString());
+ addCheck(groupsChanged, type);
}
featurePanel.setLayout(new GridLayout(featurePanel.getComponentCount(),
*/
package jalview.appletgui;
-import jalview.datamodel.Sequence;
import jalview.datamodel.SequenceFeature;
import jalview.datamodel.SequenceGroup;
import jalview.datamodel.SequenceI;
UrlProviderI urlProvider = null;
- public IdPanel(AlignViewport av, AlignmentPanel parent)
+ public IdPanel(AlignViewport viewport, AlignmentPanel parent)
{
- this.av = av;
+ this.av = viewport;
alignPanel = parent;
- idCanvas = new IdCanvas(av);
+ idCanvas = new IdCanvas(viewport);
setLayout(new BorderLayout());
add(idCanvas, BorderLayout.CENTER);
idCanvas.addMouseListener(this);
// make a list of label,url pairs
HashMap<String, String> urlList = new HashMap<String, String>();
- if (av.applet != null)
+ if (viewport.applet != null)
{
for (int i = 1; i < 10; i++)
{
- label = av.applet.getParameter("linkLabel_" + i);
- url = av.applet.getParameter("linkURL_" + i);
+ label = viewport.applet.getParameter("linkLabel_" + i);
+ url = viewport.applet.getParameter("linkURL_" + i);
// only add non-null parameters
if (label != null)
if (!urlList.isEmpty())
{
// set default as first entry in list
- String defaultUrl = av.applet.getParameter("linkLabel_1");
+ String defaultUrl = viewport.applet.getParameter("linkLabel_1");
UrlProviderFactoryI factory = new AppletUrlProviderFactory(
defaultUrl, urlList);
urlProvider = factory.createUrlProvider();
SequenceI sequence = av.getAlignment().getSequenceAt(seq);
- // look for non-pos features
StringBuffer tooltiptext = new StringBuffer();
- if (sequence != null)
+ if (sequence == null)
{
- if (sequence.getDescription() != null)
+ return;
+ }
+ if (sequence.getDescription() != null)
+ {
+ tooltiptext.append(sequence.getDescription());
+ tooltiptext.append("\n");
+ }
+
+ for (SequenceFeature sf : sequence.getFeatures()
+ .getNonPositionalFeatures())
+ {
+ boolean nl = false;
+ if (sf.getFeatureGroup() != null)
{
- tooltiptext.append(sequence.getDescription());
- tooltiptext.append("\n");
+ tooltiptext.append(sf.getFeatureGroup());
+ nl = true;
}
-
- SequenceFeature sf[] = sequence.getSequenceFeatures();
- for (int sl = 0; sf != null && sl < sf.length; sl++)
+ if (sf.getType() != null)
{
- if (sf[sl].begin == sf[sl].end && sf[sl].begin == 0)
- {
- boolean nl = false;
- if (sf[sl].getFeatureGroup() != null)
- {
- tooltiptext.append(sf[sl].getFeatureGroup());
- nl = true;
- }
- ;
- if (sf[sl].getType() != null)
- {
- tooltiptext.append(" ");
- tooltiptext.append(sf[sl].getType());
- nl = true;
- }
- ;
- if (sf[sl].getDescription() != null)
- {
- tooltiptext.append(" ");
- tooltiptext.append(sf[sl].getDescription());
- nl = true;
- }
- ;
- if (!Float.isNaN(sf[sl].getScore()) && sf[sl].getScore() != 0f)
- {
- tooltiptext.append(" Score = ");
- tooltiptext.append(sf[sl].getScore());
- nl = true;
- }
- ;
- if (sf[sl].getStatus() != null && sf[sl].getStatus().length() > 0)
- {
- tooltiptext.append(" (");
- tooltiptext.append(sf[sl].getStatus());
- tooltiptext.append(")");
- nl = true;
- }
- ;
- if (nl)
- {
- tooltiptext.append("\n");
- }
- }
+ tooltiptext.append(" ");
+ tooltiptext.append(sf.getType());
+ nl = true;
+ }
+ if (sf.getDescription() != null)
+ {
+ tooltiptext.append(" ");
+ tooltiptext.append(sf.getDescription());
+ nl = true;
+ }
+ if (!Float.isNaN(sf.getScore()) && sf.getScore() != 0f)
+ {
+ tooltiptext.append(" Score = ");
+ tooltiptext.append(sf.getScore());
+ nl = true;
+ }
+ if (sf.getStatus() != null && sf.getStatus().length() > 0)
+ {
+ tooltiptext.append(" (");
+ tooltiptext.append(sf.getStatus());
+ tooltiptext.append(")");
+ nl = true;
+ }
+ if (nl)
+ {
+ tooltiptext.append("\n");
}
}
+
if (tooltiptext.length() == 0)
{
// nothing to display - so clear tooltip if one is visible
if ((e.getModifiers() & InputEvent.BUTTON3_MASK) == InputEvent.BUTTON3_MASK)
{
- Sequence sq = (Sequence) av.getAlignment().getSequenceAt(seq);
+ SequenceI sq = av.getAlignment().getSequenceAt(seq);
- // build a new links menu based on the current links + any non-positional
- // features
+ /*
+ * build a new links menu based on the current links
+ * and any non-positional features
+ */
List<String> nlinks;
if (urlProvider != null)
{
{
nlinks = new ArrayList<String>();
}
- SequenceFeature sf[] = sq == null ? null : sq.getSequenceFeatures();
- for (int sl = 0; sf != null && sl < sf.length; sl++)
+
+ for (SequenceFeature sf : sq.getFeatures().getNonPositionalFeatures())
{
- if (sf[sl].begin == sf[sl].end && sf[sl].begin == 0)
+ if (sf.links != null)
{
- if (sf[sl].links != null && sf[sl].links.size() > 0)
+ for (String link : sf.links)
{
- for (int l = 0, lSize = sf[sl].links.size(); l < lSize; l++)
- {
- nlinks.add(sf[sl].links.elementAt(l));
- }
+ nlinks.add(link);
}
}
}
boolean up = true;
- public ScrollThread(boolean up)
+ public ScrollThread(boolean isUp)
{
- this.up = up;
+ this.up = isUp;
start();
}
import java.awt.event.MouseEvent;
import java.awt.event.MouseListener;
import java.awt.event.MouseMotionListener;
+import java.util.List;
import java.util.Vector;
public class SeqPanel extends Panel implements MouseMotionListener,
av.setSelectionGroup(null);
}
- SequenceFeature[] features = findFeaturesAtRes(sequence,
+ List<SequenceFeature> features = findFeaturesAtRes(sequence,
sequence.findPosition(findRes(evt)));
- if (features != null && features.length > 0)
+ if (!features.isEmpty())
{
SearchResultsI highlight = new SearchResults();
- highlight.addResult(sequence, features[0].getBegin(),
- features[0].getEnd());
+ highlight.addResult(sequence, features.get(0).getBegin(), features
+ .get(0).getEnd());
seqCanvas.highlightSearchResults(highlight);
- }
- if (features != null && features.length > 0)
- {
+ SequenceFeature[] featuresArray = features
+ .toArray(new SequenceFeature[features.size()]);
seqCanvas.getFeatureRenderer().amendFeatures(
- new SequenceI[] { sequence }, features, false, ap);
+ new SequenceI[] { sequence }, featuresArray, false, ap);
seqCanvas.highlightSearchResults(null);
}
}
// use aa to see if the mouse pointer is on a
- SequenceFeature[] allFeatures = findFeaturesAtRes(sequence,
+ List<SequenceFeature> allFeatures = findFeaturesAtRes(sequence,
sequence.findPosition(res));
int index = 0;
- while (index < allFeatures.length)
+ while (index < allFeatures.size())
{
- SequenceFeature sf = allFeatures[index];
+ SequenceFeature sf = allFeatures.get(index);
tooltipText.append(sf.getType() + " " + sf.begin + ":" + sf.end);
}
}
- SequenceFeature[] findFeaturesAtRes(SequenceI sequence, int res)
+ List<SequenceFeature> findFeaturesAtRes(SequenceI sequence, int res)
{
- Vector tmp = new Vector();
- SequenceFeature[] features = sequence.getSequenceFeatures();
- if (features != null)
- {
- for (int i = 0; i < features.length; i++)
- {
- if (av.getFeaturesDisplayed() == null
- || !av.getFeaturesDisplayed().isVisible(
- features[i].getType()))
- {
- continue;
- }
-
- if (features[i].featureGroup != null
- && !seqCanvas.fr.checkGroupVisibility(
- features[i].featureGroup, false))
- {
- continue;
- }
-
- if ((features[i].getBegin() <= res)
- && (features[i].getEnd() >= res))
- {
- tmp.addElement(features[i]);
- }
- }
- }
-
- features = new SequenceFeature[tmp.size()];
- tmp.copyInto(features);
-
- return features;
+ return seqCanvas.getFeatureRenderer().findFeaturesAtRes(sequence, res);
}
Tooltip tooltip;
// DETECT RIGHT MOUSE BUTTON IN AWT
if ((evt.getModifiers() & InputEvent.BUTTON3_MASK) == InputEvent.BUTTON3_MASK)
{
- SequenceFeature[] allFeatures = findFeaturesAtRes(sequence,
+ List<SequenceFeature> allFeatures = findFeaturesAtRes(sequence,
sequence.findPosition(res));
Vector<String> links = null;
- if (allFeatures != null)
+ for (int i = 0; i < allFeatures.size(); i++)
{
- for (int i = 0; i < allFeatures.length; i++)
+ SequenceFeature sf = allFeatures.get(i);
+ if (sf.links != null)
{
- if (allFeatures[i].links != null)
+ if (links == null)
{
- if (links == null)
- {
- links = new Vector<String>();
- }
- for (int j = 0; j < allFeatures[i].links.size(); j++)
- {
- links.addElement(allFeatures[i].links.elementAt(j));
- }
+ links = new Vector<String>();
}
+ links.addAll(sf.links);
}
}
APopupMenu popup = new APopupMenu(ap, null, links);
int nseq = 0;
for (SequenceI sq : seqs)
{
- boolean sequenceHasFeature = false;
if (sq != null)
{
- SequenceFeature[] sfs = sq.getSequenceFeatures();
- if (sfs != null)
+ int ist = sq.findPosition(sqcol.getStartRes());
+ int iend = sq.findPosition(sqcol.getEndRes()); // see JAL-2526
+ List<SequenceFeature> sfs = sq.getFeatures().findFeatures(ist,
+ iend, featureType);
+ boolean overlap = false;
+ for (SequenceFeature sf : sfs)
{
- int ist = sq.findIndex(sq.getStart());
- int iend = sq.findIndex(sq.getEnd());
- if (iend < startPosition || ist > endPosition)
+ // future functionality - featureType == null means mark columns
+ // containing all displayed features
+ if (sf != null && (featureType.equals(sf.getType())))
{
- // sequence not in region
- continue;
- }
- for (SequenceFeature sf : sfs)
- {
- // future functionality - featureType == null means mark columns
- // containing all displayed features
- if (sf != null && (featureType.equals(sf.getType())))
- {
- // optimisation - could consider 'spos,apos' like cursor argument
- // - findIndex wastes time by starting from first character and
- // counting
-
- int sfStartCol = sq.findIndex(sf.getBegin());
- int sfEndCol = sq.findIndex(sf.getEnd());
-
- if (sf.isContactFeature())
- {
- /*
- * 'contact' feature - check for 'start' or 'end'
- * position within the selected region
- */
- if (sfStartCol >= startPosition
- && sfStartCol <= endPosition)
- {
- bs.set(sfStartCol - 1);
- sequenceHasFeature = true;
- }
- if (sfEndCol >= startPosition && sfEndCol <= endPosition)
- {
- bs.set(sfEndCol - 1);
- sequenceHasFeature = true;
- }
- continue;
- }
+ int sfStartCol = sq.findIndex(sf.getBegin());
+ int sfEndCol = sq.findIndex(sf.getEnd()); // inefficient - JAL-2526
+ if (sf.isContactFeature())
+ {
/*
- * contiguous feature - select feature positions (if any)
- * within the selected region
+ * 'contact' feature - check for 'start' or 'end'
+ * position within the selected region
*/
- if (sfStartCol > endPosition || sfEndCol < startPosition)
- {
- // feature is outside selected region
- continue;
- }
- sequenceHasFeature = true;
- if (sfStartCol < startPosition)
- {
- sfStartCol = startPosition;
- }
- if (sfStartCol < ist)
+ if (sfStartCol >= startPosition && sfStartCol <= endPosition)
{
- sfStartCol = ist;
+ bs.set(sfStartCol - 1);
+ overlap = true;
}
- if (sfEndCol > endPosition)
+ if (sfEndCol >= startPosition && sfEndCol <= endPosition)
{
- sfEndCol = endPosition;
- }
- for (; sfStartCol <= sfEndCol; sfStartCol++)
- {
- bs.set(sfStartCol - 1); // convert to base 0
+ bs.set(sfEndCol - 1);
+ overlap = true;
}
+ continue;
+ }
+
+ /*
+ * contiguous feature - select feature positions (if any)
+ * within the selected region
+ */
+ if (sfStartCol < startPosition)
+ {
+ sfStartCol = startPosition;
+ }
+ if (sfStartCol < ist)
+ {
+ sfStartCol = ist;
+ }
+ if (sfEndCol > endPosition)
+ {
+ sfEndCol = endPosition;
+ }
+ for (; sfStartCol <= sfEndCol; sfStartCol++)
+ {
+ bs.set(sfStartCol - 1); // convert to base 0
+ overlap = true;
}
}
}
-
- if (sequenceHasFeature)
+ if (overlap)
{
nseq++;
}
* Updates the _rnasecstr field Determines the positions that base pair and
* the positions of helices based on secondary structure from a Stockholm file
*
- * @param RNAannot
+ * @param rnaAnnotation
*/
- private void _updateRnaSecStr(CharSequence RNAannot)
+ private void _updateRnaSecStr(CharSequence rnaAnnotation)
{
try
{
- bps = Rna.getModeleBP(RNAannot);
- _rnasecstr = Rna.getBasePairs(bps);
+ _rnasecstr = Rna.getHelixMap(rnaAnnotation);
invalidrnastruc = -1;
} catch (WUSSParseException px)
{
{
return;
}
- Rna.HelixMap(_rnasecstr);
- // setRNAStruc(RNAannot);
if (_rnasecstr != null && _rnasecstr.length > 0)
{
}
}
- // JBPNote: what does this do ?
- public void ConcenStru(CharSequence RNAannot) throws WUSSParseException
- {
- bps = Rna.getModeleBP(RNAannot);
- }
-
/**
* Creates a new AlignmentAnnotation object.
*
SequenceFeature[] vf = new SequenceFeature[frange.length / 2];
for (int i = 0, v = 0; i < frange.length; i += 2, v++)
{
- vf[v] = new SequenceFeature(f);
- vf[v].setBegin(frange[i]);
- vf[v].setEnd(frange[i + 1]);
+ vf[v] = new SequenceFeature(f, frange[i], frange[i + 1],
+ f.getFeatureGroup());
if (frange.length > 2)
{
vf[v].setDescription(f.getDescription() + "\nPart " + (v + 1));
return vf;
}
}
- if (false) // else
- {
- int[] word = getWord(f.getBegin());
- if (word[0] < word[1])
- {
- f.setBegin(word[0]);
- }
- else
- {
- f.setBegin(word[1]);
- }
- word = getWord(f.getEnd());
- if (word[0] > word[1])
- {
- f.setEnd(word[0]);
- }
- else
- {
- f.setEnd(word[1]);
- }
- }
+
// give up and just return the feature.
return new SequenceFeature[] { f };
}
import jalview.analysis.AlignSeq;
import jalview.api.DBRefEntryI;
+import jalview.datamodel.features.SequenceFeatures;
+import jalview.datamodel.features.SequenceFeaturesI;
import jalview.util.Comparison;
import jalview.util.DBRefUtils;
import jalview.util.MapList;
/** array of sequence features - may not be null for a valid sequence object */
public SequenceFeature[] sequenceFeatures;
+ private SequenceFeatures sequenceFeatureStore;
+
/**
* Creates a new Sequence object.
*
this.sequence = sequence2;
this.start = start2;
this.end = end2;
+ sequenceFeatureStore = new SequenceFeatures();
parseId();
checkValidRange();
}
@Override
public synchronized boolean addSequenceFeature(SequenceFeature sf)
{
+ if (sf.getType() == null)
+ {
+ System.err.println("SequenceFeature type may not be null: "
+ + sf.toString());
+ return false;
+ }
+
if (sequenceFeatures == null && datasetSequence != null)
{
return datasetSequence.addSequenceFeature(sf);
temp[sequenceFeatures.length] = sf;
sequenceFeatures = temp;
+
+ sequenceFeatureStore.add(sf);
return true;
}
return;
}
+ /*
+ * new way
+ */
+ sequenceFeatureStore.delete(sf);
+
+ /*
+ * old way - to be removed
+ */
int index = 0;
for (index = 0; index < sequenceFeatures.length; index++)
{
}
@Override
+ public SequenceFeaturesI getFeatures()
+ {
+ return datasetSequence != null ? datasetSequence.getFeatures()
+ : sequenceFeatureStore;
+ }
+
+ @Override
public boolean addPDBId(PDBEntry entry)
{
if (pdbIds == null)
// move features and database references onto dataset sequence
dsseq.sequenceFeatures = sequenceFeatures;
sequenceFeatures = null;
+ dsseq.sequenceFeatureStore = sequenceFeatureStore;
+ sequenceFeatureStore = null;
dsseq.dbrefs = dbrefs;
dbrefs = null;
// TODO: search and replace any references to this sequence with
}
}
+ /**
+ * {@inheritDoc}
+ */
+ @Override
+ public List<SequenceFeature> findFeatures(int from, int to,
+ String... types)
+ {
+ if (datasetSequence != null)
+ {
+ return datasetSequence.findFeatures(from, to, types);
+ }
+ return sequenceFeatureStore.findFeatures(from, to, types);
+ }
}
*/
package jalview.datamodel;
+import jalview.datamodel.features.FeatureLocationI;
+
import java.util.HashMap;
import java.util.Map;
import java.util.Vector;
* @author $author$
* @version $Revision$
*/
-public class SequenceFeature
+public class SequenceFeature implements FeatureLocationI
{
private static final String STATUS = "status";
}
/**
+ * A copy constructor that allows the begin and end positions and group to be
+ * modified
+ *
+ * @param sf
+ * @param newBegin
+ * @param newEnd
+ * @param newGroup
+ */
+ public SequenceFeature(SequenceFeature sf, int newBegin, int newEnd,
+ String newGroup)
+ {
+ this(sf);
+ begin = newBegin;
+ end = newEnd;
+ featureGroup = newGroup;
+ }
+
+ /**
* Two features are considered equal if they have the same type, group,
* description, start, end, phase, strand, and (if present) 'Name', ID' and
* 'Parent' attributes.
*
* @return DOCUMENT ME!
*/
+ @Override
public int getBegin()
{
return begin;
*
* @return DOCUMENT ME!
*/
+ @Override
public int getEnd()
{
return end;
links = new Vector<String>();
}
- links.insertElementAt(labelLink, 0);
+ if (!links.contains(labelLink))
+ {
+ links.insertElementAt(labelLink, 0);
+ }
}
public float getScore()
* positions, rather than ends of a range. Such features may be visualised or
* reported differently to features on a range.
*/
+ @Override
public boolean isContactFeature()
{
// TODO abstract one day to a FeatureType class
}
return false;
}
+
+ /**
+ * Answers true if the sequence has zero start and end position
+ *
+ * @return
+ */
+ public boolean isNonPositional()
+ {
+ return begin == 0 && end == 0;
+ }
}
*/
package jalview.datamodel;
+import jalview.datamodel.features.SequenceFeaturesI;
+
import java.util.List;
import java.util.Vector;
public SequenceFeature[] getSequenceFeatures();
/**
+ * Answers the object holding features for the sequence
+ *
+ * @return
+ */
+ SequenceFeaturesI getFeatures();
+
+ /**
* Replaces the array of sequence features associated with this sequence with
* a new array reference. If this sequence has a dataset sequence, then this
* method will update the dataset sequence's feature array
/**
* Adds the given sequence feature and returns true, or returns false if it is
- * already present on the sequence
+ * already present on the sequence, or if the feature type is null.
*
* @param sf
* @return
* list
*/
public List<DBRefEntry> getPrimaryDBRefs();
+
+ /**
+ * Returns a (possibly empty) list of sequence features that overlap the range
+ * from-to (inclusive), optionally restricted to one or more specified feature
+ * types
+ *
+ * @param from
+ * @param to
+ * @param types
+ * @return
+ */
+ List<SequenceFeature> findFeatures(int from, int to, String... types);
}
--- /dev/null
+package jalview.datamodel.features;
+
+public interface ContiguousI
+{
+ int getBegin(); // todo want long for genomic positions?
+
+ int getEnd();
+}
--- /dev/null
+package jalview.datamodel.features;
+
+/**
+ * An extension of ContiguousI that allows start/end values to be interpreted
+ * instead as two contact positions
+ */
+public interface FeatureLocationI extends ContiguousI
+{
+ boolean isContactFeature();
+}
--- /dev/null
+package jalview.datamodel.features;
+
+import jalview.datamodel.SequenceFeature;
+
+import java.util.ArrayList;
+import java.util.Collections;
+import java.util.Comparator;
+import java.util.HashSet;
+import java.util.List;
+import java.util.Set;
+
+/**
+ * A data store for a set of sequence features that supports efficient lookup of
+ * features overlapping a given range. Intended for (but not limited to) storage
+ * of features for one sequence and feature type.
+ *
+ * @author gmcarstairs
+ *
+ */
+public class FeatureStore
+{
+ /**
+ * a class providing criteria for performing a binary search of a list
+ */
+ abstract static class SearchCriterion
+ {
+ /**
+ * Answers true if the entry passes the search criterion test
+ *
+ * @param entry
+ * @return
+ */
+ abstract boolean compare(SequenceFeature entry);
+
+ static SearchCriterion byStart(final long target)
+ {
+ return new SearchCriterion() {
+
+ @Override
+ boolean compare(SequenceFeature entry)
+ {
+ return entry.getBegin() >= target;
+ }
+ };
+ }
+
+ static SearchCriterion byEnd(final long target)
+ {
+ return new SearchCriterion()
+ {
+
+ @Override
+ boolean compare(SequenceFeature entry)
+ {
+ return entry.getEnd() >= target;
+ }
+ };
+ }
+
+ static SearchCriterion byFeature(final ContiguousI to,
+ final Comparator<ContiguousI> rc)
+ {
+ return new SearchCriterion()
+ {
+
+ @Override
+ boolean compare(SequenceFeature entry)
+ {
+ return rc.compare(entry, to) >= 0;
+ }
+ };
+ }
+ }
+
+ /*
+ * Non-positional features have no (zero) start/end position.
+ * Kept as a separate list in case this criterion changes in future.
+ */
+ List<SequenceFeature> nonPositionalFeatures;
+
+ /*
+ * An ordered list of features, with the promise that no feature in the list
+ * properly contains any other. This constraint allows bounded linear search
+ * of the list for features overlapping a region.
+ * Contact features are not included in this list.
+ */
+ List<SequenceFeature> nonNestedFeatures;
+
+ /*
+ * contact features ordered by first contact position
+ */
+ List<SequenceFeature> contactFeatureStarts;
+
+ /*
+ * contact features ordered by second contact position
+ */
+ List<SequenceFeature> contactFeatureEnds;
+
+ /*
+ * Nested Containment List is used to hold any features that are nested
+ * within (properly contained by) any other feature. This is a recursive tree
+ * which supports depth-first scan for features overlapping a range.
+ * It is used here as a 'catch-all' fallback for features that cannot be put
+ * into a simple ordered list without invalidating the search methods.
+ */
+ NCList<SequenceFeature> nestedFeatures;
+
+ /*
+ * Feature groups represented in stored positional features
+ * (possibly including null)
+ */
+ Set<String> positionalFeatureGroups;
+
+ /*
+ * Feature groups represented in stored non-positional features
+ * (possibly including null)
+ */
+ Set<String> nonPositionalFeatureGroups;
+
+ /*
+ * the total length of all positional features; contact features count 1 to
+ * the total and 1 to size(), consistent with an average 'feature length' of 1
+ */
+ int totalExtent;
+
+ float positionalMinScore;
+
+ float positionalMaxScore;
+
+ float nonPositionalMinScore;
+
+ float nonPositionalMaxScore;
+
+ /**
+ * Constructor
+ */
+ public FeatureStore()
+ {
+ nonNestedFeatures = new ArrayList<SequenceFeature>();
+ positionalFeatureGroups = new HashSet<String>();
+ nonPositionalFeatureGroups = new HashSet<String>();
+ positionalMinScore = Float.NaN;
+ positionalMaxScore = Float.NaN;
+ nonPositionalMinScore = Float.NaN;
+ nonPositionalMaxScore = Float.NaN;
+
+ // we only construct nonPositionalFeatures, contactFeatures
+ // or the NCList if we need to
+ }
+
+ /**
+ * Adds one sequence feature to the store, and returns true, unless the
+ * feature is already contained in the store, in which case this method
+ * returns false. Containment is determined by SequenceFeature.equals()
+ * comparison.
+ *
+ * @param feature
+ */
+ public boolean addFeature(SequenceFeature feature)
+ {
+ /*
+ * keep a record of feature groups
+ */
+ if (!feature.isNonPositional())
+ {
+ positionalFeatureGroups.add(feature.getFeatureGroup());
+ }
+
+ boolean added = false;
+
+ if (feature.isContactFeature())
+ {
+ added = addContactFeature(feature);
+ }
+ else if (feature.isNonPositional())
+ {
+ added = addNonPositionalFeature(feature);
+ }
+ else
+ {
+ if (!contains(nonNestedFeatures, feature))
+ {
+ added = addNonNestedFeature(feature);
+ if (!added)
+ {
+ /*
+ * detected a nested feature - put it in the NCList structure
+ */
+ added = addNestedFeature(feature);
+ }
+ }
+ }
+
+ if (added)
+ {
+ /*
+ * record the total extent of positional features, to make
+ * getTotalFeatureLength possible; we count the length of a
+ * contact feature as 1
+ */
+ totalExtent += getFeatureLength(feature);
+
+ /*
+ * record the minimum and maximum score for positional
+ * and non-positional features
+ */
+ float score = feature.getScore();
+ if (!Float.isNaN(score))
+ {
+ if (feature.isNonPositional())
+ {
+ nonPositionalMinScore = min(nonPositionalMinScore, score);
+ nonPositionalMaxScore = max(nonPositionalMaxScore, score);
+ }
+ else
+ {
+ positionalMinScore = min(positionalMinScore, score);
+ positionalMaxScore = max(positionalMaxScore, score);
+ }
+ }
+ }
+
+ return added;
+ }
+
+ /**
+ * Answers the 'length' of the feature, counting 0 for non-positional features
+ * and 1 for contact features
+ *
+ * @param feature
+ * @return
+ */
+ protected static int getFeatureLength(SequenceFeature feature)
+ {
+ if (feature.isNonPositional())
+ {
+ return 0;
+ }
+ if (feature.isContactFeature())
+ {
+ return 1;
+ }
+ return 1 + feature.getEnd() - feature.getBegin();
+ }
+
+ /**
+ * Adds the feature to the list of non-positional features (with lazy
+ * instantiation of the list if it is null), and returns true. If the
+ * non-positional features already include the new feature (by equality test),
+ * then it is not added, and this method returns false. The feature group is
+ * added to the set of distinct feature groups for non-positional features.
+ *
+ * @param feature
+ */
+ protected boolean addNonPositionalFeature(SequenceFeature feature)
+ {
+ if (nonPositionalFeatures == null)
+ {
+ nonPositionalFeatures = new ArrayList<SequenceFeature>();
+ }
+ if (nonPositionalFeatures.contains(feature))
+ {
+ return false;
+ }
+
+ nonPositionalFeatures.add(feature);
+
+ nonPositionalFeatureGroups.add(feature.getFeatureGroup());
+
+ return true;
+ }
+
+ /**
+ * Adds one feature to the NCList that can manage nested features (creating
+ * the NCList if necessary), and returns true. If the feature is already
+ * stored in the NCList (by equality test), then it is not added, and this
+ * method returns false.
+ */
+ protected synchronized boolean addNestedFeature(SequenceFeature feature)
+ {
+ if (nestedFeatures == null)
+ {
+ nestedFeatures = new NCList<SequenceFeature>(feature);
+ return true;
+ }
+ return nestedFeatures.add(feature, false);
+ }
+
+ /**
+ * Add a feature to the list of non-nested features, maintaining the ordering
+ * of the list. A check is made for whether the feature is nested in (properly
+ * contained by) an existing feature. If there is no nesting, the feature is
+ * added to the list and the method returns true. If nesting is found, the
+ * feature is not added and the method returns false.
+ *
+ * @param feature
+ * @return
+ */
+ protected boolean addNonNestedFeature(SequenceFeature feature)
+ {
+ synchronized (nonNestedFeatures)
+ {
+ /*
+ * find the first stored feature which doesn't precede the new one
+ */
+ int insertPosition = binarySearch(nonNestedFeatures,
+ SearchCriterion.byFeature(feature, RangeComparator.BY_START_POSITION));
+
+ /*
+ * fail if we detect feature enclosure - of the new feature by
+ * the one preceding it, or of the next feature by the new one
+ */
+ if (insertPosition > 0)
+ {
+ if (encloses(nonNestedFeatures.get(insertPosition - 1), feature))
+ {
+ return false;
+ }
+ }
+ if (insertPosition < nonNestedFeatures.size())
+ {
+ if (encloses(feature, nonNestedFeatures.get(insertPosition)))
+ {
+ return false;
+ }
+ }
+
+ /*
+ * checks passed - add the feature
+ */
+ nonNestedFeatures.add(insertPosition, feature);
+
+ return true;
+ }
+ }
+
+ /**
+ * Answers true if range1 properly encloses range2, else false
+ *
+ * @param range1
+ * @param range2
+ * @return
+ */
+ protected boolean encloses(ContiguousI range1, ContiguousI range2)
+ {
+ int begin1 = range1.getBegin();
+ int begin2 = range2.getBegin();
+ int end1 = range1.getEnd();
+ int end2 = range2.getEnd();
+ if (begin1 == begin2 && end1 > end2)
+ {
+ return true;
+ }
+ if (begin1 < begin2 && end1 >= end2)
+ {
+ return true;
+ }
+ return false;
+ }
+
+ /**
+ * Add a contact feature to the lists that hold them ordered by start (first
+ * contact) and by end (second contact) position, ensuring the lists remain
+ * ordered, and returns true. If the contact feature lists already contain the
+ * given feature (by test for equality), does not add it and returns false.
+ *
+ * @param feature
+ * @return
+ */
+ protected synchronized boolean addContactFeature(SequenceFeature feature)
+ {
+ if (contactFeatureStarts == null)
+ {
+ contactFeatureStarts = new ArrayList<SequenceFeature>();
+ }
+ if (contactFeatureEnds == null)
+ {
+ contactFeatureEnds = new ArrayList<SequenceFeature>();
+ }
+
+ if (contains(contactFeatureStarts, feature))
+ {
+ return false;
+ }
+
+ /*
+ * binary search the sorted list to find the insertion point
+ */
+ int insertPosition = binarySearch(contactFeatureStarts,
+ SearchCriterion.byFeature(feature,
+ RangeComparator.BY_START_POSITION));
+ contactFeatureStarts.add(insertPosition, feature);
+ // and resort to mak siccar...just in case insertion point not quite right
+ Collections.sort(contactFeatureStarts, RangeComparator.BY_START_POSITION);
+
+ insertPosition = binarySearch(contactFeatureStarts,
+ SearchCriterion.byFeature(feature,
+ RangeComparator.BY_END_POSITION));
+ contactFeatureEnds.add(feature);
+ Collections.sort(contactFeatureEnds, RangeComparator.BY_END_POSITION);
+
+ return true;
+ }
+
+ /**
+ * Answers true if the list contains the feature, else false. This method is
+ * optimised for the condition that the list is sorted on feature start
+ * position ascending, and will give unreliable results if this does not hold.
+ *
+ * @param features
+ * @param feature
+ * @return
+ */
+ protected static boolean contains(List<SequenceFeature> features,
+ SequenceFeature feature)
+ {
+ if (features == null || feature == null)
+ {
+ return false;
+ }
+
+ /*
+ * locate the first entry in the list which does not precede the feature
+ */
+ int pos = binarySearch(features,
+ SearchCriterion.byFeature(feature, RangeComparator.BY_START_POSITION));
+ int len = features.size();
+ while (pos < len)
+ {
+ SequenceFeature sf = features.get(pos);
+ if (sf.getBegin() > feature.getBegin())
+ {
+ return false; // no match found
+ }
+ if (sf.equals(feature))
+ {
+ return true;
+ }
+ pos++;
+ }
+ return false;
+ }
+
+ /**
+ * Returns a (possibly empty) list of features whose extent overlaps the given
+ * range. The returned list is not ordered. Contact features are included if
+ * either of the contact points lies within the range.
+ *
+ * @param start
+ * start position of overlap range (inclusive)
+ * @param end
+ * end position of overlap range (inclusive)
+ * @return
+ */
+ public List<SequenceFeature> findOverlappingFeatures(long start, long end)
+ {
+ List<SequenceFeature> result = new ArrayList<SequenceFeature>();
+
+ findNonNestedFeatures(start, end, result);
+
+ findContactFeatures(start, end, result);
+
+ if (nestedFeatures != null)
+ {
+ result.addAll(nestedFeatures.findOverlaps(start, end));
+ }
+
+ return result;
+ }
+
+ /**
+ * Adds contact features to the result list where either the second or the
+ * first contact position lies within the target range
+ *
+ * @param from
+ * @param to
+ * @param result
+ */
+ protected void findContactFeatures(long from, long to,
+ List<SequenceFeature> result)
+ {
+ if (contactFeatureStarts != null)
+ {
+ findContactStartFeatures(from, to, result);
+ }
+ if (contactFeatureEnds != null)
+ {
+ findContactEndFeatures(from, to, result);
+ }
+ }
+
+ /**
+ * Adds to the result list any contact features whose end (second contact
+ * point), but not start (first contact point), lies in the query from-to
+ * range
+ *
+ * @param from
+ * @param to
+ * @param result
+ */
+ protected void findContactEndFeatures(long from, long to,
+ List<SequenceFeature> result)
+ {
+ /*
+ * find the first contact feature (if any) that does not lie
+ * entirely before the target range
+ */
+ int startPosition = binarySearch(contactFeatureEnds,
+ SearchCriterion.byEnd(from));
+ for (; startPosition < contactFeatureEnds.size(); startPosition++)
+ {
+ SequenceFeature sf = contactFeatureEnds.get(startPosition);
+ if (!sf.isContactFeature())
+ {
+ System.err.println("Error! non-contact feature type "
+ + sf.getType() + " in contact features list");
+ continue;
+ }
+
+ int begin = sf.getBegin();
+ if (begin >= from && begin <= to)
+ {
+ /*
+ * this feature's first contact position lies in the search range
+ * so we don't include it in results a second time
+ */
+ continue;
+ }
+
+ int end = sf.getEnd();
+ if (end >= from && end <= to)
+ {
+ result.add(sf);
+ }
+ if (end > to)
+ {
+ break;
+ }
+ }
+ }
+
+ /**
+ * Adds non-nested features to the result list that lie within the target
+ * range. Non-positional features (start=end=0), contact features and nested
+ * features are excluded.
+ *
+ * @param from
+ * @param to
+ * @param result
+ */
+ protected void findNonNestedFeatures(long from, long to,
+ List<SequenceFeature> result)
+ {
+ int startIndex = binarySearch(nonNestedFeatures,
+ SearchCriterion.byEnd(from));
+
+ findNonNestedFeatures(startIndex, from, to, result);
+ }
+
+ /**
+ * Scans the list of non-nested features, starting from startIndex, to find
+ * those that overlap the from-to range, and adds them to the result list.
+ * Returns the index of the first feature whose start position is after the
+ * target range (or the length of the whole list if none such feature exists).
+ *
+ * @param startIndex
+ * @param from
+ * @param to
+ * @param result
+ * @return
+ */
+ protected int findNonNestedFeatures(final int startIndex, long from,
+ long to, List<SequenceFeature> result)
+ {
+ int i = startIndex;
+ while (i < nonNestedFeatures.size())
+ {
+ SequenceFeature sf = nonNestedFeatures.get(i);
+ if (sf.getBegin() > to)
+ {
+ break;
+ }
+ int start = sf.getBegin();
+ int end = sf.getEnd();
+ if (start <= to && end >= from)
+ {
+ result.add(sf);
+ }
+ i++;
+ }
+ return i;
+ }
+
+ /**
+ * Adds contact features whose start position lies in the from-to range to the
+ * result list
+ *
+ * @param from
+ * @param to
+ * @param result
+ */
+ protected void findContactStartFeatures(long from, long to,
+ List<SequenceFeature> result)
+ {
+ int startPosition = binarySearch(contactFeatureStarts,
+ SearchCriterion.byStart(from));
+
+ for (; startPosition < contactFeatureStarts.size(); startPosition++)
+ {
+ SequenceFeature sf = contactFeatureStarts.get(startPosition);
+ if (!sf.isContactFeature())
+ {
+ System.err.println("Error! non-contact feature type "
+ + sf.getType() + " in contact features list");
+ continue;
+ }
+ int begin = sf.getBegin();
+ if (begin >= from && begin <= to)
+ {
+ result.add(sf);
+ }
+ }
+ }
+
+ /**
+ * Answers a list of all positional features stored, in no guaranteed order
+ *
+ * @return
+ */
+ public List<SequenceFeature> getPositionalFeatures()
+ {
+ /*
+ * add non-nested features (may be all features for many cases)
+ */
+ List<SequenceFeature> result = new ArrayList<SequenceFeature>();
+ result.addAll(nonNestedFeatures);
+
+ /*
+ * add any contact features - from the list by start position
+ */
+ if (contactFeatureStarts != null)
+ {
+ result.addAll(contactFeatureStarts);
+ }
+
+ /*
+ * add any nested features
+ */
+ if (nestedFeatures != null)
+ {
+ result.addAll(nestedFeatures.getEntries());
+ }
+
+ return result;
+ }
+
+ /**
+ * Answers a list of all contact features. If there are none, returns an
+ * immutable empty list.
+ *
+ * @return
+ */
+ public List<SequenceFeature> getContactFeatures()
+ {
+ if (contactFeatureStarts == null)
+ {
+ return Collections.emptyList();
+ }
+ return new ArrayList<SequenceFeature>(contactFeatureStarts);
+ }
+
+ /**
+ * Answers a list of all non-positional features. If there are none, returns
+ * an immutable empty list.
+ *
+ * @return
+ */
+ public List<SequenceFeature> getNonPositionalFeatures()
+ {
+ if (nonPositionalFeatures == null)
+ {
+ return Collections.emptyList();
+ }
+ return new ArrayList<SequenceFeature>(nonPositionalFeatures);
+ }
+
+ /**
+ * Deletes the given feature from the store, returning true if it was found
+ * (and deleted), else false. This method makes no assumption that the feature
+ * is in the 'expected' place in the store, in case it has been modified since
+ * it was added.
+ *
+ * @param sf
+ */
+ public synchronized boolean delete(SequenceFeature sf)
+ {
+ /*
+ * try the non-nested positional features first
+ */
+ boolean removed = nonNestedFeatures.remove(sf);
+
+ /*
+ * if not found, try contact positions (and if found, delete
+ * from both lists of contact positions)
+ */
+ if (!removed && contactFeatureStarts != null)
+ {
+ removed = contactFeatureStarts.remove(sf);
+ if (removed)
+ {
+ contactFeatureEnds.remove(sf);
+ }
+ }
+
+ boolean removedNonPositional = false;
+
+ /*
+ * if not found, try non-positional features
+ */
+ if (!removed && nonPositionalFeatures != null)
+ {
+ removedNonPositional = nonPositionalFeatures.remove(sf);
+ removed = removedNonPositional;
+ }
+
+ /*
+ * if not found, try nested features
+ */
+ if (!removed && nestedFeatures != null)
+ {
+ removed = nestedFeatures.delete(sf);
+ }
+
+ if (removed)
+ {
+ rescanAfterDelete();
+ }
+
+ return removed;
+ }
+
+ /**
+ * Rescan all features to recompute any cached values after an entry has been
+ * deleted. This is expected to be an infrequent event, so performance here is
+ * not critical.
+ */
+ protected synchronized void rescanAfterDelete()
+ {
+ positionalFeatureGroups.clear();
+ nonPositionalFeatureGroups.clear();
+ totalExtent = 0;
+ positionalMinScore = Float.NaN;
+ positionalMaxScore = Float.NaN;
+ nonPositionalMinScore = Float.NaN;
+ nonPositionalMaxScore = Float.NaN;
+
+ /*
+ * scan non-positional features for groups and scores
+ */
+ for (SequenceFeature sf : getNonPositionalFeatures())
+ {
+ nonPositionalFeatureGroups.add(sf.getFeatureGroup());
+ float score = sf.getScore();
+ nonPositionalMinScore = min(nonPositionalMinScore, score);
+ nonPositionalMaxScore = max(nonPositionalMaxScore, score);
+ }
+
+ /*
+ * scan positional features for groups, scores and extents
+ */
+ for (SequenceFeature sf : getPositionalFeatures())
+ {
+ positionalFeatureGroups.add(sf.getFeatureGroup());
+ float score = sf.getScore();
+ positionalMinScore = min(positionalMinScore, score);
+ positionalMaxScore = max(positionalMaxScore, score);
+ totalExtent += getFeatureLength(sf);
+ }
+ }
+
+ /**
+ * A helper method to return the minimum of two floats, where a non-NaN value
+ * is treated as 'less than' a NaN value (unlike Math.min which does the
+ * opposite)
+ *
+ * @param f1
+ * @param f2
+ */
+ protected static float min(float f1, float f2)
+ {
+ if (Float.isNaN(f1))
+ {
+ return Float.isNaN(f2) ? f1 : f2;
+ }
+ else
+ {
+ return Float.isNaN(f2) ? f1 : Math.min(f1, f2);
+ }
+ }
+
+ /**
+ * A helper method to return the maximum of two floats, where a non-NaN value
+ * is treated as 'greater than' a NaN value (unlike Math.max which does the
+ * opposite)
+ *
+ * @param f1
+ * @param f2
+ */
+ protected static float max(float f1, float f2)
+ {
+ if (Float.isNaN(f1))
+ {
+ return Float.isNaN(f2) ? f1 : f2;
+ }
+ else
+ {
+ return Float.isNaN(f2) ? f1 : Math.max(f1, f2);
+ }
+ }
+
+ /**
+ * Scans all positional features to check whether the given feature group is
+ * found, and returns true if found, else false
+ *
+ * @param featureGroup
+ * @return
+ */
+ protected boolean findFeatureGroup(String featureGroup)
+ {
+ for (SequenceFeature sf : getPositionalFeatures())
+ {
+ String group = sf.getFeatureGroup();
+ if (group == featureGroup
+ || (group != null && group.equals(featureGroup)))
+ {
+ return true;
+ }
+ }
+ return false;
+ }
+
+ /**
+ * Answers true if this store has no features, else false
+ *
+ * @return
+ */
+ public boolean isEmpty()
+ {
+ boolean hasFeatures = !nonNestedFeatures.isEmpty()
+ || (contactFeatureStarts != null && !contactFeatureStarts
+ .isEmpty())
+ || (nonPositionalFeatures != null && !nonPositionalFeatures
+ .isEmpty())
+ || (nestedFeatures != null && nestedFeatures.size() > 0);
+
+ return !hasFeatures;
+ }
+
+ /**
+ * Answers the set of distinct feature groups stored, possibly including null,
+ * as an unmodifiable view of the set. The parameter determines whether the
+ * groups for positional or for non-positional features are returned.
+ *
+ * @param positionalFeatures
+ * @return
+ */
+ public Set<String> getFeatureGroups(boolean positionalFeatures)
+ {
+ if (positionalFeatures)
+ {
+ return Collections.unmodifiableSet(positionalFeatureGroups);
+ }
+ else
+ {
+ return nonPositionalFeatureGroups == null ? Collections
+ .<String> emptySet() : Collections
+ .unmodifiableSet(nonPositionalFeatureGroups);
+ }
+ }
+
+ /**
+ * Performs a binary search of the (sorted) list to find the index of the
+ * first entry which returns true for the given comparator function. Returns
+ * the length of the list if there is no such entry.
+ *
+ * @param features
+ * @param sc
+ * @return
+ */
+ protected static int binarySearch(List<SequenceFeature> features,
+ SearchCriterion sc)
+ {
+ int start = 0;
+ int end = features.size() - 1;
+ int matched = features.size();
+
+ while (start <= end)
+ {
+ int mid = (start + end) / 2;
+ SequenceFeature entry = features.get(mid);
+ boolean compare = sc.compare(entry);
+ if (compare)
+ {
+ matched = mid;
+ end = mid - 1;
+ }
+ else
+ {
+ start = mid + 1;
+ }
+ }
+
+ return matched;
+ }
+
+ /**
+ * Answers the number of positional (or non-positional) features stored.
+ * Contact features count as 1.
+ *
+ * @param positional
+ * @return
+ */
+ public int getFeatureCount(boolean positional)
+ {
+ if (!positional)
+ {
+ return nonPositionalFeatures == null ? 0 : nonPositionalFeatures
+ .size();
+ }
+
+ int size = nonNestedFeatures.size();
+
+ if (contactFeatureStarts != null)
+ {
+ // note a contact feature (start/end) counts as one
+ size += contactFeatureStarts.size();
+ }
+
+ if (nestedFeatures != null)
+ {
+ size += nestedFeatures.size();
+ }
+
+ return size;
+ }
+
+ /**
+ * Answers the total length of positional features (or zero if there are
+ * none). Contact features contribute a value of 1 to the total.
+ *
+ * @return
+ */
+ public int getTotalFeatureLength()
+ {
+ return totalExtent;
+ }
+
+ /**
+ * Answers the minimum score held for positional or non-positional features.
+ * This may be Float.NaN if there are no features, are none has a non-NaN
+ * score.
+ *
+ * @param positional
+ * @return
+ */
+ public float getMinimumScore(boolean positional)
+ {
+ return positional ? positionalMinScore : nonPositionalMinScore;
+ }
+
+ /**
+ * Answers the maximum score held for positional or non-positional features.
+ * This may be Float.NaN if there are no features, are none has a non-NaN
+ * score.
+ *
+ * @param positional
+ * @return
+ */
+ public float getMaximumScore(boolean positional)
+ {
+ return positional ? positionalMaxScore : nonPositionalMaxScore;
+ }
+}
--- /dev/null
+package jalview.datamodel.features;
+
+import java.util.ArrayList;
+import java.util.Collections;
+import java.util.List;
+
+/**
+ * An adapted implementation of NCList as described in the paper
+ *
+ * <pre>
+ * Nested Containment List (NCList): a new algorithm for accelerating
+ * interval query of genome alignment and interval databases
+ * - Alexander V. Alekseyenko, Christopher J. Lee
+ * https://doi.org/10.1093/bioinformatics/btl647
+ * </pre>
+ */
+public class NCList<T extends ContiguousI>
+{
+ /*
+ * the number of ranges represented
+ */
+ private int size;
+
+ /*
+ * a list, in start position order, of sublists of ranges ordered so
+ * that each contains (or is the same as) the one that follows it
+ */
+ private List<NCNode<T>> subranges;
+
+ /**
+ * Constructor given a list of things that are each located on a contiguous
+ * interval. Note that the constructor may reorder the list.
+ * <p>
+ * We assume here that for each range, start <= end. Behaviour for reverse
+ * ordered ranges is undefined.
+ *
+ * @param ranges
+ */
+ public NCList(List<T> ranges)
+ {
+ this();
+ build(ranges);
+ }
+
+ /**
+ * Sort and group ranges into sublists where each sublist represents a region
+ * and its contained subregions
+ *
+ * @param ranges
+ */
+ protected void build(List<T> ranges)
+ {
+ /*
+ * sort by start ascending so that contained intervals
+ * follow their containing interval
+ */
+ Collections.sort(ranges, RangeComparator.BY_START_POSITION);
+
+ List<Range> sublists = buildSubranges(ranges);
+
+ /*
+ * convert each subrange to an NCNode consisting of a range and
+ * (possibly) its contained NCList
+ */
+ for (Range sublist : sublists)
+ {
+ subranges.add(new NCNode<T>(ranges.subList(sublist.start,
+ sublist.end + 1)));
+ }
+
+ size = ranges.size();
+ }
+
+ public NCList(T entry)
+ {
+ this();
+ subranges.add(new NCNode<T>(entry));
+ size = 1;
+ }
+
+ public NCList()
+ {
+ subranges = new ArrayList<NCNode<T>>();
+ }
+
+ /**
+ * Traverses the sorted ranges to identify sublists, within which each
+ * interval contains the one that follows it
+ *
+ * @param ranges
+ * @return
+ */
+ protected List<Range> buildSubranges(List<T> ranges)
+ {
+ List<Range> sublists = new ArrayList<Range>();
+
+ if (ranges.isEmpty())
+ {
+ return sublists;
+ }
+
+ int listStartIndex = 0;
+ long lastEndPos = Long.MAX_VALUE;
+
+ for (int i = 0; i < ranges.size(); i++)
+ {
+ ContiguousI nextInterval = ranges.get(i);
+ long nextStart = nextInterval.getBegin();
+ long nextEnd = nextInterval.getEnd();
+ if (nextStart > lastEndPos || nextEnd > lastEndPos)
+ {
+ /*
+ * this interval is not contained in the preceding one
+ * close off the last sublist
+ */
+ sublists.add(new Range(listStartIndex, i - 1));
+ listStartIndex = i;
+ }
+ lastEndPos = nextEnd;
+ }
+
+ sublists.add(new Range(listStartIndex, ranges.size() - 1));
+ return sublists;
+ }
+
+ /**
+ * Adds one entry to the stored set (with duplicates allowed)
+ *
+ * @param entry
+ */
+ public void add(T entry)
+ {
+ add(entry, true);
+ }
+
+ /**
+ * Adds one entry to the stored set, and returns true, unless allowDuplicates
+ * is set to false and it is already contained (by object equality test), in
+ * which case it is not added and this method returns false.
+ *
+ * @param entry
+ * @param allowDuplicates
+ * @return
+ */
+ public synchronized boolean add(T entry, boolean allowDuplicates)
+ {
+ if (!allowDuplicates && contains(entry))
+ {
+ return false;
+ }
+
+ size++;
+ long start = entry.getBegin();
+ long end = entry.getEnd();
+
+ /*
+ * cases:
+ * - precedes all subranges: add as NCNode on front of list
+ * - follows all subranges: add as NCNode on end of list
+ * - enclosed by a subrange - add recursively to subrange
+ * - encloses one or more subranges - push them inside it
+ * - none of the above - add as a new node and resort nodes list (?)
+ */
+
+ /*
+ * find the first subrange whose end does not precede entry's start
+ */
+ int candidateIndex = findFirstOverlap(start);
+ if (candidateIndex == -1)
+ {
+ /*
+ * all subranges precede this one - add it on the end
+ */
+ subranges.add(new NCNode<T>(entry));
+ return true;
+ }
+
+ /*
+ * search for maximal span of subranges i-k that the new entry
+ * encloses; or a subrange that encloses the new entry
+ */
+ boolean enclosing = false;
+ int firstEnclosed = 0;
+ int lastEnclosed = 0;
+ boolean overlapping = false;
+
+ for (int j = candidateIndex; j < subranges.size(); j++)
+ {
+ NCNode<T> subrange = subranges.get(j);
+
+ if (end < subrange.getBegin() && !overlapping && !enclosing)
+ {
+ /*
+ * new entry lies between subranges j-1 j
+ */
+ subranges.add(j, new NCNode<T>(entry));
+ return true;
+ }
+
+ if (subrange.getBegin() <= start && subrange.getEnd() >= end)
+ {
+ /*
+ * push new entry inside this subrange as it encloses it
+ */
+ subrange.add(entry);
+ return true;
+ }
+
+ if (start <= subrange.getBegin())
+ {
+ if (end >= subrange.getEnd())
+ {
+ /*
+ * new entry encloses this subrange (and possibly preceding ones);
+ * continue to find the maximal list it encloses
+ */
+ if (!enclosing)
+ {
+ firstEnclosed = j;
+ }
+ lastEnclosed = j;
+ enclosing = true;
+ continue;
+ }
+ else
+ {
+ /*
+ * entry spans from before this subrange to inside it
+ */
+ if (enclosing)
+ {
+ /*
+ * entry encloses one or more preceding subranges
+ */
+ addEnclosingRange(entry, firstEnclosed, lastEnclosed);
+ return true;
+ }
+ else
+ {
+ /*
+ * entry spans two subranges but doesn't enclose any
+ * so just add it
+ */
+ subranges.add(j, new NCNode<T>(entry));
+ return true;
+ }
+ }
+ }
+ else
+ {
+ overlapping = true;
+ }
+ }
+
+ /*
+ * drops through to here if new range encloses all others
+ * or overlaps the last one
+ */
+ if (enclosing)
+ {
+ addEnclosingRange(entry, firstEnclosed, lastEnclosed);
+ }
+ else
+ {
+ subranges.add(new NCNode<T>(entry));
+ }
+
+ return true;
+ }
+
+ /**
+ * Answers true if this NCList contains the given entry (by object equality
+ * test), else false
+ *
+ * @param entry
+ * @return
+ */
+ public boolean contains(T entry)
+ {
+ /*
+ * find the first sublist that might overlap, i.e.
+ * the first whose end position is >= from
+ */
+ int candidateIndex = findFirstOverlap(entry.getBegin());
+
+ if (candidateIndex == -1)
+ {
+ return false;
+ }
+
+ int to = entry.getEnd();
+
+ for (int i = candidateIndex; i < subranges.size(); i++)
+ {
+ NCNode<T> candidate = subranges.get(i);
+ if (candidate.getBegin() > to)
+ {
+ /*
+ * we are past the end of our target range
+ */
+ break;
+ }
+ if (candidate.contains(entry))
+ {
+ return true;
+ }
+ }
+ return false;
+ }
+
+ /**
+ * Update the tree so that the range of the new entry encloses subranges i to
+ * j (inclusive). That is, replace subranges i-j (inclusive) with a new
+ * subrange that contains them.
+ *
+ * @param entry
+ * @param i
+ * @param j
+ */
+ protected synchronized void addEnclosingRange(T entry, final int i,
+ final int j)
+ {
+ NCList<T> newNCList = new NCList<T>();
+ newNCList.addNodes(subranges.subList(i, j + 1));
+ NCNode<T> newNode = new NCNode<T>(entry, newNCList);
+ for (int k = j; k >= i; k--)
+ {
+ subranges.remove(k);
+ }
+ subranges.add(i, newNode);
+ }
+
+ protected void addNodes(List<NCNode<T>> nodes)
+ {
+ for (NCNode<T> node : nodes)
+ {
+ subranges.add(node);
+ size += node.size();
+ }
+ }
+
+ /**
+ * Returns a (possibly empty) list of items whose extent overlaps the given
+ * range
+ *
+ * @param from
+ * start of overlap range (inclusive)
+ * @param to
+ * end of overlap range (inclusive)
+ * @return
+ */
+ public List<T> findOverlaps(long from, long to)
+ {
+ List<T> result = new ArrayList<T>();
+
+ findOverlaps(from, to, result);
+
+ return result;
+ }
+
+ /**
+ * Recursively searches the NCList adding any items that overlap the from-to
+ * range to the result list
+ *
+ * @param from
+ * @param to
+ * @param result
+ */
+ protected void findOverlaps(long from, long to, List<T> result)
+ {
+ /*
+ * find the first sublist that might overlap, i.e.
+ * the first whose end position is >= from
+ */
+ int candidateIndex = findFirstOverlap(from);
+
+ if (candidateIndex == -1)
+ {
+ return;
+ }
+
+ for (int i = candidateIndex; i < subranges.size(); i++)
+ {
+ NCNode<T> candidate = subranges.get(i);
+ if (candidate.getBegin() > to)
+ {
+ /*
+ * we are past the end of our target range
+ */
+ break;
+ }
+ candidate.findOverlaps(from, to, result);
+ }
+
+ }
+
+ /**
+ * Search subranges for the first one whose end position is not before the
+ * target range's start position, i.e. the first one that may overlap the
+ * target range. Returns the index in the list of the first such range found,
+ * or -1 if none found.
+ *
+ * @param from
+ * @return
+ */
+ protected int findFirstOverlap(long from)
+ {
+ /*
+ * The NCList paper describes binary search for this step,
+ * but this not implemented here as (a) I haven't understood it yet
+ * and (b) it seems to imply complications for adding to an NCList
+ */
+
+ int i = 0;
+ if (subranges != null)
+ {
+ for (NCNode<T> subrange : subranges)
+ {
+ if (subrange.getEnd() >= from)
+ {
+ return i;
+ }
+ i++;
+ }
+ }
+ return -1;
+ }
+
+ /**
+ * Formats the tree as a bracketed list e.g.
+ *
+ * <pre>
+ * [1-100 [10-30 [10-20]], 15-30 [20-20]]
+ * </pre>
+ */
+ @Override
+ public String toString()
+ {
+ return subranges.toString();
+ }
+
+ /**
+ * Returns a string representation of the data where containment is shown by
+ * indentation on new lines
+ *
+ * @return
+ */
+ public String prettyPrint()
+ {
+ StringBuilder sb = new StringBuilder(512);
+ int offset = 0;
+ int indent = 2;
+ prettyPrint(sb, offset, indent);
+ sb.append(System.lineSeparator());
+ return sb.toString();
+ }
+
+ /**
+ * @param sb
+ * @param offset
+ * @param indent
+ */
+ void prettyPrint(StringBuilder sb, int offset, int indent)
+ {
+ boolean first = true;
+ for (NCNode<T> subrange : subranges)
+ {
+ if (!first)
+ {
+ sb.append(System.lineSeparator());
+ }
+ first = false;
+ subrange.prettyPrint(sb, offset, indent);
+ }
+ }
+
+ /**
+ * Answers true if the data held satisfy the rules of construction of an
+ * NCList, else false.
+ *
+ * @return
+ */
+ public boolean isValid()
+ {
+ return isValid(Integer.MIN_VALUE, Integer.MAX_VALUE);
+ }
+
+ /**
+ * Answers true if the data held satisfy the rules of construction of an
+ * NCList bounded within the given start-end range, else false.
+ * <p>
+ * Each subrange must lie within start-end (inclusive). Subranges must be
+ * ordered by start position ascending.
+ * <p>
+ *
+ * @param start
+ * @param end
+ * @return
+ */
+ boolean isValid(final int start, final int end)
+ {
+ int lastStart = start;
+ for (NCNode<T> subrange : subranges)
+ {
+ if (subrange.getBegin() < lastStart)
+ {
+ System.err.println("error in NCList: range " + subrange.toString()
+ + " starts before " + lastStart);
+ return false;
+ }
+ if (subrange.getEnd() > end)
+ {
+ System.err.println("error in NCList: range " + subrange.toString()
+ + " ends after " + end);
+ return false;
+ }
+ lastStart = subrange.getBegin();
+
+ if (!subrange.isValid())
+ {
+ return false;
+ }
+ }
+ return true;
+ }
+
+ /**
+ * Answers the lowest start position enclosed by the ranges
+ *
+ * @return
+ */
+ public int getStart()
+ {
+ return subranges.isEmpty() ? 0 : subranges.get(0).getBegin();
+ }
+
+ /**
+ * Returns the number of ranges held (deep count)
+ *
+ * @return
+ */
+ public int size()
+ {
+ return size;
+ }
+
+ /**
+ * Returns a list of all entries stored
+ *
+ * @return
+ */
+ public List<T> getEntries()
+ {
+ List<T> result = new ArrayList<T>();
+ getEntries(result);
+ return result;
+ }
+
+ /**
+ * Adds all contained entries to the given list
+ *
+ * @param result
+ */
+ void getEntries(List<T> result)
+ {
+ for (NCNode<T> subrange : subranges)
+ {
+ subrange.getEntries(result);
+ }
+ }
+
+ /**
+ * Deletes the given entry from the store, returning true if it was found (and
+ * deleted), else false. This method makes no assumption that the entry is in
+ * the 'expected' place in the store, in case it has been modified since it
+ * was added. Only the first 'same object' match is deleted, not 'equal' or
+ * multiple objects.
+ *
+ * @param entry
+ */
+ public synchronized boolean delete(T entry)
+ {
+ if (entry == null)
+ {
+ return false;
+ }
+ for (int i = 0; i < subranges.size(); i++)
+ {
+ NCNode<T> subrange = subranges.get(i);
+ NCList<T> subRegions = subrange.getSubRegions();
+
+ if (subrange.getRegion() == entry)
+ {
+ /*
+ * if the subrange is rooted on this entry, promote its
+ * subregions (if any) to replace the subrange here;
+ * NB have to resort subranges after doing this since e.g.
+ * [10-30 [12-20 [16-18], 13-19]]
+ * after deleting 12-20, 16-18 is promoted to sibling of 13-19
+ * but should follow it in the list of subranges of 10-30
+ */
+ subranges.remove(i);
+ if (subRegions != null)
+ {
+ subranges.addAll(subRegions.subranges);
+ Collections.sort(subranges, RangeComparator.BY_START_POSITION);
+ }
+ size--;
+ return true;
+ }
+ else
+ {
+ if (subRegions != null && subRegions.delete(entry))
+ {
+ size--;
+ subrange.deleteSubRegionsIfEmpty();
+ return true;
+ }
+ }
+ }
+ return false;
+ }
+}
--- /dev/null
+package jalview.datamodel.features;
+
+import java.util.ArrayList;
+import java.util.List;
+
+/**
+ * Each node of the NCList tree consists of a range, and (optionally) the NCList
+ * of ranges it encloses
+ *
+ * @param <V>
+ */
+class NCNode<V extends ContiguousI> implements ContiguousI
+{
+ /*
+ * deep size (number of ranges included)
+ */
+ private int size;
+
+ private V region;
+
+ /*
+ * null, or an object holding contained subregions of this nodes region
+ */
+ private NCList<V> subregions;
+
+ /**
+ * Constructor given a list of ranges
+ *
+ * @param ranges
+ */
+ NCNode(List<V> ranges)
+ {
+ build(ranges);
+ }
+
+ /**
+ * Constructor given a single range
+ *
+ * @param range
+ */
+ NCNode(V range)
+ {
+ List<V> ranges = new ArrayList<V>();
+ ranges.add(range);
+ build(ranges);
+ }
+
+ NCNode(V entry, NCList<V> newNCList)
+ {
+ region = entry;
+ subregions = newNCList;
+ size = 1 + newNCList.size();
+ }
+
+ /**
+ * @param ranges
+ */
+ protected void build(List<V> ranges)
+ {
+ size = ranges.size();
+
+ if (!ranges.isEmpty())
+ {
+ region = ranges.get(0);
+ }
+ if (ranges.size() > 1)
+ {
+ subregions = new NCList<V>(ranges.subList(1, ranges.size()));
+ }
+ }
+
+ @Override
+ public int getBegin()
+ {
+ return region.getBegin();
+ }
+
+ @Override
+ public int getEnd()
+ {
+ return region.getEnd();
+ }
+
+ /**
+ * Formats the node as a bracketed list e.g.
+ *
+ * <pre>
+ * [1-100 [10-30 [10-20]], 15-30 [20-20]]
+ * </pre>
+ */
+ @Override
+ public String toString() {
+ StringBuilder sb = new StringBuilder(10 * size);
+ sb.append(region.getBegin()).append("-").append(region.getEnd());
+ if (subregions != null)
+ {
+ sb.append(" ").append(subregions.toString());
+ }
+ return sb.toString();
+ }
+
+ void prettyPrint(StringBuilder sb, int offset, int indent) {
+ for (int i = 0 ; i < offset ; i++) {
+ sb.append(" ");
+ }
+ sb.append(region.getBegin()).append("-").append(region.getEnd());
+ if (subregions != null)
+ {
+ sb.append(System.lineSeparator());
+ subregions.prettyPrint(sb, offset + 2, indent);
+ }
+ }
+ /**
+ * Add any ranges that overlap the from-to range to the result list
+ *
+ * @param from
+ * @param to
+ * @param result
+ */
+ void findOverlaps(long from, long to, List<V> result)
+ {
+ if (region.getBegin() <= to && region.getEnd() >= from)
+ {
+ result.add(region);
+ }
+ if (subregions != null)
+ {
+ subregions.findOverlaps(from, to, result);
+ }
+ }
+
+ /**
+ * Add one range to this subrange
+ *
+ * @param entry
+ */
+ synchronized void add(V entry)
+ {
+ if (entry.getBegin() < region.getBegin() || entry.getEnd() > region.getEnd()) {
+ throw new IllegalArgumentException(String.format(
+ "adding improper subrange %d-%d to range %d-%d",
+ entry.getBegin(), entry.getEnd(), region.getBegin(),
+ region.getEnd()));
+ }
+ if (subregions == null)
+ {
+ subregions = new NCList<V>(entry);
+ }
+ else
+ {
+ subregions.add(entry);
+ }
+ size++;
+ }
+
+ /**
+ * Answers true if the data held satisfy the rules of construction of an
+ * NCList, else false.
+ *
+ * @return
+ */
+ boolean isValid()
+ {
+ /*
+ * we don't handle reverse ranges
+ */
+ if (region != null && region.getBegin() > region.getEnd())
+ {
+ return false;
+ }
+ if (subregions == null)
+ {
+ return true;
+ }
+ return subregions.isValid(getBegin(), getEnd());
+ }
+
+ /**
+ * Adds all contained entries to the given list
+ *
+ * @param entries
+ */
+ void getEntries(List<V> entries)
+ {
+ entries.add(region);
+ if (subregions != null)
+ {
+ subregions.getEntries(entries);
+ }
+ }
+
+ /**
+ * Answers true if this object contains the given entry (by object equals
+ * test), else false
+ *
+ * @param entry
+ * @return
+ */
+ boolean contains(V entry)
+ {
+ if (entry == null)
+ {
+ return false;
+ }
+ if (entry.equals(region))
+ {
+ return true;
+ }
+ return subregions == null ? false : subregions.contains(entry);
+ }
+
+ /**
+ * Answers the 'root' region modelled by this object
+ *
+ * @return
+ */
+ V getRegion()
+ {
+ return region;
+ }
+
+ /**
+ * Answers the (possibly null) contained regions within this object
+ *
+ * @return
+ */
+ NCList<V> getSubRegions()
+ {
+ return subregions;
+ }
+
+ /**
+ * Nulls the subregion reference if it is empty (after a delete entry
+ * operation)
+ */
+ void deleteSubRegionsIfEmpty()
+ {
+ if (subregions != null && subregions.size() == 0)
+ {
+ subregions = null;
+ }
+ }
+
+ /**
+ * Answers the (deep) size of this node i.e. the number of ranges it models
+ *
+ * @return
+ */
+ int size()
+ {
+ return size;
+ }
+}
--- /dev/null
+package jalview.datamodel.features;
+
+
+public class Range implements ContiguousI
+{
+ final int start;
+
+ final int end;
+
+ @Override
+ public int getBegin()
+ {
+ return start;
+ }
+
+ @Override
+ public int getEnd()
+ {
+ return end;
+ }
+
+ public Range(int i, int j)
+ {
+ start = i;
+ end = j;
+ }
+
+ @Override
+ public String toString()
+ {
+ return String.valueOf(start) + "-" + String.valueOf(end);
+ }
+}
--- /dev/null
+package jalview.datamodel.features;
+
+import java.util.Comparator;
+
+/**
+ * A comparator that orders ranges by either start position or end position
+ * ascending. If the position matches, ordering is resolved by end position (or
+ * start position).
+ *
+ * @author gmcarstairs
+ *
+ */
+public class RangeComparator implements Comparator<ContiguousI>
+{
+ public static final Comparator<ContiguousI> BY_START_POSITION = new RangeComparator(
+ true);
+
+ public static final Comparator<ContiguousI> BY_END_POSITION = new RangeComparator(
+ false);
+
+ boolean byStart;
+
+ /**
+ * Constructor
+ *
+ * @param byStartPosition
+ * if true, order based on start position, if false by end position
+ */
+ RangeComparator(boolean byStartPosition)
+ {
+ byStart = byStartPosition;
+ }
+
+ @Override
+ public int compare(ContiguousI o1, ContiguousI o2)
+ {
+ int len1 = o1.getEnd() - o1.getBegin();
+ int len2 = o2.getEnd() - o2.getBegin();
+
+ if (byStart)
+ {
+ return compare(o1.getBegin(), o2.getBegin(), len1, len2);
+ }
+ else
+ {
+ return compare(o1.getEnd(), o2.getEnd(), len1, len2);
+ }
+ }
+
+ /**
+ * Compares two ranges for ordering
+ *
+ * @param pos1
+ * first range positional ordering criterion
+ * @param pos2
+ * second range positional ordering criterion
+ * @param len1
+ * first range length ordering criterion
+ * @param len2
+ * second range length ordering criterion
+ * @return
+ */
+ public int compare(long pos1, long pos2, int len1, int len2)
+ {
+ int order = Long.compare(pos1, pos2);
+ if (order == 0)
+ {
+ /*
+ * if tied on position order, longer length sorts to left
+ * i.e. the negation of normal ordering by length
+ */
+ order = -Integer.compare(len1, len2);
+ }
+ return order;
+ }
+}
--- /dev/null
+package jalview.datamodel.features;
+
+import jalview.datamodel.SequenceFeature;
+import jalview.io.gff.SequenceOntologyFactory;
+import jalview.io.gff.SequenceOntologyI;
+
+import java.util.ArrayList;
+import java.util.Arrays;
+import java.util.Collections;
+import java.util.Comparator;
+import java.util.HashSet;
+import java.util.List;
+import java.util.Map;
+import java.util.Map.Entry;
+import java.util.Set;
+import java.util.TreeMap;
+
+/**
+ * A class that stores sequence features in a way that supports efficient
+ * querying by type and location (overlap). Intended for (but not limited to)
+ * storage of features for one sequence.
+ *
+ * @author gmcarstairs
+ *
+ */
+public class SequenceFeatures implements SequenceFeaturesI
+{
+ /**
+ * a comparator for sorting features by start position ascending
+ */
+ private static Comparator<ContiguousI> FORWARD_STRAND = new Comparator<ContiguousI>()
+ {
+ @Override
+ public int compare(ContiguousI o1, ContiguousI o2)
+ {
+ return Integer.compare(o1.getBegin(), o2.getBegin());
+ }
+ };
+
+ /**
+ * a comparator for sorting features by end position descending
+ */
+ private static Comparator<ContiguousI> REVERSE_STRAND = new Comparator<ContiguousI>()
+ {
+ @Override
+ public int compare(ContiguousI o1, ContiguousI o2)
+ {
+ return Integer.compare(o2.getEnd(), o1.getEnd());
+ }
+ };
+
+ /*
+ * map from feature type to structured store of features for that type
+ * null types are permitted (but not a good idea!)
+ */
+ private Map<String, FeatureStore> featureStore;
+
+ /**
+ * Constructor
+ */
+ public SequenceFeatures()
+ {
+ /*
+ * use a TreeMap so that features are returned in alphabetical order of type
+ * wrap as a synchronized map for add and delete operations
+ */
+ // featureStore = Collections
+ // .synchronizedSortedMap(new TreeMap<String, FeatureStore>());
+ featureStore = new TreeMap<String, FeatureStore>();
+ }
+
+ /**
+ * {@inheritDoc}
+ */
+ @Override
+ public boolean add(SequenceFeature sf)
+ {
+ String type = sf.getType();
+ if (type == null)
+ {
+ System.err.println("Feature type may not be null: " + sf.toString());
+ return false;
+ }
+
+ if (featureStore.get(type) == null)
+ {
+ featureStore.put(type, new FeatureStore());
+ }
+ return featureStore.get(type).addFeature(sf);
+ }
+
+ /**
+ * {@inheritDoc}
+ */
+ @Override
+ public List<SequenceFeature> findFeatures(int from, int to,
+ String... type)
+ {
+ List<SequenceFeature> result = new ArrayList<SequenceFeature>();
+
+ for (String featureType : varargToTypes(type))
+ {
+ FeatureStore features = featureStore.get(featureType);
+ if (features != null)
+ {
+ result.addAll(features.findOverlappingFeatures(from, to));
+ }
+ }
+
+ return result;
+ }
+
+ /**
+ * {@inheritDoc}
+ */
+ @Override
+ public List<SequenceFeature> getAllFeatures(String... type)
+ {
+ List<SequenceFeature> result = new ArrayList<SequenceFeature>();
+
+ result.addAll(getPositionalFeatures(type));
+
+ result.addAll(getNonPositionalFeatures());
+
+ return result;
+ }
+
+ /**
+ * {@inheritDoc}
+ */
+ @Override
+ public List<SequenceFeature> getFeaturesByOntology(String... ontologyTerm)
+ {
+ if (ontologyTerm == null || ontologyTerm.length == 0)
+ {
+ return new ArrayList<SequenceFeature>();
+ }
+
+ Set<String> featureTypes = getFeatureTypes(ontologyTerm);
+ return getAllFeatures(featureTypes.toArray(new String[featureTypes
+ .size()]));
+ }
+
+ /**
+ * {@inheritDoc}
+ */
+ @Override
+ public int getFeatureCount(boolean positional, String... type)
+ {
+ int result = 0;
+
+ for (String featureType : varargToTypes(type))
+ {
+ FeatureStore featureSet = featureStore.get(featureType);
+ if (featureSet != null)
+ {
+ result += featureSet.getFeatureCount(positional);
+ }
+ }
+ return result;
+ }
+
+ /**
+ * {@inheritDoc}
+ */
+ @Override
+ public int getTotalFeatureLength(String... type)
+ {
+ int result = 0;
+
+ for (String featureType : varargToTypes(type))
+ {
+ FeatureStore featureSet = featureStore.get(featureType);
+ if (featureSet != null)
+ {
+ result += featureSet.getTotalFeatureLength();
+ }
+ }
+ return result;
+
+ }
+
+ /**
+ * {@inheritDoc}
+ */
+ @Override
+ public List<SequenceFeature> getPositionalFeatures(String... type)
+ {
+ List<SequenceFeature> result = new ArrayList<SequenceFeature>();
+
+ for (String featureType : varargToTypes(type))
+ {
+ FeatureStore featureSet = featureStore.get(featureType);
+ if (featureSet != null)
+ {
+ result.addAll(featureSet.getPositionalFeatures());
+ }
+ }
+ return result;
+ }
+
+ /**
+ * A convenience method that converts a vararg for feature types to an
+ * Iterable, replacing the value with the stored feature types if it is null
+ * or empty
+ *
+ * @param type
+ * @return
+ */
+ protected Iterable<String> varargToTypes(String... type)
+ {
+ if (type == null || type.length == 0)
+ {
+ /*
+ * no vararg parameter supplied
+ */
+ return featureStore.keySet();
+ }
+
+ /*
+ * else make a copy of the list, and remove any null value just in case,
+ * as it would cause errors looking up the features Map
+ */
+ List<String> types = new ArrayList<String>(Arrays.asList(type));
+ types.remove(null);
+ return types;
+ }
+
+ /**
+ * {@inheritDoc}
+ */
+ @Override
+ public List<SequenceFeature> getContactFeatures(String... type)
+ {
+ List<SequenceFeature> result = new ArrayList<SequenceFeature>();
+
+ for (String featureType : varargToTypes(type))
+ {
+ FeatureStore featureSet = featureStore.get(featureType);
+ if (featureSet != null)
+ {
+ result.addAll(featureSet.getContactFeatures());
+ }
+ }
+ return result;
+ }
+
+ /**
+ * {@inheritDoc}
+ */
+ @Override
+ public List<SequenceFeature> getNonPositionalFeatures(String... type)
+ {
+ List<SequenceFeature> result = new ArrayList<SequenceFeature>();
+
+ for (String featureType : varargToTypes(type))
+ {
+ FeatureStore featureSet = featureStore.get(featureType);
+ if (featureSet != null)
+ {
+ result.addAll(featureSet.getNonPositionalFeatures());
+ }
+ }
+ return result;
+ }
+
+ /**
+ * {@inheritDoc}
+ */
+ @Override
+ public boolean delete(SequenceFeature sf)
+ {
+ for (FeatureStore featureSet : featureStore.values())
+ {
+ if (featureSet.delete(sf))
+ {
+ return true;
+ }
+ }
+ return false;
+ }
+
+ /**
+ * {@inheritDoc}
+ */
+ @Override
+ public boolean hasFeatures()
+ {
+ for (FeatureStore featureSet : featureStore.values())
+ {
+ if (!featureSet.isEmpty())
+ {
+ return true;
+ }
+ }
+ return false;
+ }
+
+ /**
+ * {@inheritDoc}
+ */
+ @Override
+ public Set<String> getFeatureGroups(boolean positionalFeatures,
+ String... type)
+ {
+ Set<String> groups = new HashSet<String>();
+
+ Iterable<String> types = varargToTypes(type);
+
+ for (String featureType : types)
+ {
+ FeatureStore featureSet = featureStore.get(featureType);
+ if (featureSet != null)
+ {
+ groups.addAll(featureSet.getFeatureGroups(positionalFeatures));
+ }
+ }
+
+ return groups;
+ }
+
+ /**
+ * {@inheritDoc}
+ */
+ @Override
+ public Set<String> getFeatureTypesForGroups(boolean positionalFeatures,
+ String... groups)
+ {
+ Set<String> result = new HashSet<String>();
+
+ for (Entry<String, FeatureStore> featureType : featureStore.entrySet())
+ {
+ Set<String> featureGroups = featureType.getValue().getFeatureGroups(
+ positionalFeatures);
+ for (String group : groups)
+ {
+ if (featureGroups.contains(group))
+ {
+ /*
+ * yes this feature type includes one of the query groups
+ */
+ result.add(featureType.getKey());
+ break;
+ }
+ }
+ }
+
+ return result;
+ }
+
+ /**
+ * {@inheritDoc}
+ */
+ @Override
+ public Set<String> getFeatureTypes(String... soTerm)
+ {
+ Set<String> types = new HashSet<String>();
+ for (Entry<String, FeatureStore> entry : featureStore.entrySet())
+ {
+ String type = entry.getKey();
+ if (!entry.getValue().isEmpty() && isOntologyTerm(type, soTerm))
+ {
+ types.add(type);
+ }
+ }
+ return types;
+ }
+
+ /**
+ * Answers true if the given type is one of the specified sequence ontology
+ * terms (or a sub-type of one), or if no terms are supplied. Answers false if
+ * filter terms are specified and the given term does not match any of them.
+ *
+ * @param type
+ * @param soTerm
+ * @return
+ */
+ protected boolean isOntologyTerm(String type, String... soTerm)
+ {
+ if (soTerm == null || soTerm.length == 0)
+ {
+ return true;
+ }
+ SequenceOntologyI so = SequenceOntologyFactory.getInstance();
+ for (String term : soTerm)
+ {
+ if (so.isA(type, term))
+ {
+ return true;
+ }
+ }
+ return false;
+ }
+
+ /**
+ * {@inheritDoc}
+ */
+ @Override
+ public float getMinimumScore(String type, boolean positional)
+ {
+ return featureStore.containsKey(type) ? featureStore.get(type)
+ .getMinimumScore(positional) : Float.NaN;
+ }
+
+ /**
+ * {@inheritDoc}
+ */
+ @Override
+ public float getMaximumScore(String type, boolean positional)
+ {
+ return featureStore.containsKey(type) ? featureStore.get(type)
+ .getMaximumScore(positional) : Float.NaN;
+ }
+
+ /**
+ * A convenience method to sort features by start position ascending (if on
+ * forward strand), or end position descending (if on reverse strand)
+ *
+ * @param features
+ * @param forwardStrand
+ */
+ public static void sortFeatures(List<SequenceFeature> features,
+ final boolean forwardStrand)
+ {
+ Collections.sort(features, forwardStrand ? FORWARD_STRAND
+ : REVERSE_STRAND);
+ }
+}
\ No newline at end of file
--- /dev/null
+package jalview.datamodel.features;
+
+import jalview.datamodel.SequenceFeature;
+
+import java.util.List;
+import java.util.Set;
+
+public interface SequenceFeaturesI
+{
+
+ /**
+ * Adds one sequence feature to the store, and returns true, unless the
+ * feature is already contained in the store, in which case this method
+ * returns false. Containment is determined by SequenceFeature.equals()
+ * comparison. Answers false, and does not add the feature, if feature type is
+ * null.
+ *
+ * @param sf
+ */
+ boolean add(SequenceFeature sf);
+
+ /**
+ * Returns a (possibly empty) list of features, optionally restricted to
+ * specified types, which overlap the given (inclusive) sequence position
+ * range
+ *
+ * @param from
+ * @param to
+ * @param type
+ * @return
+ */
+ List<SequenceFeature> findFeatures(int from, int to,
+ String... type);
+
+ /**
+ * Answers a list of all features stored, in no particular guaranteed order.
+ * Positional features may optionally be restricted to specified types, but
+ * all non-positional features (if any) are always returned.
+ * <p>
+ * To filter non-positional features by type, use
+ * getNonPositionalFeatures(type).
+ *
+ * @param type
+ * @return
+ */
+ List<SequenceFeature> getAllFeatures(String... type);
+
+ /**
+ * Answers a list of all features stored, whose type either matches one of the
+ * given ontology terms, or is a specialisation of a term in the Sequence
+ * Ontology. Results are returned in no particular guaranteed order.
+ *
+ * @param ontologyTerm
+ * @return
+ */
+ List<SequenceFeature> getFeaturesByOntology(String... ontologyTerm);
+
+ /**
+ * Answers the number of (positional or non-positional) features, optionally
+ * restricted to specified feature types. Contact features are counted as 1.
+ *
+ * @param positional
+ * @param type
+ * @return
+ */
+ int getFeatureCount(boolean positional, String... type);
+
+ /**
+ * Answers the total length of positional features, optionally restricted to
+ * specified feature types. Contact features are counted as length 1.
+ *
+ * @param type
+ * @return
+ */
+ int getTotalFeatureLength(String... type);
+
+ /**
+ * Answers a list of all positional features, optionally restricted to
+ * specified types, in no particular guaranteed order
+ *
+ * @param type
+ * @return
+ */
+ List<SequenceFeature> getPositionalFeatures(
+ String... type);
+
+ /**
+ * Answers a list of all contact features, optionally restricted to specified
+ * types, in no particular guaranteed order
+ *
+ * @return
+ */
+ List<SequenceFeature> getContactFeatures(String... type);
+
+ /**
+ * Answers a list of all non-positional features, optionally restricted to
+ * specified types, in no particular guaranteed order
+ *
+ * @param type
+ * if no type is specified, all are returned
+ * @return
+ */
+ List<SequenceFeature> getNonPositionalFeatures(
+ String... type);
+
+ /**
+ * Deletes the given feature from the store, returning true if it was found
+ * (and deleted), else false. This method makes no assumption that the feature
+ * is in the 'expected' place in the store, in case it has been modified since
+ * it was added.
+ *
+ * @param sf
+ */
+ boolean delete(SequenceFeature sf);
+
+ /**
+ * Answers true if this store contains at least one feature, else false
+ *
+ * @return
+ */
+ boolean hasFeatures();
+
+ /**
+ * Returns a set of the distinct feature groups present in the collection. The
+ * set may include null. The boolean parameter determines whether the groups
+ * for positional or for non-positional features are returned. The optional
+ * type parameter may be used to restrict to groups for specified feature
+ * types.
+ *
+ * @param positionalFeatures
+ * @param type
+ * @return
+ */
+ Set<String> getFeatureGroups(boolean positionalFeatures,
+ String... type);
+
+ /**
+ * Answers the set of distinct feature types for which there is at least one
+ * feature with one of the given feature group(s). The boolean parameter
+ * determines whether the groups for positional or for non-positional features
+ * are returned.
+ *
+ * @param positionalFeatures
+ * @param groups
+ * @return
+ */
+ Set<String> getFeatureTypesForGroups(
+ boolean positionalFeatures, String... groups);
+
+ /**
+ * Answers a set of the distinct feature types for which a feature is stored.
+ * The types may optionally be restricted to those which match, or are a
+ * subtype of, given sequence ontology terms
+ *
+ * @return
+ */
+ Set<String> getFeatureTypes(String... soTerm);
+
+ /**
+ * Answers the minimum score held for positional or non-positional features
+ * for the specified type. This may be Float.NaN if there are no features, or
+ * none has a non-NaN score.
+ *
+ * @param type
+ * @param positional
+ * @return
+ */
+ float getMinimumScore(String type, boolean positional);
+
+ /**
+ * Answers the maximum score held for positional or non-positional features
+ * for the specified type. This may be Float.NaN if there are no features, or
+ * none has a non-NaN score.
+ *
+ * @param type
+ * @param positional
+ * @return
+ */
+ float getMaximumScore(String type, boolean positional);
+}
\ No newline at end of file
/*
* add cds features to dna sequence
*/
- for (int xint = 0; exons != null && xint < exons.length; xint += 2)
+ String cds = feature.getName(); // "CDS"
+ for (int xint = 0; exons != null && xint < exons.length - 1; xint += 2)
{
- SequenceFeature sf = makeCdsFeature(exons, xint, proteinName,
- proteinId, vals, codonStart);
- sf.setType(feature.getName()); // "CDS"
+ int exonStart = exons[xint];
+ int exonEnd = exons[xint + 1];
+ int begin = Math.min(exonStart, exonEnd);
+ int end = Math.max(exonStart, exonEnd);
+ int exonNumber = xint / 2 + 1;
+ String desc = String.format("Exon %d for protein '%s' EMBLCDS:%s",
+ exonNumber, proteinName, proteinId);
+
+ SequenceFeature sf = makeCdsFeature(cds, desc, begin, end,
+ sourceDb, vals);
+
sf.setEnaLocation(feature.getLocation());
- sf.setFeatureGroup(sourceDb);
+ boolean forwardStrand = exonStart <= exonEnd;
+ sf.setStrand(forwardStrand ? "+" : "-");
+ sf.setPhase(String.valueOf(codonStart - 1));
+ sf.setValue(FeatureProperties.EXONPOS, exonNumber);
+ sf.setValue(FeatureProperties.EXONPRODUCT, proteinName);
+
dna.addSequenceFeature(sf);
}
}
/**
* Helper method to construct a SequenceFeature for one cds range
*
- * @param exons
- * array of cds [start, end, ...] positions
- * @param exonStartIndex
- * offset into the exons array
- * @param proteinName
- * @param proteinAccessionId
+ * @param type
+ * feature type ("CDS")
+ * @param desc
+ * description
+ * @param begin
+ * start position
+ * @param end
+ * end position
+ * @param group
+ * feature group
* @param vals
* map of 'miscellaneous values' for feature
- * @param codonStart
- * codon start position for CDS (1/2/3, normally 1)
* @return
*/
- protected SequenceFeature makeCdsFeature(int[] exons, int exonStartIndex,
- String proteinName, String proteinAccessionId,
- Map<String, String> vals, int codonStart)
- {
- int exonNumber = exonStartIndex / 2 + 1;
- SequenceFeature sf = new SequenceFeature();
- sf.setBegin(Math.min(exons[exonStartIndex], exons[exonStartIndex + 1]));
- sf.setEnd(Math.max(exons[exonStartIndex], exons[exonStartIndex + 1]));
- sf.setDescription(String.format("Exon %d for protein '%s' EMBLCDS:%s",
- exonNumber, proteinName, proteinAccessionId));
- sf.setPhase(String.valueOf(codonStart - 1));
- sf.setStrand(exons[exonStartIndex] <= exons[exonStartIndex + 1] ? "+"
- : "-");
- sf.setValue(FeatureProperties.EXONPOS, exonNumber);
- sf.setValue(FeatureProperties.EXONPRODUCT, proteinName);
+ protected SequenceFeature makeCdsFeature(String type, String desc,
+ int begin, int end, String group, Map<String, String> vals)
+ {
+ SequenceFeature sf = new SequenceFeature(type, desc, begin, end,
+ Float.NaN, group);
+
if (!vals.isEmpty())
{
StringBuilder sb = new StringBuilder();
import jalview.datamodel.Sequence;
import jalview.datamodel.SequenceFeature;
import jalview.datamodel.SequenceI;
+import jalview.datamodel.features.SequenceFeatures;
import jalview.io.gff.SequenceOntologyFactory;
import jalview.io.gff.SequenceOntologyI;
import jalview.schemes.FeatureColour;
*/
protected void clearGeneFeatures(SequenceI gene)
{
- SequenceFeature[] sfs = gene.getSequenceFeatures();
- if (sfs != null)
+ /*
+ * Note we include NMD_transcript_variant here because it behaves like
+ * 'transcript' in Ensembl, although strictly speaking it is not
+ * (it is a sub-type of sequence_variant)
+ */
+ String[] soTerms = new String[] {
+ SequenceOntologyI.NMD_TRANSCRIPT_VARIANT,
+ SequenceOntologyI.TRANSCRIPT, SequenceOntologyI.EXON,
+ SequenceOntologyI.CDS };
+ List<SequenceFeature> sfs = gene.getFeatures().getFeaturesByOntology(
+ soTerms);
+ for (SequenceFeature sf : sfs)
{
- SequenceOntologyI so = SequenceOntologyFactory.getInstance();
- List<SequenceFeature> filtered = new ArrayList<SequenceFeature>();
- for (SequenceFeature sf : sfs)
- {
- String type = sf.getType();
- if (!isTranscript(type) && !so.isA(type, SequenceOntologyI.EXON)
- && !so.isA(type, SequenceOntologyI.CDS))
- {
- filtered.add(sf);
- }
- }
- gene.setSequenceFeatures(filtered
- .toArray(new SequenceFeature[filtered.size()]));
+ gene.deleteFeature(sf);
}
}
{
splices = findFeatures(gene, SequenceOntologyI.CDS, parentId);
}
+ SequenceFeatures.sortFeatures(splices, true);
int transcriptLength = 0;
final char[] geneChars = gene.getSequence();
mapTo.add(new int[] { 1, transcriptLength });
MapList mapping = new MapList(mappedFrom, mapTo, 1, 1);
EnsemblCdna cdna = new EnsemblCdna(getDomain());
- cdna.transferFeatures(gene.getSequenceFeatures(),
+ cdna.transferFeatures(gene.getFeatures().getPositionalFeatures(),
transcript.getDatasetSequence(), mapping, parentId);
/*
List<SequenceFeature> transcriptFeatures = new ArrayList<SequenceFeature>();
String parentIdentifier = GENE_PREFIX + accId;
- SequenceFeature[] sfs = geneSequence.getSequenceFeatures();
+ // todo optimise here by transcript type!
+ List<SequenceFeature> sfs = geneSequence.getFeatures()
+ .getPositionalFeatures();
- if (sfs != null)
+ for (SequenceFeature sf : sfs)
{
- for (SequenceFeature sf : sfs)
+ if (isTranscript(sf.getType()))
{
- if (isTranscript(sf.getType()))
+ String parent = (String) sf.getValue(PARENT);
+ if (parentIdentifier.equals(parent))
{
- String parent = (String) sf.getValue(PARENT);
- if (parentIdentifier.equals(parent))
- {
- transcriptFeatures.add(sf);
- }
+ transcriptFeatures.add(sf);
}
}
}
import jalview.datamodel.Mapping;
import jalview.datamodel.SequenceFeature;
import jalview.datamodel.SequenceI;
+import jalview.datamodel.features.SequenceFeatures;
import jalview.exceptions.JalviewException;
import jalview.io.FastaFile;
import jalview.io.FileParse;
import jalview.io.gff.SequenceOntologyI;
import jalview.util.Comparison;
import jalview.util.DBRefUtils;
+import jalview.util.IntRangeComparator;
import jalview.util.MapList;
-import jalview.util.RangeComparator;
import java.io.IOException;
import java.net.MalformedURLException;
import java.util.ArrayList;
import java.util.Arrays;
import java.util.Collections;
-import java.util.Comparator;
import java.util.List;
/**
protected MapList getGenomicRangesFromFeatures(SequenceI sourceSequence,
String accId, int start)
{
- SequenceFeature[] sfs = sourceSequence.getSequenceFeatures();
- if (sfs == null)
+ // SequenceFeature[] sfs = sourceSequence.getSequenceFeatures();
+ List<SequenceFeature> sfs = sourceSequence.getFeatures()
+ .getPositionalFeatures();
+ if (sfs.isEmpty())
{
return null;
}
* a final sort is needed since Ensembl returns CDS sorted within source
* (havana / ensembl_havana)
*/
- Collections.sort(regions, new RangeComparator(direction == 1));
+ Collections.sort(regions, direction == 1 ? IntRangeComparator.ASCENDING
+ : IntRangeComparator.DESCENDING);
List<int[]> to = Arrays.asList(new int[] { start,
start + mappedLength - 1 });
if (mappedRange != null)
{
- SequenceFeature copy = new SequenceFeature(sf);
- copy.setBegin(Math.min(mappedRange[0], mappedRange[1]));
- copy.setEnd(Math.max(mappedRange[0], mappedRange[1]));
- if (".".equals(copy.getFeatureGroup()))
+ String group = sf.getFeatureGroup();
+ if (".".equals(group))
{
- copy.setFeatureGroup(getDbSource());
+ group = getDbSource();
}
+ int newBegin = Math.min(mappedRange[0], mappedRange[1]);
+ int newEnd = Math.max(mappedRange[0], mappedRange[1]);
+ SequenceFeature copy = new SequenceFeature(sf, newBegin, newEnd,
+ group);
targetSequence.addSequenceFeature(copy);
/*
return false;
}
- // long start = System.currentTimeMillis();
- SequenceFeature[] sfs = sourceSequence.getSequenceFeatures();
+ long start = System.currentTimeMillis();
+ // SequenceFeature[] sfs = sourceSequence.getSequenceFeatures();
+ List<SequenceFeature> sfs = sourceSequence.getFeatures()
+ .getPositionalFeatures();
MapList mapping = getGenomicRangesFromFeatures(sourceSequence,
accessionId, targetSequence.getStart());
if (mapping == null)
boolean result = transferFeatures(sfs, targetSequence, mapping,
accessionId);
- // System.out.println("transferFeatures (" + (sfs.length) + " --> "
- // + targetSequence.getSequenceFeatures().length + ") to "
- // + targetSequence.getName()
- // + " took " + (System.currentTimeMillis() - start) + "ms");
+ System.out.println("transferFeatures (" + (sfs.size()) + " --> "
+ + targetSequence.getFeatures().getFeatureCount(true) + ") to "
+ + targetSequence.getName() + " took "
+ + (System.currentTimeMillis() - start) + "ms");
return result;
}
* converted using the mapping. Features which do not overlap are ignored.
* Features whose parent is not the specified identifier are also ignored.
*
- * @param features
+ * @param sfs
* @param targetSequence
* @param mapping
* @param parentId
* @return
*/
- protected boolean transferFeatures(SequenceFeature[] features,
+ protected boolean transferFeatures(List<SequenceFeature> sfs,
SequenceI targetSequence, MapList mapping, String parentId)
{
final boolean forwardStrand = mapping.isFromForwardStrand();
* position descending if reverse strand) so as to add them in
* 'forwards' order to the target sequence
*/
- sortFeatures(features, forwardStrand);
+ SequenceFeatures.sortFeatures(sfs, forwardStrand);
boolean transferred = false;
- for (SequenceFeature sf : features)
+ for (SequenceFeature sf : sfs)
{
if (retainFeature(sf, parentId))
{
}
/**
- * Sort features by start position ascending (if on forward strand), or end
- * position descending (if on reverse strand)
- *
- * @param features
- * @param forwardStrand
- */
- protected static void sortFeatures(SequenceFeature[] features,
- final boolean forwardStrand)
- {
- Arrays.sort(features, new Comparator<SequenceFeature>()
- {
- @Override
- public int compare(SequenceFeature o1, SequenceFeature o2)
- {
- if (forwardStrand)
- {
- return Integer.compare(o1.getBegin(), o2.getBegin());
- }
- else
- {
- return Integer.compare(o2.getEnd(), o1.getEnd());
- }
- }
- });
- }
-
- /**
* Answers true if the feature type is one we want to keep for the sequence.
* Some features are only retrieved in order to identify the sequence range,
* and may then be discarded as redundant information (e.g. "CDS" feature for
/**
* Returns a (possibly empty) list of features on the sequence which have the
- * specified sequence ontology type (or a sub-type of it), and the given
+ * specified sequence ontology term (or a sub-type of it), and the given
* identifier as parent
*
* @param sequence
- * @param type
+ * @param term
* @param parentId
* @return
*/
protected List<SequenceFeature> findFeatures(SequenceI sequence,
- String type, String parentId)
+ String term, String parentId)
{
List<SequenceFeature> result = new ArrayList<SequenceFeature>();
- SequenceFeature[] sfs = sequence.getSequenceFeatures();
- if (sfs != null)
+ List<SequenceFeature> sfs = sequence.getFeatures()
+ .getFeaturesByOntology(term);
+ for (SequenceFeature sf : sfs)
{
- SequenceOntologyI so = SequenceOntologyFactory.getInstance();
- for (SequenceFeature sf : sfs)
+ String parent = (String) sf.getValue(PARENT);
+ if (parent != null && parent.equals(parentId))
{
- if (so.isA(sf.getType(), type))
- {
- String parent = (String) sf.getValue(PARENT);
- if (parent.equals(parentId))
- {
- result.add(sf);
- }
- }
+ result.add(sf);
}
}
+
return result;
}
package jalview.ext.rbvi.chimera;
-import jalview.util.RangeComparator;
+import jalview.util.IntRangeComparator;
import java.util.ArrayList;
import java.util.Collections;
/*
* sort ranges into ascending start position order
*/
- Collections.sort(rangeList, new RangeComparator(true));
+ Collections.sort(rangeList, IntRangeComparator.ASCENDING);
int start = rangeList.isEmpty() ? 0 : rangeList.get(0)[0];
int end = rangeList.isEmpty() ? 0 : rangeList.get(0)[1];
StructureMapping mapping, SequenceI seq,
Map<String, Map<Object, AtomSpecModel>> theMap, int modelNumber)
{
- SequenceFeature[] sfs = seq.getSequenceFeatures();
- if (sfs == null)
- {
- return;
- }
-
+ List<SequenceFeature> sfs = seq.getFeatures().getPositionalFeatures(
+ visibleFeatures.toArray(new String[visibleFeatures.size()]));
for (SequenceFeature sf : sfs)
{
String type = sf.getType();
*/
boolean isFromViewer = JalviewChimeraBinding.CHIMERA_FEATURE_GROUP
.equals(sf.getFeatureGroup());
- if (isFromViewer || !visibleFeatures.contains(type))
+ if (isFromViewer)
{
continue;
}
import jalview.math.AlignmentDimension;
import jalview.schemes.ResidueProperties;
import jalview.structure.StructureSelectionManager;
+import jalview.util.Comparison;
import jalview.util.MessageManager;
import jalview.util.Platform;
import jalview.viewmodel.ViewportRanges;
sy = s * av.getCharHeight() + scaleHeight;
SequenceI seq = av.getAlignment().getSequenceAt(s);
- SequenceFeature[] features = seq.getSequenceFeatures();
SequenceGroup[] groups = av.getAlignment().findAllGroups(seq);
for (res = 0; res < alwidth; res++)
{
- StringBuilder text = new StringBuilder();
+ StringBuilder text = new StringBuilder(512);
String triplet = null;
if (av.getAlignment().isNucleotide())
{
continue;
}
- int alIndex = seq.findPosition(res);
+ int seqPos = seq.findPosition(res);
gSize = groups.length;
for (g = 0; g < gSize; g++)
{
.append((idWidth + (res + 1) * av.getCharWidth()))
.append(",").append((av.getCharHeight() + sy))
.append("\"").append(" onMouseOver=\"toolTip('")
- .append(alIndex).append(" ").append(triplet);
+ .append(seqPos).append(" ").append(triplet);
}
if (groups[g].getStartRes() < res
}
}
- if (features != null)
+ if (text.length() < 1)
{
- if (text.length() < 1)
- {
- text.append("<area shape=\"rect\" coords=\"")
- .append((idWidth + res * av.getCharWidth()))
- .append(",").append(sy).append(",")
- .append((idWidth + (res + 1) * av.getCharWidth()))
- .append(",").append((av.getCharHeight() + sy))
- .append("\"").append(" onMouseOver=\"toolTip('")
- .append(alIndex).append(" ").append(triplet);
- }
- fSize = features.length;
- for (f = 0; f < fSize; f++)
+ text.append("<area shape=\"rect\" coords=\"")
+ .append((idWidth + res * av.getCharWidth()))
+ .append(",").append(sy).append(",")
+ .append((idWidth + (res + 1) * av.getCharWidth()))
+ .append(",").append((av.getCharHeight() + sy))
+ .append("\"").append(" onMouseOver=\"toolTip('")
+ .append(seqPos).append(" ").append(triplet);
+ }
+ if (!Comparison.isGap(seq.getCharAt(res)))
+ {
+ List<SequenceFeature> features = seq.getFeatures()
+ .findFeatures(seqPos, seqPos);
+ for (SequenceFeature sf : features)
{
-
- if ((features[f].getBegin() <= seq.findPosition(res))
- && (features[f].getEnd() >= seq.findPosition(res)))
+ if (sf.isContactFeature())
{
- if (features[f].isContactFeature())
- {
- if (features[f].getBegin() == seq.findPosition(res)
- || features[f].getEnd() == seq
- .findPosition(res))
- {
- text.append("<br>").append(features[f].getType())
- .append(" ").append(features[f].getBegin())
- .append(":").append(features[f].getEnd());
- }
- }
- else
+ text.append("<br>").append(sf.getType()).append(" ")
+ .append(sf.getBegin()).append(":")
+ .append(sf.getEnd());
+ }
+ else
+ {
+ text.append("<br>");
+ text.append(sf.getType());
+ String description = sf.getDescription();
+ if (description != null
+ && !sf.getType().equals(description))
{
- text.append("<br>");
- text.append(features[f].getType());
- if (features[f].getDescription() != null
- && !features[f].getType().equals(
- features[f].getDescription()))
- {
- text.append(" ").append(features[f].getDescription());
- }
-
- if (features[f].getValue("status") != null)
- {
- text.append(" (").append(features[f].getValue("status"))
- .append(")");
- }
+ description = description.replace("\"", """);
+ text.append(" ").append(description);
}
}
-
+ String status = sf.getStatus();
+ if (status != null && !"".equals(status))
+ {
+ text.append(" (").append(status).append(")");
+ }
+ }
+ if (text.length() > 1)
+ {
+ text.append("')\"; onMouseOut=\"toolTip()\"; href=\"#\">");
+ out.println(text.toString());
}
- }
- if (text.length() > 1)
- {
- text.append("')\"; onMouseOut=\"toolTip()\"; href=\"#\">");
- out.println(text.toString());
}
}
}
.getString("label.no_features_on_alignment");
if (features)
{
- Map<String, FeatureColourI> displayedFeatureColours = ap
- .getFeatureRenderer().getDisplayedFeatureCols();
FeaturesFile formatter = new FeaturesFile();
SequenceI[] sequences = ap.av.getAlignment().getSequencesArray();
Map<String, FeatureColourI> featureColours = ap.getFeatureRenderer()
boolean includeNonPositional = ap.av.isShowNPFeats();
if (GFFFormat.isSelected())
{
- text = new FeaturesFile().printGffFormat(ap.av.getAlignment()
- .getDataset().getSequencesArray(), displayedFeatureColours,
- true, ap.av.isShowNPFeats());
text = formatter.printGffFormat(sequences, featureColours, true,
includeNonPositional);
}
else
{
- text = new FeaturesFile().printJalviewFormat(ap.av.getAlignment()
- .getDataset().getSequencesArray(), displayedFeatureColours,
- true, ap.av.isShowNPFeats()); // ap.av.featuresDisplayed);
text = formatter.printJalviewFormat(sequences, featureColours,
true, includeNonPositional);
}
AlignFrame.DEFAULT_WIDTH, AlignFrame.DEFAULT_HEIGHT);
af.getViewport().setShowSequenceFeatures(showSeqFeatures);
af.getViewport().setFeaturesDisplayed(fd);
+ af.setMenusForViewport();
ColourSchemeI cs = ColourSchemeMapper.getJalviewColourScheme(
colourSchemeName, al);
if (cs != null)
import java.awt.event.MouseEvent;
import java.util.Arrays;
import java.util.Comparator;
+import java.util.HashMap;
import java.util.List;
import javax.swing.JColorChooser;
* YES_OPTION corresponds to the Amend button
* need to refresh Feature Settings if type, group or colour changed
*/
- sf.type = name.getText().trim();
- sf.featureGroup = group.getText().trim();
- sf.description = description.getText().replaceAll("\n", " ");
+ String newType = name.getText().trim();
+ String newFeatureGroup = group.getText().trim();
+ String newDescription = description.getText().replaceAll("\n", " ");
boolean refreshSettings = (!featureType.equals(sf.type) || !featureGroup
.equals(sf.featureGroup));
refreshSettings |= (fcol != oldcol);
-
- setColour(sf.type, fcol);
-
+ setColour(newType, fcol);
+/*?*/ getFeaturesDisplayed().setVisible(newType);
+ int newBegin = sf.begin;
+ int newEnd = sf.end;
try
{
- sf.begin = ((Integer) start.getValue()).intValue();
- sf.end = ((Integer) end.getValue()).intValue();
+ newBegin = ((Integer) start.getValue()).intValue();
+ newEnd = ((Integer) end.getValue()).intValue();
} catch (NumberFormatException ex)
{
+ // JSpinner doesn't accept invalid format data :-)
+ }
+
+ /*
+ * replace the feature by deleting it and adding a new one
+ * (to ensure integrity of SequenceFeatures data store)
+ */
+ sequences.get(0).deleteFeature(sf);
+ SequenceFeature newSf = new SequenceFeature(newType,
+ newDescription, newBegin, newEnd, sf.getScore(),
+ newFeatureGroup);
+ // ensure any additional properties are copied
+ if (sf.otherDetails != null)
+ {
+ newSf.otherDetails = new HashMap<String, Object>(sf.otherDetails);
+ }
+ ffile.parseDescriptionHTML(newSf, false);
+ // add any additional links not parsed from description
+ if (sf.links != null)
+ {
+ for (String link : sf.links)
+ {
+ newSf.addLink(link);
+ }
}
+ // amend features only gets one sequence to act on
+ sequences.get(0).addSequenceFeature(newSf);
- ffile.parseDescriptionHTML(sf, false);
if (refreshSettings)
{
featuresAdded();
import jalview.api.FeatureColourI;
import jalview.api.FeatureSettingsControllerI;
import jalview.bin.Cache;
-import jalview.datamodel.SequenceFeature;
+import jalview.datamodel.AlignmentI;
import jalview.datamodel.SequenceI;
import jalview.gui.Help.HelpId;
import jalview.io.JalviewFileChooser;
private boolean handlingUpdate = false;
/**
- * contains a float[3] for each feature type string. created by setTableData
+ * holds {featureCount, totalExtent} for each feature type
*/
Map<String, float[]> typeWidth = null;
@Override
synchronized public void discoverAllFeatureData()
{
- Vector<String> allFeatures = new Vector<String>();
- Vector<String> allGroups = new Vector<String>();
- SequenceFeature[] tmpfeatures;
- String group;
- for (int i = 0; i < af.getViewport().getAlignment().getHeight(); i++)
- {
- tmpfeatures = af.getViewport().getAlignment().getSequenceAt(i)
- .getSequenceFeatures();
- if (tmpfeatures == null)
- {
- continue;
- }
+ Set<String> allGroups = new HashSet<String>();
+ AlignmentI alignment = af.getViewport().getAlignment();
- int index = 0;
- while (index < tmpfeatures.length)
+ for (int i = 0; i < alignment.getHeight(); i++)
+ {
+ SequenceI seq = alignment.getSequenceAt(i);
+ for (String group : seq.getFeatures().getFeatureGroups(true))
{
- if (tmpfeatures[index].begin == 0 && tmpfeatures[index].end == 0)
+ if (group != null && !allGroups.contains(group))
{
- index++;
- continue;
+ allGroups.add(group);
+ checkGroupState(group);
}
-
- if (tmpfeatures[index].getFeatureGroup() != null)
- {
- group = tmpfeatures[index].featureGroup;
- if (!allGroups.contains(group))
- {
- allGroups.addElement(group);
- checkGroupState(group);
- }
- }
-
- if (!allFeatures.contains(tmpfeatures[index].getType()))
- {
- allFeatures.addElement(tmpfeatures[index].getType());
- }
- index++;
}
}
synchronized void resetTable(String[] groupChanged)
{
- if (resettingTable == true)
+ if (resettingTable)
{
return;
}
typeWidth = new Hashtable<String, float[]>();
// TODO: change avWidth calculation to 'per-sequence' average and use long
// rather than float
- float[] avWidth = null;
- SequenceFeature[] tmpfeatures;
- String group = null, type;
- Vector<String> visibleChecks = new Vector<String>();
+
+ Set<String> displayableTypes = new HashSet<String>();
Set<String> foundGroups = new HashSet<String>();
- // Find out which features should be visible depending on which groups
- // are selected / deselected
- // and recompute average width ordering
+ /*
+ * determine which feature types may be visible depending on
+ * which groups are selected, and recompute average width data
+ */
for (int i = 0; i < af.getViewport().getAlignment().getHeight(); i++)
{
- tmpfeatures = af.getViewport().getAlignment().getSequenceAt(i)
- .getSequenceFeatures();
- if (tmpfeatures == null)
- {
- continue;
- }
+ SequenceI seq = af.getViewport().getAlignment().getSequenceAt(i);
- int index = 0;
- while (index < tmpfeatures.length)
+ /*
+ * get the sequence's groups for positional features
+ * and keep track of which groups are visible
+ */
+ Set<String> groups = seq.getFeatures().getFeatureGroups(true);
+ Set<String> visibleGroups = new HashSet<String>();
+ for (String group : groups)
{
- group = tmpfeatures[index].featureGroup;
- foundGroups.add(group);
-
- if (tmpfeatures[index].begin == 0 && tmpfeatures[index].end == 0)
- {
- index++;
- continue;
- }
-
if (group == null || checkGroupState(group))
{
- type = tmpfeatures[index].getType();
- if (!visibleChecks.contains(type))
- {
- visibleChecks.addElement(type);
- }
- }
- if (!typeWidth.containsKey(tmpfeatures[index].getType()))
- {
- typeWidth.put(tmpfeatures[index].getType(),
- avWidth = new float[3]);
+ visibleGroups.add(group);
}
- else
- {
- avWidth = typeWidth.get(tmpfeatures[index].getType());
- }
- avWidth[0]++;
- if (tmpfeatures[index].getBegin() > tmpfeatures[index].getEnd())
- {
- avWidth[1] += 1 + tmpfeatures[index].getBegin()
- - tmpfeatures[index].getEnd();
- }
- else
+ }
+ foundGroups.addAll(groups);
+
+ /*
+ * get distinct feature types for visible groups
+ * record distinct visible types, and their count and total length
+ */
+ Set<String> types = seq.getFeatures().getFeatureTypesForGroups(true,
+ visibleGroups.toArray(new String[visibleGroups.size()]));
+ for (String type : types)
+ {
+ displayableTypes.add(type);
+ float[] avWidth = typeWidth.get(type);
+ if (avWidth == null)
{
- avWidth[1] += 1 + tmpfeatures[index].getEnd()
- - tmpfeatures[index].getBegin();
+ avWidth = new float[2];
+ typeWidth.put(type, avWidth);
}
- index++;
+ // todo this could include features with a non-visible group
+ // - do we greatly care?
+ // todo should we include non-displayable features here, and only
+ // update when features are added?
+ avWidth[0] += seq.getFeatures().getFeatureCount(true, type);
+ avWidth[1] += seq.getFeatures().getTotalFeatureLength(type);
}
}
- int fSize = visibleChecks.size();
- Object[][] data = new Object[fSize][3];
+ Object[][] data = new Object[displayableTypes.size()][3];
int dataIndex = 0;
if (fr.hasRenderOrder())
List<String> frl = fr.getRenderOrder();
for (int ro = frl.size() - 1; ro > -1; ro--)
{
- type = frl.get(ro);
+ String type = frl.get(ro);
- if (!visibleChecks.contains(type))
+ if (!displayableTypes.contains(type))
{
continue;
}
data[dataIndex][2] = new Boolean(af.getViewport()
.getFeaturesDisplayed().isVisible(type));
dataIndex++;
- visibleChecks.removeElement(type);
+ displayableTypes.remove(type);
}
}
- fSize = visibleChecks.size();
- for (int i = 0; i < fSize; i++)
+ /*
+ * process any extra features belonging only to
+ * a group which was just selected
+ */
+ while (!displayableTypes.isEmpty())
{
- // These must be extra features belonging to the group
- // which was just selected
- type = visibleChecks.elementAt(i).toString();
+ String type = displayableTypes.iterator().next();
data[dataIndex][0] = type;
data[dataIndex][1] = fr.getFeatureStyle(type);
data[dataIndex][2] = new Boolean(true);
dataIndex++;
+ displayableTypes.remove(type);
}
if (originalData == null)
{
int seq2 = alignPanel.getSeqPanel().findSeq(e);
Sequence sq = (Sequence) av.getAlignment().getSequenceAt(seq2);
- // build a new links menu based on the current links + any non-positional
- // features
+
+ /*
+ * build a new links menu based on the current links
+ * and any non-positional features
+ */
List<String> nlinks = Preferences.sequenceUrlLinks.getLinksForMenu();
- SequenceFeature sfs[] = sq == null ? null : sq.getSequenceFeatures();
- if (sfs != null)
+ for (SequenceFeature sf : sq.getFeatures().getNonPositionalFeatures())
{
- for (SequenceFeature sf : sfs)
+ if (sf.links != null)
{
- if (sf.begin == sf.end && sf.begin == 0)
+ for (String link : sf.links)
{
- if (sf.links != null && sf.links.size() > 0)
- {
- for (int l = 0, lSize = sf.links.size(); l < lSize; l++)
- {
- nlinks.add(sf.links.elementAt(l));
- }
- }
+ nlinks.add(link);
}
}
}
{
for (SequenceI sq : alsqs)
{
- if ((sfs = sq.getSequenceFeatures()) != null)
+ if (sq.getFeatures().hasFeatures())
{
- if (sfs.length > 0)
- {
- af.setShowSeqFeatures(true);
- break;
- }
+ af.setShowSeqFeatures(true);
+ break;
}
-
}
}
}
if (newname == null)
{
- SequenceFeature sf[] = sq.getSequenceFeatures();
- for (int i = 0; sf != null && i < sf.length; i++)
+ List<SequenceFeature> features = sq.getFeatures()
+ .getPositionalFeatures(labelClass);
+ for (SequenceFeature feature : features)
{
- if (sf[i].getType().equals(labelClass))
+ if (newname == null)
+ {
+ newname = feature.getDescription();
+ }
+ else
{
- if (newname == null)
- {
- newname = new String(sf[i].getDescription());
- }
- else
- {
- newname = newname + "; " + sf[i].getDescription();
- }
+ newname = newname + "; " + feature.getDescription();
}
}
}
+++ /dev/null
-/*
- * Jalview - A Sequence Alignment Editor and Viewer ($$Version-Rel$$)
- * Copyright (C) $$Year-Rel$$ The Jalview Authors
- *
- * This file is part of Jalview.
- *
- * Jalview is free software: you can redistribute it and/or
- * modify it under the terms of the GNU General Public License
- * as published by the Free Software Foundation, either version 3
- * of the License, or (at your option) any later version.
- *
- * Jalview is distributed in the hope that it will be useful, but
- * WITHOUT ANY WARRANTY; without even the implied warranty
- * of MERCHANTABILITY or FITNESS FOR A PARTICULAR
- * PURPOSE. See the GNU General Public License for more details.
- *
- * You should have received a copy of the GNU General Public License
- * along with Jalview. If not, see <http://www.gnu.org/licenses/>.
- * The Jalview Authors are detailed in the 'AUTHORS' file.
- */
-package jalview.io;
-
-/**
- * Read or write a CLANS style score matrix file.
- */
-
-public class ClansFile extends FileParse
-{
-
-}
*/
for (SequenceI newseq : newseqs)
{
- if (newseq.getSequenceFeatures() != null)
+ if (newseq.getFeatures().hasFeatures())
{
align.addSequence(newseq);
}
// read as a FASTA (probably)
break;
}
+ if (data.indexOf("{\"") > -1)
+ {
+ reply = FileFormat.Json;
+ break;
+ }
int lessThan = data.indexOf("<");
if ((lessThan > -1)) // possible Markup Language data i.e HTML,
// RNAML, XML
}
}
- if (data.indexOf("{\"") > -1)
- {
- reply = FileFormat.Json;
- break;
- }
if ((data.length() < 1) || (data.indexOf("#") == 0))
{
lineswereskipped = true;
import jalview.schemes.JalviewColourScheme;
import jalview.schemes.ResidueColourScheme;
import jalview.util.ColorUtils;
+import jalview.util.Format;
import jalview.viewmodel.seqfeatures.FeaturesDisplayed;
import java.awt.Color;
if (exportSettings.isExportFeatures())
{
- jsonAlignmentPojo
- .setSeqFeatures(sequenceFeatureToJsonPojo(sqs, fr));
+ jsonAlignmentPojo.setSeqFeatures(sequenceFeatureToJsonPojo(sqs));
}
if (exportSettings.isExportGroups() && seqGroups != null
return hiddenSections;
}
- public List<SequenceFeaturesPojo> sequenceFeatureToJsonPojo(
- SequenceI[] sqs, FeatureRenderer fr)
+ protected List<SequenceFeaturesPojo> sequenceFeatureToJsonPojo(
+ SequenceI[] sqs)
{
displayedFeatures = (fr == null) ? null : fr.getFeaturesDisplayed();
List<SequenceFeaturesPojo> sequenceFeaturesPojo = new ArrayList<SequenceFeaturesPojo>();
FeatureColourFinder finder = new FeatureColourFinder(fr);
+ String[] visibleFeatureTypes = displayedFeatures == null ? null
+ : displayedFeatures.getVisibleFeatures().toArray(
+ new String[displayedFeatures.getVisibleFeatureCount()]);
+
for (SequenceI seq : sqs)
{
- SequenceI dataSetSequence = seq.getDatasetSequence();
- SequenceFeature[] seqFeatures = (dataSetSequence == null) ? null
- : seq.getDatasetSequence().getSequenceFeatures();
-
- seqFeatures = (seqFeatures == null) ? seq.getSequenceFeatures()
- : seqFeatures;
- if (seqFeatures == null)
- {
- continue;
- }
-
+ /*
+ * get all features currently visible (and any non-positional features)
+ */
+ List<SequenceFeature> seqFeatures = seq.getFeatures().getAllFeatures(
+ visibleFeatureTypes);
for (SequenceFeature sf : seqFeatures)
{
- if (displayedFeatures != null
- && displayedFeatures.isVisible(sf.getType()))
- {
- SequenceFeaturesPojo jsonFeature = new SequenceFeaturesPojo(
- String.valueOf(seq.hashCode()));
-
- String featureColour = (fr == null) ? null : jalview.util.Format
- .getHexString(finder.findFeatureColour(Color.white, seq,
- seq.findIndex(sf.getBegin())));
- jsonFeature.setXstart(seq.findIndex(sf.getBegin()) - 1);
- jsonFeature.setXend(seq.findIndex(sf.getEnd()));
- jsonFeature.setType(sf.getType());
- jsonFeature.setDescription(sf.getDescription());
- jsonFeature.setLinks(sf.links);
- jsonFeature.setOtherDetails(sf.otherDetails);
- jsonFeature.setScore(sf.getScore());
- jsonFeature.setFillColor(featureColour);
- jsonFeature.setFeatureGroup(sf.getFeatureGroup());
- sequenceFeaturesPojo.add(jsonFeature);
- }
+ SequenceFeaturesPojo jsonFeature = new SequenceFeaturesPojo(
+ String.valueOf(seq.hashCode()));
+
+ String featureColour = (fr == null) ? null : Format
+ .getHexString(finder.findFeatureColour(Color.white, seq,
+ seq.findIndex(sf.getBegin())));
+ int xStart = sf.getBegin() == 0 ? 0
+ : seq.findIndex(sf.getBegin()) - 1;
+ int xEnd = sf.getEnd() == 0 ? 0 : seq.findIndex(sf.getEnd());
+ jsonFeature.setXstart(xStart);
+ jsonFeature.setXend(xEnd);
+ jsonFeature.setType(sf.getType());
+ jsonFeature.setDescription(sf.getDescription());
+ jsonFeature.setLinks(sf.links);
+ jsonFeature.setOtherDetails(sf.otherDetails);
+ jsonFeature.setScore(sf.getScore());
+ jsonFeature.setFillColor(featureColour);
+ jsonFeature.setFeatureGroup(sf.getFeatureGroup());
+ sequenceFeaturesPojo.add(jsonFeature);
}
}
return sequenceFeaturesPojo;
Long end = (Long) jsonFeature.get("xEnd");
String type = (String) jsonFeature.get("type");
String featureGrp = (String) jsonFeature.get("featureGroup");
- String descripiton = (String) jsonFeature.get("description");
+ String description = (String) jsonFeature.get("description");
String seqRef = (String) jsonFeature.get("sequenceRef");
Float score = Float.valueOf(jsonFeature.get("score").toString());
Sequence seq = seqMap.get(seqRef);
- SequenceFeature sequenceFeature = new SequenceFeature();
+
+ /*
+ * begin/end of 0 is for a non-positional feature
+ */
+ int featureBegin = begin.intValue() == 0 ? 0 : seq
+ .findPosition(begin.intValue());
+ int featureEnd = end.intValue() == 0 ? 0 : seq.findPosition(end
+ .intValue()) - 1;
+
+ SequenceFeature sequenceFeature = new SequenceFeature(type,
+ description, featureBegin, featureEnd, score, featureGrp);
+
JSONArray linksJsonArray = (JSONArray) jsonFeature.get("links");
if (linksJsonArray != null && linksJsonArray.size() > 0)
{
sequenceFeature.addLink(link);
}
}
- sequenceFeature.setFeatureGroup(featureGrp);
- sequenceFeature.setScore(score);
- sequenceFeature.setDescription(descripiton);
- sequenceFeature.setType(type);
- sequenceFeature.setBegin(seq.findPosition(begin.intValue()));
- sequenceFeature.setEnd(seq.findPosition(end.intValue()) - 1);
+
seq.addSequenceFeature(sequenceFeature);
displayedFeatures.setVisible(type);
}
+++ /dev/null
-/*
- * Jalview - A Sequence Alignment Editor and Viewer ($$Version-Rel$$)
- * Copyright (C) $$Year-Rel$$ The Jalview Authors
- *
- * This file is part of Jalview.
- *
- * Jalview is free software: you can redistribute it and/or
- * modify it under the terms of the GNU General Public License
- * as published by the Free Software Foundation, either version 3
- * of the License, or (at your option) any later version.
- *
- * Jalview is distributed in the hope that it will be useful, but
- * WITHOUT ANY WARRANTY; without even the implied warranty
- * of MERCHANTABILITY or FITNESS FOR A PARTICULAR
- * PURPOSE. See the GNU General Public License for more details.
- *
- * You should have received a copy of the GNU General Public License
- * along with Jalview. If not, see <http://www.gnu.org/licenses/>.
- * The Jalview Authors are detailed in the 'AUTHORS' file.
- */
-package jalview.io;
-
-/**
- * IO for asymmetric matrix with arbitrary dimension with labels, as displayed
- * by PCA viewer. Form is: tab separated entity defs header line TITLE\ttitle
- * DESC\tdesc PROPERTY\t<id or empty for whole matrix>\tname\ttype\tvalue
- * ROW\tRow i label (ID)/tPrinciple text/tprinciple description/t...
- * COLUMN\t(similar, optional).. .. <float>\t<float>...(column-wise data for row
- * i)
- */
-
-public class MatrixFile extends FileParse
-{
-
-}
final String linkImageURL;
/*
- * Comparator to order DBRefEntry by Source + accession id (case-insensitive)
+ * Comparator to order DBRefEntry by Source + accession id (case-insensitive),
+ * with 'Primary' sources placed before others
*/
private static Comparator<DBRefEntry> comparator = new Comparator<DBRefEntry>()
{
{
ds = ds.getDatasetSequence();
}
+
+ if (showDbRefs)
+ {
+ maxWidth = Math.max(maxWidth, appendDbRefs(sb, ds, summary));
+ }
+
+ /*
+ * add non-positional features if wanted
+ */
+ if (showNpFeats)
+ {
+ for (SequenceFeature sf : sequence.getFeatures()
+ .getNonPositionalFeatures())
+ {
+ int sz = -sb.length();
+ appendFeature(sb, 0, minmax, sf);
+ sz += sb.length();
+ maxWidth = Math.max(maxWidth, sz);
+ }
+ }
+ sb.append("</i>");
+ return maxWidth;
+ }
+
+ /**
+ * A helper method that appends any DBRefs, returning the maximum line length
+ * added
+ *
+ * @param sb
+ * @param ds
+ * @param summary
+ * @return
+ */
+ protected int appendDbRefs(final StringBuilder sb, SequenceI ds,
+ boolean summary)
+ {
DBRefEntry[] dbrefs = ds.getDBRefs();
- if (showDbRefs && dbrefs != null)
+ if (dbrefs == null)
+ {
+ return 0;
+ }
+
+ // note this sorts the refs held on the sequence!
+ Arrays.sort(dbrefs, comparator);
+ boolean ellipsis = false;
+ String source = null;
+ String lastSource = null;
+ int countForSource = 0;
+ int sourceCount = 0;
+ boolean moreSources = false;
+ int maxLineLength = 0;
+ int lineLength = 0;
+
+ for (DBRefEntry ref : dbrefs)
{
- // note this sorts the refs held on the sequence!
- Arrays.sort(dbrefs, comparator);
- boolean ellipsis = false;
- String source = null;
- String lastSource = null;
- int countForSource = 0;
- int sourceCount = 0;
- boolean moreSources = false;
- int lineLength = 0;
-
- for (DBRefEntry ref : dbrefs)
+ source = ref.getSource();
+ if (source == null)
{
- source = ref.getSource();
- if (source == null)
- {
- // shouldn't happen
- continue;
- }
- boolean sourceChanged = !source.equals(lastSource);
- if (sourceChanged)
- {
- lineLength = 0;
- countForSource = 0;
- sourceCount++;
- }
- if (sourceCount > MAX_SOURCES && summary)
- {
- ellipsis = true;
- moreSources = true;
- break;
- }
- lastSource = source;
- countForSource++;
- if (countForSource == 1 || !summary)
- {
- sb.append("<br>");
- }
- if (countForSource <= MAX_REFS_PER_SOURCE || !summary)
- {
- String accessionId = ref.getAccessionId();
- lineLength += accessionId.length() + 1;
- if (countForSource > 1 && summary)
- {
- sb.append(", ").append(accessionId);
- lineLength++;
- }
- else
- {
- sb.append(source).append(" ").append(accessionId);
- lineLength += source.length();
- }
- maxWidth = Math.max(maxWidth, lineLength);
- }
- if (countForSource == MAX_REFS_PER_SOURCE && summary)
- {
- sb.append(COMMA).append(ELLIPSIS);
- ellipsis = true;
- }
+ // shouldn't happen
+ continue;
}
- if (moreSources)
+ boolean sourceChanged = !source.equals(lastSource);
+ if (sourceChanged)
{
- sb.append("<br>").append(ELLIPSIS).append(COMMA).append(source)
- .append(COMMA).append(ELLIPSIS);
+ lineLength = 0;
+ countForSource = 0;
+ sourceCount++;
}
- if (ellipsis)
+ if (sourceCount > MAX_SOURCES && summary)
{
- sb.append("<br>(");
- sb.append(MessageManager.getString("label.output_seq_details"));
- sb.append(")");
+ ellipsis = true;
+ moreSources = true;
+ break;
}
- }
-
- /*
- * add non-positional features if wanted
- */
- SequenceFeature[] features = sequence.getSequenceFeatures();
- if (showNpFeats && features != null)
- {
- for (int i = 0; i < features.length; i++)
+ lastSource = source;
+ countForSource++;
+ if (countForSource == 1 || !summary)
+ {
+ sb.append("<br>");
+ }
+ if (countForSource <= MAX_REFS_PER_SOURCE || !summary)
{
- if (features[i].begin == 0 && features[i].end == 0)
+ String accessionId = ref.getAccessionId();
+ lineLength += accessionId.length() + 1;
+ if (countForSource > 1 && summary)
{
- int sz = -sb.length();
- appendFeature(sb, 0, minmax, features[i]);
- sz += sb.length();
- maxWidth = Math.max(maxWidth, sz);
+ sb.append(", ").append(accessionId);
+ lineLength++;
}
+ else
+ {
+ sb.append(source).append(" ").append(accessionId);
+ lineLength += source.length();
+ }
+ maxLineLength = Math.max(maxLineLength, lineLength);
+ }
+ if (countForSource == MAX_REFS_PER_SOURCE && summary)
+ {
+ sb.append(COMMA).append(ELLIPSIS);
+ ellipsis = true;
}
}
- sb.append("</i>");
- return maxWidth;
+ if (moreSources)
+ {
+ sb.append("<br>").append(source)
+ .append(COMMA).append(ELLIPSIS);
+ }
+ if (ellipsis)
+ {
+ sb.append("<br>(");
+ sb.append(MessageManager.getString("label.output_seq_details"));
+ sb.append(")");
+ }
+
+ return maxLineLength;
}
public void createTooltipAnnotationReport(final StringBuilder tip,
return false;
}
+ /**
+ * An override to set feature group to "exonerate" instead of the default GFF
+ * source value (column 2)
+ */
@Override
protected SequenceFeature buildSequenceFeature(String[] gff,
Map<String, List<String>> set)
{
- SequenceFeature sf = super.buildSequenceFeature(gff, set);
- sf.setFeatureGroup("exonerate");
+ SequenceFeature sf = super.buildSequenceFeature(gff, TYPE_COL,
+ "exonerate", set);
return sf;
}
* give the mapped sequence a copy of the sequence feature, with
* start/end range adjusted
*/
- SequenceFeature sf2 = new SequenceFeature(sf);
- sf2.setBegin(1);
int sequenceFeatureLength = 1 + sf.getEnd() - sf.getBegin();
- sf2.setEnd(sequenceFeatureLength);
+ SequenceFeature sf2 = new SequenceFeature(sf, 1,
+ sequenceFeatureLength, sf.getFeatureGroup());
mappedSequence.addSequenceFeature(sf2);
/*
*/
@Override
protected SequenceFeature buildSequenceFeature(String[] gff,
+ int typeColumn, String group,
Map<String, List<String>> attributes)
{
- SequenceFeature sf = super.buildSequenceFeature(gff, attributes);
+ SequenceFeature sf = super.buildSequenceFeature(gff, typeColumn, group,
+ attributes);
String desc = getDescription(sf, attributes);
if (desc != null)
{
protected SequenceFeature buildSequenceFeature(String[] gff,
Map<String, List<String>> attributes)
{
+ return buildSequenceFeature(gff, TYPE_COL, gff[SOURCE_COL], attributes);
+ }
+
+ /**
+ * @param gff
+ * @param typeColumn
+ * @param group
+ * @param attributes
+ * @return
+ */
+ protected SequenceFeature buildSequenceFeature(String[] gff,
+ int typeColumn, String group, Map<String, List<String>> attributes)
+ {
try
{
int start = Integer.parseInt(gff[START_COL]);
// e.g. '.' - leave as zero
}
- SequenceFeature sf = new SequenceFeature(gff[TYPE_COL],
- gff[SOURCE_COL], start, end, score, gff[SOURCE_COL]);
+ SequenceFeature sf = new SequenceFeature(gff[typeColumn],
+ gff[SOURCE_COL], start, end, score, group);
sf.setStrand(gff[STRAND_COL]);
}
/**
- *
- */
+ * An override that
+ * <ul>
+ * <li>uses Source (column 2) as feature type instead of the default column 3</li>
+ * <li>sets "InterProScan" as the feature group</li>
+ * <li>extracts "signature_desc" attribute as the feature description</li>
+ * </ul>
+ */
@Override
protected SequenceFeature buildSequenceFeature(String[] gff,
Map<String, List<String>> attributes)
{
- SequenceFeature sf = super.buildSequenceFeature(gff, attributes);
+ SequenceFeature sf = super.buildSequenceFeature(gff, SOURCE_COL,
+ INTER_PRO_SCAN, attributes);
/*
* signature_desc is a more informative source of description
sf.setDescription(description);
}
- /*
- * Set sequence feature group as 'InterProScan', and type as the source
- * database for this match (e.g. 'Pfam')
- */
- sf.setType(gff[SOURCE_COL]);
- sf.setFeatureGroup(INTER_PRO_SCAN);
-
return sf;
}
import java.awt.FontMetrics;
import java.awt.Graphics;
import java.awt.Graphics2D;
+import java.util.List;
public class FeatureRenderer extends FeatureRendererModel
{
return null;
}
- SequenceFeature[] sequenceFeatures = seq.getSequenceFeatures();
-
- if (sequenceFeatures == null || sequenceFeatures.length == 0)
- {
- return null;
- }
-
if (Comparison.isGap(seq.getCharAt(column)))
{
return Color.white;
final SequenceI seq, int start, int end, int y1,
boolean colourOnly)
{
- SequenceFeature[] sequenceFeatures = seq.getSequenceFeatures();
- if (sequenceFeatures == null || sequenceFeatures.length == 0)
+ if (!seq.getFeatures().hasFeatures())
{
return null;
}
}
int startPos = seq.findPosition(start);
- int endPos = seq.findPosition(end);
+ int endPos = seq.findPosition(end);// todo a performant overload of this!
- int sfSize = sequenceFeatures.length;
Color drawnColour = null;
/*
continue;
}
- // loop through all features in sequence to find
- // current feature to render
- for (int sfindex = 0; sfindex < sfSize; sfindex++)
+ List<SequenceFeature> overlaps = seq.findFeatures(startPos, endPos,
+ type);
+ for (SequenceFeature sequenceFeature : overlaps)
{
- final SequenceFeature sequenceFeature = sequenceFeatures[sfindex];
- if (!sequenceFeature.type.equals(type))
- {
- continue;
- }
-
/*
* a feature type may be flagged as shown but the group
* an instance of it belongs to may be hidden
continue;
}
- /*
- * check feature overlaps the target range
- * TODO: efficient retrieval of features overlapping a range
- */
- if (sequenceFeature.getBegin() > endPos
- || sequenceFeature.getEnd() < startPos)
- {
- continue;
- }
-
Color featureColour = getColour(sequenceFeature);
boolean isContactFeature = sequenceFeature.isContactFeature();
}
else if (showFeature(sequenceFeature))
{
+ /*
+ * showing feature score by height of colour
+ * is not implemented as a selectable option
+ *
if (av.isShowSequenceFeaturesHeight()
&& !Float.isNaN(sequenceFeature.score))
{
}
else
{
+ */
boolean drawn = renderFeature(g, seq,
seq.findIndex(sequenceFeature.begin) - 1,
seq.findIndex(sequenceFeature.end) - 1, featureColour,
{
drawnColour = featureColour;
}
- }
+ /*}*/
}
}
}
}
/**
- * Answers true if the feature belongs to a feature group which is not
- * currently displayed, else false
- *
- * @param sequenceFeature
- * @return
- */
- protected boolean featureGroupNotShown(
- final SequenceFeature sequenceFeature)
- {
- return featureGroups != null
- && sequenceFeature.featureGroup != null
- && sequenceFeature.featureGroup.length() != 0
- && featureGroups.containsKey(sequenceFeature.featureGroup)
- && !featureGroups.get(sequenceFeature.featureGroup)
- .booleanValue();
- }
-
- /**
* Called when alignment in associated view has new/modified features to
* discover and display.
*
*/
Color findFeatureColour(SequenceI seq, int pos)
{
- SequenceFeature[] sequenceFeatures = seq.getSequenceFeatures();
- if (sequenceFeatures == null || sequenceFeatures.length == 0)
- {
- return null;
- }
-
/*
* check for new feature added while processing
*/
continue;
}
- for (int sfindex = 0; sfindex < sequenceFeatures.length; sfindex++)
+ List<SequenceFeature> overlaps = seq.findFeatures(pos, pos, type);
+ for (SequenceFeature sequenceFeature : overlaps)
{
- SequenceFeature sequenceFeature = sequenceFeatures[sfindex];
- if (!sequenceFeature.type.equals(type))
- {
- continue;
- }
-
- if (featureGroupNotShown(sequenceFeature))
- {
- continue;
- }
-
- /*
- * check the column position is within the feature range
- * (or is one of the two contact positions for a contact feature)
- */
- boolean featureIsAtPosition = sequenceFeature.begin <= pos
- && sequenceFeature.end >= pos;
- if (sequenceFeature.isContactFeature())
- {
- featureIsAtPosition = sequenceFeature.begin == pos
- || sequenceFeature.end == pos;
- }
- if (featureIsAtPosition)
+ if (!featureGroupNotShown(sequenceFeature))
{
return getColour(sequenceFeature);
}
* A comparator to order [from, to] ranges into ascending or descending order of
* their start position
*/
-public class RangeComparator implements Comparator<int[]>
+public class IntRangeComparator implements Comparator<int[]>
{
+ public static final Comparator<int[]> ASCENDING = new IntRangeComparator(
+ true);
+
+ public static final Comparator<int[]> DESCENDING = new IntRangeComparator(
+ false);
+
boolean forwards;
- public RangeComparator(boolean forward)
+ IntRangeComparator(boolean forward)
{
forwards = forward;
}
import java.beans.PropertyChangeSupport;
import java.util.ArrayList;
import java.util.Arrays;
+import java.util.Collections;
import java.util.HashMap;
import java.util.HashSet;
import java.util.Hashtable;
-import java.util.Iterator;
import java.util.List;
import java.util.Map;
import java.util.Set;
synchronized (fd)
{
fd.clear();
- java.util.Iterator<String> fdisp = _fr.getFeaturesDisplayed()
- .getVisibleFeatures();
- while (fdisp.hasNext())
+ for (String type : _fr.getFeaturesDisplayed()
+ .getVisibleFeatures())
{
- fd.setVisible(fdisp.next());
+ fd.setVisible(type);
}
}
}
@Override
public List<SequenceFeature> findFeaturesAtRes(SequenceI sequence, int res)
{
- ArrayList<SequenceFeature> tmp = new ArrayList<SequenceFeature>();
- SequenceFeature[] features = sequence.getSequenceFeatures();
-
- if (features != null)
+ List<SequenceFeature> result = new ArrayList<SequenceFeature>();
+ if (!av.areFeaturesDisplayed())
{
- for (int i = 0; i < features.length; i++)
- {
- if (!av.areFeaturesDisplayed()
- || !av.getFeaturesDisplayed().isVisible(
- features[i].getType()))
- {
- continue;
- }
+ return result;
+ }
- if (features[i].featureGroup != null
- && featureGroups != null
- && featureGroups.containsKey(features[i].featureGroup)
- && !featureGroups.get(features[i].featureGroup)
- .booleanValue())
- {
- continue;
- }
+ Set<String> visibleFeatures = getFeaturesDisplayed()
+ .getVisibleFeatures();
+ String[] visibleTypes = visibleFeatures
+ .toArray(new String[visibleFeatures.size()]);
- // check if start/end are at res, and if not a contact feature, that res
- // lies between start and end
- if ((features[i].getBegin() == res || features[i].getEnd() == res)
- || (!features[i].isContactFeature()
- && (features[i].getBegin() < res) && (features[i]
- .getEnd() >= res)))
- {
- tmp.add(features[i]);
- }
+ /*
+ * include features at the position provided their feature type is
+ * displayed, and feature group is null or marked for display
+ */
+ List<SequenceFeature> features = sequence.getFeatures().findFeatures(
+ res, res, visibleTypes);
+
+ for (SequenceFeature sf : features)
+ {
+ if (!featureGroupNotShown(sf))
+ {
+ result.add(sf);
}
}
- return tmp;
+ return result;
}
/**
* Searches alignment for all features and updates colours
*
* @param newMadeVisible
- * if true newly added feature types will be rendered immediatly
+ * if true newly added feature types will be rendered immediately
* TODO: check to see if this method should actually be proxied so
* repaint events can be propagated by the renderer code
*/
}
FeaturesDisplayedI featuresDisplayed = av.getFeaturesDisplayed();
- ArrayList<String> allfeatures = new ArrayList<String>();
- ArrayList<String> oldfeatures = new ArrayList<String>();
+ Set<String> oldfeatures = new HashSet<String>();
if (renderOrder != null)
{
for (int i = 0; i < renderOrder.length; i++)
}
}
}
- if (minmax == null)
- {
- minmax = new Hashtable<String, float[][]>();
- }
-
- Set<String> oldGroups = new HashSet<String>(featureGroups.keySet());
+ // <<<<<<< HEAD
+ //
+ // =======
+ // if (minmax == null)
+ // {
+ // minmax = new Hashtable<String, float[][]>();
+ // }
+ //
+ // Set<String> oldGroups = new HashSet<String>(featureGroups.keySet());
+ // >>>>>>> refs/heads/develop
AlignmentI alignment = av.getAlignment();
+ List<String> allfeatures = new ArrayList<String>(); // or HashSet?
+
for (int i = 0; i < alignment.getHeight(); i++)
{
SequenceI asq = alignment.getSequenceAt(i);
- SequenceFeature[] features = asq.getSequenceFeatures();
-
- if (features == null)
+ for (String group : asq.getFeatures().getFeatureGroups(true))
{
- continue;
- }
-
- int index = 0;
- while (index < features.length)
- {
- String fgrp = features[index].getFeatureGroup();
- oldGroups.remove(fgrp);
- if (!featuresDisplayed.isRegistered(features[index].getType()))
+ // <<<<<<< HEAD
+ /*
+ * features in null group are always displayed; other groups
+ * keep their current visibility; new groups as 'newMadeVisible'
+ */
+ boolean groupDisplayed = true;
+ if (group != null)
+ // =======
+ // continue;
+ // }
+ //
+ // int index = 0;
+ // while (index < features.length)
+ // {
+ // String fgrp = features[index].getFeatureGroup();
+ // oldGroups.remove(fgrp);
+ // if (!featuresDisplayed.isRegistered(features[index].getType()))
+ // >>>>>>> refs/heads/develop
{
- if (fgrp != null)
+ // <<<<<<< HEAD
+ if (featureGroups.containsKey(group))
+ // =======
+ // if (fgrp != null)
+ // >>>>>>> refs/heads/develop
{
- Boolean groupDisplayed = featureGroups.get(fgrp);
- if (groupDisplayed == null)
- {
- groupDisplayed = Boolean.valueOf(newMadeVisible);
- featureGroups.put(fgrp, groupDisplayed);
- }
- if (!groupDisplayed.booleanValue())
- {
- index++;
- continue;
- }
+ groupDisplayed = featureGroups.get(group);
}
- if (!(features[index].begin == 0 && features[index].end == 0))
+ else
{
- // If beginning and end are 0, the feature is for the whole sequence
- // and we don't want to render the feature in the normal way
-
- if (newMadeVisible
- && !oldfeatures.contains(features[index].getType()))
- {
- // this is a new feature type on the alignment. Mark it for
- // display.
- featuresDisplayed.setVisible(features[index].getType());
- setOrder(features[index].getType(), 0);
- }
+ groupDisplayed = newMadeVisible;
+ featureGroups.put(group, groupDisplayed);
}
}
- if (!allfeatures.contains(features[index].getType()))
+ if (groupDisplayed)
{
- allfeatures.add(features[index].getType());
- }
- if (!Float.isNaN(features[index].score))
- {
- int nonpos = features[index].getBegin() >= 1 ? 0 : 1;
- float[][] mm = minmax.get(features[index].getType());
- if (mm == null)
- {
- mm = new float[][] { null, null };
- minmax.put(features[index].getType(), mm);
- }
- if (mm[nonpos] == null)
- {
- mm[nonpos] = new float[] { features[index].score,
- features[index].score };
-
- }
- else
+ Set<String> types = asq.getFeatures().getFeatureTypesForGroups(
+ true, group);
+ for (String type : types)
{
- if (mm[nonpos][0] > features[index].score)
- {
- mm[nonpos][0] = features[index].score;
- }
- if (mm[nonpos][1] < features[index].score)
+ if (!allfeatures.contains(type)) // or use HashSet and no test?
{
- mm[nonpos][1] = features[index].score;
+ allfeatures.add(type);
}
+ updateMinMax(asq, type, true); // todo: for all features?
}
}
- index++;
}
}
/*
- * oldGroups now consists of groups that no longer
- * have any feature in them - remove these
+ //<<<<<<< HEAD
+ * mark any new feature types as visible
*/
- for (String grp : oldGroups)
+ Collections.sort(allfeatures, String.CASE_INSENSITIVE_ORDER);
+ if (newMadeVisible)
{
- featureGroups.remove(grp);
+ for (String type : allfeatures)
+ {
+ if (!oldfeatures.contains(type))
+ {
+ featuresDisplayed.setVisible(type);
+ setOrder(type, 0);
+ }
+ }
+ // =======
+ // * oldGroups now consists of groups that no longer
+ // * have any feature in them - remove these
+ // */
+ // for (String grp : oldGroups)
+ // {
+ // featureGroups.remove(grp);
+ // >>>>>>> refs/heads/develop
}
updateRenderOrder(allfeatures);
findingFeatures = false;
}
+ /**
+ * Updates the global (alignment) min and max values for a feature type from
+ * the score for a sequence, if the score is not NaN. Values are stored
+ * separately for positional and non-positional features.
+ *
+ * @param seq
+ * @param featureType
+ * @param positional
+ */
+ protected void updateMinMax(SequenceI seq, String featureType,
+ boolean positional)
+ {
+ float min = seq.getFeatures().getMinimumScore(featureType, positional);
+ if (Float.isNaN(min))
+ {
+ return;
+ }
+
+ float max = seq.getFeatures().getMaximumScore(featureType, positional);
+
+ /*
+ * stored values are
+ * { {positionalMin, positionalMax}, {nonPositionalMin, nonPositionalMax} }
+ */
+ if (minmax == null)
+ {
+ minmax = new Hashtable<String, float[][]>();
+ }
+ synchronized (minmax)
+ {
+ float[][] mm = minmax.get(featureType);
+ int index = positional ? 0 : 1;
+ if (mm == null)
+ {
+ mm = new float[][] { null, null };
+ minmax.put(featureType, mm);
+ }
+ if (mm[index] == null)
+ {
+ mm[index] = new float[] { min, max };
+ }
+ else
+ {
+ mm[index][0] = Math.min(mm[index][0], min);
+ mm[index][1] = Math.max(mm[index][1], max);
+ }
+ }
+ }
protected Boolean firing = Boolean.FALSE;
/**
return fc.getColor(feature);
}
+ /**
+ * Answers true unless the feature has a graduated colour scheme and the
+ * feature value lies outside the current threshold for display
+ *
+ * @param sequenceFeature
+ * @return
+ */
protected boolean showFeature(SequenceFeature sequenceFeature)
{
FeatureColourI fc = getFeatureStyle(sequenceFeature.type);
}
/**
- * Sets the priority order for features
+ * Sets the priority order for features, with the highest priority (displayed
+ * on top) at the start of the data array
*
* @param data
* { String(Type), Colour(Type), Boolean(Displayed) }
{
return fcols;
}
- Iterator<String> features = getViewport().getFeaturesDisplayed()
+ Set<String> features = getViewport().getFeaturesDisplayed()
.getVisibleFeatures();
- while (features.hasNext())
+ for (String feature : features)
{
- String feature = features.next();
fcols.put(feature, getFeatureStyle(feature));
}
return fcols;
return _gps;
}
+ /**
+ * Answers true if the feature belongs to a feature group which is not
+ * currently displayed, else false
+ *
+ * @param sequenceFeature
+ * @return
+ */
+ protected boolean featureGroupNotShown(final SequenceFeature sequenceFeature)
+ {
+ return featureGroups != null
+ && sequenceFeature.featureGroup != null
+ && sequenceFeature.featureGroup.length() != 0
+ && featureGroups.containsKey(sequenceFeature.featureGroup)
+ && !featureGroups.get(sequenceFeature.featureGroup)
+ .booleanValue();
+ }
+
}
import jalview.api.FeaturesDisplayedI;
import java.util.Collection;
+import java.util.Collections;
import java.util.HashSet;
-import java.util.Iterator;
+import java.util.Set;
public class FeaturesDisplayed implements FeaturesDisplayedI
{
- private HashSet<String> featuresDisplayed = new HashSet<String>();
+ private Set<String> featuresDisplayed = new HashSet<String>();
- private HashSet<String> featuresRegistered = new HashSet<String>();
+ private Set<String> featuresRegistered = new HashSet<String>();
public FeaturesDisplayed(FeaturesDisplayedI featuresDisplayed2)
{
- Iterator<String> fdisp = featuresDisplayed2.getVisibleFeatures();
- String ftype;
- while (fdisp.hasNext())
+ Set<String> fdisp = featuresDisplayed2.getVisibleFeatures();
+ for (String ftype : fdisp)
{
- ftype = fdisp.next();
featuresDisplayed.add(ftype);
featuresRegistered.add(ftype);
}
public FeaturesDisplayed()
{
- // TODO Auto-generated constructor stub
}
@Override
- public Iterator<String> getVisibleFeatures()
+ public Set<String> getVisibleFeatures()
{
- return featuresDisplayed.iterator();
+ return Collections.unmodifiableSet(featuresDisplayed);
}
@Override
{
for (SequenceFeature sf : entry.getFeature())
{
- sf.setFeatureGroup("Uniprot");
- sequence.addSequenceFeature(sf);
+ SequenceFeature copy = new SequenceFeature(sf, sf.getBegin(),
+ sf.getEnd(), "Uniprot");
+ sequence.addSequenceFeature(copy);
}
}
for (DBRefEntry dbr : dbRefs)
/*
* sort with no score features does nothing
*/
- PA.setValue(AlignmentSorter.class, "lastSortByFeatureScore", null);
+ PA.setValue(AlignmentSorter.class, "sortByFeatureCriteria", null);
- AlignmentSorter.sortByFeature((String) null, null, 0, al.getWidth(),
- al,
+ AlignmentSorter.sortByFeature(null, null, 0, al.getWidth(), al,
AlignmentSorter.FEATURE_SCORE);
assertSame(al.getSequenceAt(0), seq1);
assertSame(al.getSequenceAt(1), seq2);
* sort by ascending score, no filter on feature type or group
* NB sort order for the same feature set (none) gets toggled, so descending
*/
- PA.setValue(AlignmentSorter.class, "sortByFeatureScoreAscending", true);
- AlignmentSorter.sortByFeature((String) null, null, 0, al.getWidth(),
- al, AlignmentSorter.FEATURE_SCORE);
+ PA.setValue(AlignmentSorter.class, "sortByFeatureAscending", true);
+ AlignmentSorter.sortByFeature(null, null, 0, al.getWidth(), al,
+ AlignmentSorter.FEATURE_SCORE);
assertSame(al.getSequenceAt(3), seq3); // -0.5
assertSame(al.getSequenceAt(2), seq2); // 2.5
assertSame(al.getSequenceAt(1), seq1); // 3.0
/*
* repeat sort toggles order - now ascending
*/
- AlignmentSorter.sortByFeature((String) null, null, 0, al.getWidth(),
- al, AlignmentSorter.FEATURE_SCORE);
+ AlignmentSorter.sortByFeature(null, null, 0, al.getWidth(), al,
+ AlignmentSorter.FEATURE_SCORE);
assertSame(al.getSequenceAt(0), seq3); // -0.5
assertSame(al.getSequenceAt(1), seq2); // 2.5
assertSame(al.getSequenceAt(2), seq1); // 3.0
*/
// fails because seq1.findPosition(4) returns 4
// although residue 4 is in column 5! - JAL-2544
- AlignmentSorter.sortByFeature((String) null, null, 0, 4, al,
+ AlignmentSorter.sortByFeature(null, null, 0, 4, al,
AlignmentSorter.FEATURE_SCORE);
assertSame(al.getSequenceAt(0), seq3); // -4
assertSame(al.getSequenceAt(1), seq1); // 2.0
import static org.testng.AssertJUnit.fail;
import jalview.analysis.SecStrConsensus.SimpleBP;
+import jalview.datamodel.SequenceFeature;
import jalview.gui.JvOptionPane;
-import java.util.Vector;
+import java.util.List;
import org.testng.annotations.BeforeClass;
import org.testng.annotations.Test;
public void testGetSimpleBPs() throws WUSSParseException
{
String rna = "([{})]"; // JAL-1081 example
- Vector<SimpleBP> bps = Rna.getSimpleBPs(rna);
+ List<SimpleBP> bps = Rna.getSimpleBPs(rna);
assertEquals(3, bps.size());
/*
.valueOf((char) i) + " "));
}
}
+
+ @Test(groups = "Functional")
+ public void testGetHelixMap_oneHelix() throws WUSSParseException
+ {
+ String rna = ".(..[{.<..>}..].)";
+ SequenceFeature[] sfs = Rna.getHelixMap(rna);
+ assertEquals(4, sfs.length);
+
+ /*
+ * pairs are added in the order in which the closing bracket is found
+ * (see testGetSimpleBPs)
+ */
+ assertEquals(7, sfs[0].getBegin());
+ assertEquals(10, sfs[0].getEnd());
+ assertEquals("0", sfs[0].getFeatureGroup());
+ assertEquals(5, sfs[1].getBegin());
+ assertEquals(11, sfs[1].getEnd());
+ assertEquals("0", sfs[1].getFeatureGroup());
+ assertEquals(4, sfs[2].getBegin());
+ assertEquals(14, sfs[2].getEnd());
+ assertEquals("0", sfs[2].getFeatureGroup());
+ assertEquals(1, sfs[3].getBegin());
+ assertEquals(16, sfs[3].getEnd());
+ assertEquals("0", sfs[3].getFeatureGroup());
+ }
+
+ @Test(groups = "Functional")
+ public void testGetHelixMap_twoHelices() throws WUSSParseException
+ {
+ String rna = ".([.)]..{.<}.>";
+ SequenceFeature[] sfs = Rna.getHelixMap(rna);
+ assertEquals(4, sfs.length);
+
+ /*
+ * pairs are added in the order in which the closing bracket is found
+ * (see testGetSimpleBPs)
+ */
+ assertEquals(1, sfs[0].getBegin());
+ assertEquals(4, sfs[0].getEnd());
+ assertEquals("0", sfs[0].getFeatureGroup());
+ assertEquals(2, sfs[1].getBegin());
+ assertEquals(5, sfs[1].getEnd());
+ assertEquals("0", sfs[1].getFeatureGroup());
+ assertEquals(8, sfs[2].getBegin());
+ assertEquals(11, sfs[2].getEnd());
+ assertEquals("1", sfs[2].getFeatureGroup());
+ assertEquals(10, sfs[3].getBegin());
+ assertEquals(13, sfs[3].getEnd());
+ assertEquals("1", sfs[3].getFeatureGroup());
+ }
}
import static org.testng.Assert.assertEquals;
import static org.testng.Assert.assertTrue;
+import jalview.api.analysis.ScoreModelI;
import jalview.api.analysis.SimilarityParamsI;
import jalview.datamodel.Alignment;
import jalview.datamodel.AlignmentI;
public void testFeatureScoreModel() throws Exception
{
AlignFrame alf = getTestAlignmentFrame();
- FeatureDistanceModel fsm = new FeatureDistanceModel();
- assertTrue(fsm.configureFromAlignmentView(alf.getCurrentView()
- .getAlignPanel()));
+ ScoreModelI sm = new FeatureDistanceModel();
+ sm = ScoreModels.getInstance().getScoreModel(sm.getName(),
+ alf.getCurrentView().getAlignPanel());
alf.selectAllSequenceMenuItem_actionPerformed(null);
- MatrixI dm = fsm.findDistances(
+ MatrixI dm = sm.findDistances(
alf.getViewport().getAlignmentView(true),
SimilarityParams.Jalview);
assertEquals(dm.getValue(0, 2), 0d,
AlignFrame alf = getTestAlignmentFrame();
// hiding first two columns shouldn't affect the tree
alf.getViewport().hideColumns(0, 1);
- FeatureDistanceModel fsm = new FeatureDistanceModel();
- assertTrue(fsm.configureFromAlignmentView(alf.getCurrentView()
- .getAlignPanel()));
+ ScoreModelI sm = new FeatureDistanceModel();
+ sm = ScoreModels.getInstance().getScoreModel(sm.getName(),
+ alf.getCurrentView().getAlignPanel());
alf.selectAllSequenceMenuItem_actionPerformed(null);
- MatrixI dm = fsm.findDistances(
+ MatrixI dm = sm.findDistances(
alf.getViewport().getAlignmentView(true),
SimilarityParams.Jalview);
assertEquals(dm.getValue(0, 2), 0d,
// hide columns and check tree changes
alf.getViewport().hideColumns(3, 4);
alf.getViewport().hideColumns(0, 1);
- FeatureDistanceModel fsm = new FeatureDistanceModel();
- assertTrue(fsm.configureFromAlignmentView(alf.getCurrentView()
- .getAlignPanel()));
+ // getName() can become static in Java 8
+ ScoreModelI sm = new FeatureDistanceModel();
+ sm = ScoreModels.getInstance().getScoreModel(sm.getName(),
+ alf.getCurrentView().getAlignPanel());
alf.selectAllSequenceMenuItem_actionPerformed(null);
- MatrixI dm = fsm.findDistances(
+ MatrixI dm = sm.findDistances(
alf.getViewport().getAlignmentView(true),
SimilarityParams.Jalview);
assertEquals(
alf.setShowSeqFeatures(true);
alf.getFeatureRenderer().findAllFeatures(true);
- FeatureDistanceModel fsm = new FeatureDistanceModel();
- assertTrue(fsm.configureFromAlignmentView(alf.getCurrentView()
- .getAlignPanel()));
+ ScoreModelI sm = new FeatureDistanceModel();
+ sm = ScoreModels.getInstance().getScoreModel(sm.getName(),
+ alf.getCurrentView().getAlignPanel());
alf.selectAllSequenceMenuItem_actionPerformed(null);
- MatrixI distances = fsm.findDistances(alf.getViewport()
- .getAlignmentView(true), SimilarityParams.Jalview);
+ AlignmentView alignmentView = alf.getViewport()
+ .getAlignmentView(true);
+ MatrixI distances = sm.findDistances(alignmentView,
+ SimilarityParams.Jalview);
assertEquals(distances.width(), 2);
assertEquals(distances.height(), 2);
assertEquals(distances.getValue(0, 0), 0d);
AlignViewport viewport = af.getViewport();
AlignmentView view = viewport.getAlignmentView(false);
- FeatureDistanceModel sm = new FeatureDistanceModel();
- sm.configureFromAlignmentView(af.alignPanel);
-
+ ScoreModelI sm = new FeatureDistanceModel();
+ sm = ScoreModels.getInstance().getScoreModel(sm.getName(),
+ af.alignPanel);
+
/*
* feature distance model always normalises by region width
* gap-gap is always included (but scores zero)
import java.util.List;
import java.util.Vector;
+import junit.extensions.PA;
+
import org.testng.Assert;
import org.testng.annotations.BeforeClass;
import org.testng.annotations.BeforeMethod;
/*
* SequenceFeature on sequence
*/
- SequenceFeature sf = new SequenceFeature();
+ SequenceFeature sf = new SequenceFeature("Cath", "desc", 2, 4, 2f, null);
sq.addSequenceFeature(sf);
SequenceFeature[] sfs = sq.getSequenceFeatures();
assertEquals(1, sfs.length);
public void testCreateDatasetSequence()
{
SequenceI sq = new Sequence("my", "ASDASD");
+ sq.addSequenceFeature(new SequenceFeature("type", "desc", 1, 10, 1f,
+ "group"));
+ sq.addDBRef(new DBRefEntry("source", "version", "accession"));
assertNull(sq.getDatasetSequence());
+ assertNotNull(PA.getValue(sq, "sequenceFeatures")); // to be removed!
+ assertNotNull(PA.getValue(sq, "sequenceFeatureStore"));
+ assertNotNull(PA.getValue(sq, "dbrefs"));
+
SequenceI rds = sq.createDatasetSequence();
assertNotNull(rds);
assertNull(rds.getDatasetSequence());
- assertEquals(sq.getDatasetSequence(), rds);
+ assertSame(sq.getDatasetSequence(), rds);
+
+ // sequence features and dbrefs transferred to dataset sequence
+ assertNull(PA.getValue(sq, "sequenceFeatures"));
+ assertNull(PA.getValue(sq, "sequenceFeatureStore"));
+ assertNull(PA.getValue(sq, "dbrefs"));
+ assertNotNull(PA.getValue(rds, "sequenceFeatures"));
+ assertNotNull(PA.getValue(rds, "sequenceFeatureStore"));
+ assertNotNull(PA.getValue(rds, "dbrefs"));
}
/**
assertEquals(' ', sq.getCharAt(-1));
}
+ @Test(groups = { "Functional" })
+ public void testAddSequenceFeatures()
+ {
+ SequenceI sq = new Sequence("", "abcde");
+ // type may not be null
+ assertFalse(sq.addSequenceFeature(new SequenceFeature(null, "desc", 4,
+ 8, 0f, null)));
+ assertTrue(sq.addSequenceFeature(new SequenceFeature("Cath", "desc", 4,
+ 8, 0f, null)));
+ // can't add a duplicate feature
+ assertFalse(sq.addSequenceFeature(new SequenceFeature("Cath", "desc",
+ 4, 8, 0f, null)));
+ // can add a different feature
+ assertTrue(sq.addSequenceFeature(new SequenceFeature("Scop", "desc", 4,
+ 8, 0f, null))); // different type
+ assertTrue(sq.addSequenceFeature(new SequenceFeature("Cath",
+ "description", 4, 8, 0f, null)));// different description
+ assertTrue(sq.addSequenceFeature(new SequenceFeature("Cath", "desc", 3,
+ 8, 0f, null))); // different start position
+ assertTrue(sq.addSequenceFeature(new SequenceFeature("Cath", "desc", 4,
+ 9, 0f, null))); // different end position
+ assertTrue(sq.addSequenceFeature(new SequenceFeature("Cath", "desc", 4,
+ 8, 1f, null))); // different score
+ assertTrue(sq.addSequenceFeature(new SequenceFeature("Cath", "desc", 4,
+ 8, Float.NaN, null))); // score NaN
+ assertTrue(sq.addSequenceFeature(new SequenceFeature("Cath", "desc", 4,
+ 8, 0f, "Metal"))); // different group
+ assertEquals(8, sq.getFeatures().getAllFeatures().size());
+ }
+
/**
* Tests for adding (or updating) dbrefs
*
--- /dev/null
+package jalview.datamodel.features;
+
+import static org.testng.Assert.assertEquals;
+import static org.testng.Assert.assertFalse;
+import static org.testng.Assert.assertTrue;
+
+import jalview.datamodel.SequenceFeature;
+
+import java.util.ArrayList;
+import java.util.List;
+import java.util.Set;
+
+import org.testng.annotations.Test;
+
+public class FeatureStoreTest
+{
+
+ @Test(groups = "Functional")
+ public void testFindFeatures_nonNested()
+ {
+ FeatureStore fs = new FeatureStore();
+ fs.addFeature(new SequenceFeature("", "", 10, 20, Float.NaN,
+ null));
+ // same range different description
+ fs.addFeature(new SequenceFeature("", "desc", 10, 20, Float.NaN, null));
+ fs.addFeature(new SequenceFeature("", "", 15, 25, Float.NaN, null));
+ fs.addFeature(new SequenceFeature("", "", 20, 35, Float.NaN, null));
+
+ List<SequenceFeature> overlaps = fs.findOverlappingFeatures(1, 9);
+ assertTrue(overlaps.isEmpty());
+
+ overlaps = fs.findOverlappingFeatures(8, 10);
+ assertEquals(overlaps.size(), 2);
+ assertEquals(overlaps.get(0).getEnd(), 20);
+ assertEquals(overlaps.get(1).getEnd(), 20);
+
+ overlaps = fs.findOverlappingFeatures(12, 16);
+ assertEquals(overlaps.size(), 3);
+ assertEquals(overlaps.get(0).getEnd(), 20);
+ assertEquals(overlaps.get(1).getEnd(), 20);
+ assertEquals(overlaps.get(2).getEnd(), 25);
+
+ overlaps = fs.findOverlappingFeatures(33, 33);
+ assertEquals(overlaps.size(), 1);
+ assertEquals(overlaps.get(0).getEnd(), 35);
+ }
+
+ @Test(groups = "Functional")
+ public void testFindFeatures_nested()
+ {
+ FeatureStore fs = new FeatureStore();
+ SequenceFeature sf1 = addFeature(fs, 10, 50);
+ SequenceFeature sf2 = addFeature(fs, 10, 40);
+ SequenceFeature sf3 = addFeature(fs, 20, 30);
+ // fudge feature at same location but different group (so is added)
+ SequenceFeature sf4 = new SequenceFeature("", "", 20, 30, Float.NaN,
+ "different group");
+ fs.addFeature(sf4);
+ SequenceFeature sf5 = addFeature(fs, 35, 36);
+
+ List<SequenceFeature> overlaps = fs.findOverlappingFeatures(1, 9);
+ assertTrue(overlaps.isEmpty());
+
+ overlaps = fs.findOverlappingFeatures(10, 15);
+ assertEquals(overlaps.size(), 2);
+ assertTrue(overlaps.contains(sf1));
+ assertTrue(overlaps.contains(sf2));
+
+ overlaps = fs.findOverlappingFeatures(45, 60);
+ assertEquals(overlaps.size(), 1);
+ assertTrue(overlaps.contains(sf1));
+
+ overlaps = fs.findOverlappingFeatures(32, 38);
+ assertEquals(overlaps.size(), 3);
+ assertTrue(overlaps.contains(sf1));
+ assertTrue(overlaps.contains(sf2));
+ assertTrue(overlaps.contains(sf5));
+
+ overlaps = fs.findOverlappingFeatures(15, 25);
+ assertEquals(overlaps.size(), 4);
+ assertTrue(overlaps.contains(sf1));
+ assertTrue(overlaps.contains(sf2));
+ assertTrue(overlaps.contains(sf3));
+ assertTrue(overlaps.contains(sf4));
+ }
+
+ @Test(groups = "Functional")
+ public void testFindFeatures_mixed()
+ {
+ FeatureStore fs = new FeatureStore();
+ SequenceFeature sf1 = addFeature(fs, 10, 50);
+ SequenceFeature sf2 = addFeature(fs, 1, 15);
+ SequenceFeature sf3 = addFeature(fs, 20, 30);
+ SequenceFeature sf4 = addFeature(fs, 40, 100);
+ SequenceFeature sf5 = addFeature(fs, 60, 100);
+ SequenceFeature sf6 = addFeature(fs, 70, 70);
+
+ List<SequenceFeature> overlaps = fs.findOverlappingFeatures(200, 200);
+ assertTrue(overlaps.isEmpty());
+
+ overlaps = fs.findOverlappingFeatures(1, 9);
+ assertEquals(overlaps.size(), 1);
+ assertTrue(overlaps.contains(sf2));
+
+ overlaps = fs.findOverlappingFeatures(5, 18);
+ assertEquals(overlaps.size(), 2);
+ assertTrue(overlaps.contains(sf1));
+ assertTrue(overlaps.contains(sf2));
+
+ overlaps = fs.findOverlappingFeatures(30, 40);
+ assertEquals(overlaps.size(), 3);
+ assertTrue(overlaps.contains(sf1));
+ assertTrue(overlaps.contains(sf3));
+ assertTrue(overlaps.contains(sf4));
+
+ overlaps = fs.findOverlappingFeatures(80, 90);
+ assertEquals(overlaps.size(), 2);
+ assertTrue(overlaps.contains(sf4));
+ assertTrue(overlaps.contains(sf5));
+
+ overlaps = fs.findOverlappingFeatures(68, 70);
+ assertEquals(overlaps.size(), 3);
+ assertTrue(overlaps.contains(sf4));
+ assertTrue(overlaps.contains(sf5));
+ assertTrue(overlaps.contains(sf6));
+ }
+
+ /**
+ * Helper method to add a feature of no particular type
+ *
+ * @param fs
+ * @param from
+ * @param to
+ * @return
+ */
+ SequenceFeature addFeature(FeatureStore fs, int from, int to)
+ {
+ SequenceFeature sf1 = new SequenceFeature("", "", from, to, Float.NaN,
+ null);
+ fs.addFeature(sf1);
+ return sf1;
+ }
+
+ @Test(groups = "Functional")
+ public void testFindFeatures_contactFeatures()
+ {
+ FeatureStore fs = new FeatureStore();
+
+ SequenceFeature sf = new SequenceFeature("disulphide bond", "bond", 10,
+ 20, Float.NaN, null);
+ fs.addFeature(sf);
+
+ /*
+ * neither contact point in range
+ */
+ List<SequenceFeature> overlaps = fs.findOverlappingFeatures(1, 9);
+ assertTrue(overlaps.isEmpty());
+
+ /*
+ * neither contact point in range
+ */
+ overlaps = fs.findOverlappingFeatures(11, 19);
+ assertTrue(overlaps.isEmpty());
+
+ /*
+ * first contact point in range
+ */
+ overlaps = fs.findOverlappingFeatures(5, 15);
+ assertEquals(overlaps.size(), 1);
+ assertTrue(overlaps.contains(sf));
+
+ /*
+ * second contact point in range
+ */
+ overlaps = fs.findOverlappingFeatures(15, 25);
+ assertEquals(overlaps.size(), 1);
+ assertTrue(overlaps.contains(sf));
+
+ /*
+ * both contact points in range
+ */
+ overlaps = fs.findOverlappingFeatures(5, 25);
+ assertEquals(overlaps.size(), 1);
+ assertTrue(overlaps.contains(sf));
+ }
+
+ /**
+ * Tests for the method that returns false for an attempt to add a feature
+ * that would enclose, or be enclosed by, another feature
+ */
+ @Test(groups = "Functional")
+ public void testAddNonNestedFeature()
+ {
+ FeatureStore fs = new FeatureStore();
+
+ String type = "Domain";
+ SequenceFeature sf1 = new SequenceFeature(type, type, 10, 20,
+ Float.NaN, null);
+ assertTrue(fs.addNonNestedFeature(sf1));
+
+ // co-located feature is ok
+ SequenceFeature sf2 = new SequenceFeature(type, type, 10, 20,
+ Float.NaN, null);
+ assertTrue(fs.addNonNestedFeature(sf2));
+
+ // overlap left is ok
+ SequenceFeature sf3 = new SequenceFeature(type, type, 5, 15, Float.NaN,
+ null);
+ assertTrue(fs.addNonNestedFeature(sf3));
+
+ // overlap right is ok
+ SequenceFeature sf4 = new SequenceFeature(type, type, 15, 25,
+ Float.NaN, null);
+ assertTrue(fs.addNonNestedFeature(sf4));
+
+ // add enclosing feature is not ok
+ SequenceFeature sf5 = new SequenceFeature(type, type, 10, 21,
+ Float.NaN, null);
+ assertFalse(fs.addNonNestedFeature(sf5));
+ SequenceFeature sf6 = new SequenceFeature(type, type, 4, 15, Float.NaN,
+ null);
+ assertFalse(fs.addNonNestedFeature(sf6));
+ SequenceFeature sf7 = new SequenceFeature(type, type, 1, 50, Float.NaN,
+ null);
+ assertFalse(fs.addNonNestedFeature(sf7));
+
+ // add enclosed feature is not ok
+ SequenceFeature sf8 = new SequenceFeature(type, type, 10, 19,
+ Float.NaN, null);
+ assertFalse(fs.addNonNestedFeature(sf8));
+ SequenceFeature sf9 = new SequenceFeature(type, type, 16, 25,
+ Float.NaN, null);
+ assertFalse(fs.addNonNestedFeature(sf9));
+ SequenceFeature sf10 = new SequenceFeature(type, type, 7, 7, Float.NaN,
+ null);
+ assertFalse(fs.addNonNestedFeature(sf10));
+ }
+
+ @Test(groups = "Functional")
+ public void testGetPositionalFeatures()
+ {
+ FeatureStore store = new FeatureStore();
+ SequenceFeature sf1 = new SequenceFeature("Metal", "desc", 10, 20,
+ Float.NaN, null);
+ store.addFeature(sf1);
+ // same range, different description
+ SequenceFeature sf2 = new SequenceFeature("Metal", "desc2", 10, 20,
+ Float.NaN, null);
+ store.addFeature(sf2);
+ // discontiguous range
+ SequenceFeature sf3 = new SequenceFeature("Metal", "desc", 30, 40,
+ Float.NaN, null);
+ store.addFeature(sf3);
+ // overlapping range
+ SequenceFeature sf4 = new SequenceFeature("Metal", "desc", 15, 35,
+ Float.NaN, null);
+ store.addFeature(sf4);
+ // enclosing range
+ SequenceFeature sf5 = new SequenceFeature("Metal", "desc", 5, 50,
+ Float.NaN, null);
+ store.addFeature(sf5);
+ // non-positional feature
+ SequenceFeature sf6 = new SequenceFeature("Metal", "desc", 0, 0,
+ Float.NaN, null);
+ store.addFeature(sf6);
+ // contact feature
+ SequenceFeature sf7 = new SequenceFeature("Disulphide bond", "desc",
+ 18, 45, Float.NaN, null);
+ store.addFeature(sf7);
+
+ List<SequenceFeature> features = store.getPositionalFeatures();
+ assertEquals(features.size(), 6);
+ assertTrue(features.contains(sf1));
+ assertTrue(features.contains(sf2));
+ assertTrue(features.contains(sf3));
+ assertTrue(features.contains(sf4));
+ assertTrue(features.contains(sf5));
+ assertFalse(features.contains(sf6));
+ assertTrue(features.contains(sf7));
+
+ features = store.getNonPositionalFeatures();
+ assertEquals(features.size(), 1);
+ assertTrue(features.contains(sf6));
+ }
+
+ @Test(groups = "Functional")
+ public void testDelete()
+ {
+ FeatureStore store = new FeatureStore();
+ SequenceFeature sf1 = addFeature(store, 10, 20);
+ assertTrue(store.getPositionalFeatures().contains(sf1));
+
+ /*
+ * simple deletion
+ */
+ assertTrue(store.delete(sf1));
+ assertTrue(store.getPositionalFeatures().isEmpty());
+
+ /*
+ * non-positional feature deletion
+ */
+ SequenceFeature sf2 = addFeature(store, 0, 0);
+ assertFalse(store.getPositionalFeatures().contains(sf2));
+ assertTrue(store.getNonPositionalFeatures().contains(sf2));
+ assertTrue(store.delete(sf2));
+ assertTrue(store.getNonPositionalFeatures().isEmpty());
+
+ /*
+ * contact feature deletion
+ */
+ SequenceFeature sf3 = new SequenceFeature("", "Disulphide Bond", 11,
+ 23, Float.NaN, null);
+ store.addFeature(sf3);
+ assertEquals(store.getPositionalFeatures().size(), 1);
+ assertTrue(store.getPositionalFeatures().contains(sf3));
+ assertTrue(store.delete(sf3));
+ assertTrue(store.getPositionalFeatures().isEmpty());
+
+ /*
+ * nested feature deletion
+ */
+ SequenceFeature sf4 = addFeature(store, 20, 30);
+ SequenceFeature sf5 = addFeature(store, 22, 26); // to NCList
+ SequenceFeature sf6 = addFeature(store, 23, 24); // child of sf5
+ SequenceFeature sf7 = addFeature(store, 25, 25); // sibling of sf6
+ SequenceFeature sf8 = addFeature(store, 24, 24); // child of sf6
+ SequenceFeature sf9 = addFeature(store, 23, 23); // child of sf6
+ assertEquals(store.getPositionalFeatures().size(), 6);
+
+ // delete a node with children - they take its place
+ assertTrue(store.delete(sf6)); // sf8, sf9 should become children of sf5
+ assertEquals(store.getPositionalFeatures().size(), 5);
+ assertFalse(store.getPositionalFeatures().contains(sf6));
+
+ // delete a node with no children
+ assertTrue(store.delete(sf7));
+ assertEquals(store.getPositionalFeatures().size(), 4);
+ assertFalse(store.getPositionalFeatures().contains(sf7));
+
+ // delete root of NCList
+ assertTrue(store.delete(sf5));
+ assertEquals(store.getPositionalFeatures().size(), 3);
+ assertFalse(store.getPositionalFeatures().contains(sf5));
+
+ // continue the killing fields
+ assertTrue(store.delete(sf4));
+ assertEquals(store.getPositionalFeatures().size(), 2);
+ assertFalse(store.getPositionalFeatures().contains(sf4));
+
+ assertTrue(store.delete(sf9));
+ assertEquals(store.getPositionalFeatures().size(), 1);
+ assertFalse(store.getPositionalFeatures().contains(sf9));
+
+ assertTrue(store.delete(sf8));
+ assertTrue(store.getPositionalFeatures().isEmpty());
+ }
+
+ @Test(groups = "Functional")
+ public void testAddFeature()
+ {
+ FeatureStore fs = new FeatureStore();
+
+ SequenceFeature sf1 = new SequenceFeature("Cath", "", 10, 20,
+ Float.NaN, null);
+ SequenceFeature sf2 = new SequenceFeature("Cath", "", 10, 20,
+ Float.NaN, null);
+
+ assertTrue(fs.addFeature(sf1));
+ assertEquals(fs.getFeatureCount(true), 1); // positional
+ assertEquals(fs.getFeatureCount(false), 0); // non-positional
+
+ /*
+ * re-adding the same or an identical feature should fail
+ */
+ assertFalse(fs.addFeature(sf1));
+ assertEquals(fs.getFeatureCount(true), 1);
+ assertFalse(fs.addFeature(sf2));
+ assertEquals(fs.getFeatureCount(true), 1);
+
+ /*
+ * add non-positional
+ */
+ SequenceFeature sf3 = new SequenceFeature("Cath", "", 0, 0, Float.NaN,
+ null);
+ assertTrue(fs.addFeature(sf3));
+ assertEquals(fs.getFeatureCount(true), 1); // positional
+ assertEquals(fs.getFeatureCount(false), 1); // non-positional
+ SequenceFeature sf4 = new SequenceFeature("Cath", "", 0, 0, Float.NaN,
+ null);
+ assertFalse(fs.addFeature(sf4)); // already stored
+ assertEquals(fs.getFeatureCount(true), 1); // positional
+ assertEquals(fs.getFeatureCount(false), 1); // non-positional
+
+ /*
+ * add contact
+ */
+ SequenceFeature sf5 = new SequenceFeature("Disulfide bond", "", 0, 0,
+ Float.NaN, null);
+ assertTrue(fs.addFeature(sf5));
+ assertEquals(fs.getFeatureCount(true), 2); // positional - add 1 for contact
+ assertEquals(fs.getFeatureCount(false), 1); // non-positional
+ SequenceFeature sf6 = new SequenceFeature("Disulfide bond", "", 0, 0,
+ Float.NaN, null);
+ assertFalse(fs.addFeature(sf6)); // already stored
+ assertEquals(fs.getFeatureCount(true), 2); // no change
+ assertEquals(fs.getFeatureCount(false), 1); // no change
+ }
+
+ @Test(groups = "Functional")
+ public void testIsEmpty()
+ {
+ FeatureStore fs = new FeatureStore();
+ assertTrue(fs.isEmpty());
+ assertEquals(fs.getFeatureCount(true), 0);
+
+ /*
+ * non-nested feature
+ */
+ SequenceFeature sf1 = new SequenceFeature("Cath", "", 10, 20,
+ Float.NaN, null);
+ fs.addFeature(sf1);
+ assertFalse(fs.isEmpty());
+ assertEquals(fs.getFeatureCount(true), 1);
+ fs.delete(sf1);
+ assertTrue(fs.isEmpty());
+ assertEquals(fs.getFeatureCount(true), 0);
+
+ /*
+ * non-positional feature
+ */
+ sf1 = new SequenceFeature("Cath", "", 0, 0, Float.NaN, null);
+ fs.addFeature(sf1);
+ assertFalse(fs.isEmpty());
+ assertEquals(fs.getFeatureCount(false), 1); // non-positional
+ assertEquals(fs.getFeatureCount(true), 0); // positional
+ fs.delete(sf1);
+ assertTrue(fs.isEmpty());
+ assertEquals(fs.getFeatureCount(false), 0);
+
+ /*
+ * contact feature
+ */
+ sf1 = new SequenceFeature("Disulfide bond", "", 19, 49, Float.NaN, null);
+ fs.addFeature(sf1);
+ assertFalse(fs.isEmpty());
+ assertEquals(fs.getFeatureCount(true), 1);
+ fs.delete(sf1);
+ assertTrue(fs.isEmpty());
+ assertEquals(fs.getFeatureCount(true), 0);
+
+ /*
+ * sf2, sf3 added as nested features
+ */
+ sf1 = new SequenceFeature("Cath", "", 19, 49, Float.NaN, null);
+ SequenceFeature sf2 = new SequenceFeature("Cath", "", 20, 40,
+ Float.NaN, null);
+ SequenceFeature sf3 = new SequenceFeature("Cath", "", 25, 35,
+ Float.NaN, null);
+ fs.addFeature(sf1);
+ fs.addFeature(sf2);
+ fs.addFeature(sf3);
+ assertEquals(fs.getFeatureCount(true), 3);
+ assertTrue(fs.delete(sf1));
+ assertEquals(fs.getFeatureCount(true), 2);
+ // FeatureStore should now only contain features in the NCList
+ assertTrue(fs.nonNestedFeatures.isEmpty());
+ assertEquals(fs.nestedFeatures.size(), 2);
+ assertFalse(fs.isEmpty());
+ assertTrue(fs.delete(sf2));
+ assertEquals(fs.getFeatureCount(true), 1);
+ assertFalse(fs.isEmpty());
+ assertTrue(fs.delete(sf3));
+ assertEquals(fs.getFeatureCount(true), 0);
+ assertTrue(fs.isEmpty()); // all gone
+ }
+
+ @Test(groups = "Functional")
+ public void testGetFeatureGroups()
+ {
+ FeatureStore fs = new FeatureStore();
+ assertTrue(fs.getFeatureGroups(true).isEmpty());
+ assertTrue(fs.getFeatureGroups(false).isEmpty());
+
+ SequenceFeature sf1 = new SequenceFeature("Cath", "desc", 10, 20, 1f, "group1");
+ fs.addFeature(sf1);
+ Set<String> groups = fs.getFeatureGroups(true);
+ assertEquals(groups.size(), 1);
+ assertTrue(groups.contains("group1"));
+
+ /*
+ * add another feature of the same group, delete one, delete both
+ */
+ SequenceFeature sf2 = new SequenceFeature("Cath", "desc", 20, 30, 1f, "group1");
+ fs.addFeature(sf2);
+ groups = fs.getFeatureGroups(true);
+ assertEquals(groups.size(), 1);
+ assertTrue(groups.contains("group1"));
+ fs.delete(sf2);
+ groups = fs.getFeatureGroups(true);
+ assertEquals(groups.size(), 1);
+ assertTrue(groups.contains("group1"));
+ fs.delete(sf1);
+ groups = fs.getFeatureGroups(true);
+ assertTrue(fs.getFeatureGroups(true).isEmpty());
+
+ SequenceFeature sf3 = new SequenceFeature("Cath", "desc", 20, 30, 1f, "group2");
+ fs.addFeature(sf3);
+ SequenceFeature sf4 = new SequenceFeature("Cath", "desc", 20, 30, 1f, "Group2");
+ fs.addFeature(sf4);
+ SequenceFeature sf5 = new SequenceFeature("Cath", "desc", 20, 30, 1f, null);
+ fs.addFeature(sf5);
+ groups = fs.getFeatureGroups(true);
+ assertEquals(groups.size(), 3);
+ assertTrue(groups.contains("group2"));
+ assertTrue(groups.contains("Group2")); // case sensitive
+ assertTrue(groups.contains(null)); // null allowed
+ assertTrue(fs.getFeatureGroups(false).isEmpty()); // non-positional
+
+ fs.delete(sf3);
+ groups = fs.getFeatureGroups(true);
+ assertEquals(groups.size(), 2);
+ assertFalse(groups.contains("group2"));
+ fs.delete(sf4);
+ groups = fs.getFeatureGroups(true);
+ assertEquals(groups.size(), 1);
+ assertFalse(groups.contains("Group2"));
+ fs.delete(sf5);
+ groups = fs.getFeatureGroups(true);
+ assertTrue(groups.isEmpty());
+
+ /*
+ * add non-positional feature
+ */
+ SequenceFeature sf6 = new SequenceFeature("Cath", "desc", 0, 0, 1f,
+ "CathGroup");
+ fs.addFeature(sf6);
+ groups = fs.getFeatureGroups(false);
+ assertEquals(groups.size(), 1);
+ assertTrue(groups.contains("CathGroup"));
+ assertTrue(fs.delete(sf6));
+ assertTrue(fs.getFeatureGroups(false).isEmpty());
+ }
+
+ @Test(groups = "Functional")
+ public void testGetTotalFeatureLength()
+ {
+ FeatureStore fs = new FeatureStore();
+ assertEquals(fs.getTotalFeatureLength(), 0);
+
+ addFeature(fs, 10, 20); // 11
+ assertEquals(fs.getTotalFeatureLength(), 11);
+ addFeature(fs, 17, 37); // 21
+ SequenceFeature sf1 = addFeature(fs, 14, 74); // 61
+ assertEquals(fs.getTotalFeatureLength(), 93);
+
+ // non-positional features don't count
+ SequenceFeature sf2 = new SequenceFeature("Cath", "desc", 0, 0, 1f,
+ "group1");
+ fs.addFeature(sf2);
+ assertEquals(fs.getTotalFeatureLength(), 93);
+
+ // contact features count 1
+ SequenceFeature sf3 = new SequenceFeature("disulphide bond", "desc",
+ 15, 35, 1f, "group1");
+ fs.addFeature(sf3);
+ assertEquals(fs.getTotalFeatureLength(), 94);
+
+ assertTrue(fs.delete(sf1));
+ assertEquals(fs.getTotalFeatureLength(), 33);
+ assertFalse(fs.delete(sf1));
+ assertEquals(fs.getTotalFeatureLength(), 33);
+ assertTrue(fs.delete(sf2));
+ assertEquals(fs.getTotalFeatureLength(), 33);
+ assertTrue(fs.delete(sf3));
+ assertEquals(fs.getTotalFeatureLength(), 32);
+ }
+
+ @Test(groups = "Functional")
+ public void testGetFeatureLength()
+ {
+ /*
+ * positional feature
+ */
+ SequenceFeature sf1 = new SequenceFeature("Cath", "desc", 10, 20, 1f, "group1");
+ assertEquals(FeatureStore.getFeatureLength(sf1), 11);
+
+ /*
+ * non-positional feature
+ */
+ SequenceFeature sf2 = new SequenceFeature("Cath", "desc", 0, 0, 1f,
+ "CathGroup");
+ assertEquals(FeatureStore.getFeatureLength(sf2), 0);
+
+ /*
+ * contact feature counts 1
+ */
+ SequenceFeature sf3 = new SequenceFeature("Disulphide Bond", "desc",
+ 14, 28, 1f, "AGroup");
+ assertEquals(FeatureStore.getFeatureLength(sf3), 1);
+ }
+
+ @Test(groups = "Functional")
+ public void testMin()
+ {
+ assertEquals(FeatureStore.min(Float.NaN, Float.NaN), Float.NaN);
+ assertEquals(FeatureStore.min(Float.NaN, 2f), 2f);
+ assertEquals(FeatureStore.min(-2f, Float.NaN), -2f);
+ assertEquals(FeatureStore.min(2f, -3f), -3f);
+ }
+
+ @Test(groups = "Functional")
+ public void testMax()
+ {
+ assertEquals(FeatureStore.max(Float.NaN, Float.NaN), Float.NaN);
+ assertEquals(FeatureStore.max(Float.NaN, 2f), 2f);
+ assertEquals(FeatureStore.max(-2f, Float.NaN), -2f);
+ assertEquals(FeatureStore.max(2f, -3f), 2f);
+ }
+
+ @Test(groups = "Functional")
+ public void testGetMinimumScore_getMaximumScore()
+ {
+ FeatureStore fs = new FeatureStore();
+ assertEquals(fs.getMinimumScore(true), Float.NaN); // positional
+ assertEquals(fs.getMaximumScore(true), Float.NaN);
+ assertEquals(fs.getMinimumScore(false), Float.NaN); // non-positional
+ assertEquals(fs.getMaximumScore(false), Float.NaN);
+
+ // add features with no score
+ SequenceFeature sf1 = new SequenceFeature("type", "desc", 0, 0,
+ Float.NaN, "group");
+ fs.addFeature(sf1);
+ SequenceFeature sf2 = new SequenceFeature("type", "desc", 10, 20,
+ Float.NaN, "group");
+ fs.addFeature(sf2);
+ assertEquals(fs.getMinimumScore(true), Float.NaN);
+ assertEquals(fs.getMaximumScore(true), Float.NaN);
+ assertEquals(fs.getMinimumScore(false), Float.NaN);
+ assertEquals(fs.getMaximumScore(false), Float.NaN);
+
+ // add positional features with score
+ SequenceFeature sf3 = new SequenceFeature("type", "desc", 10, 20, 1f,
+ "group");
+ fs.addFeature(sf3);
+ SequenceFeature sf4 = new SequenceFeature("type", "desc", 12, 16, 4f,
+ "group");
+ fs.addFeature(sf4);
+ assertEquals(fs.getMinimumScore(true), 1f);
+ assertEquals(fs.getMaximumScore(true), 4f);
+ assertEquals(fs.getMinimumScore(false), Float.NaN);
+ assertEquals(fs.getMaximumScore(false), Float.NaN);
+
+ // add non-positional features with score
+ SequenceFeature sf5 = new SequenceFeature("type", "desc", 0, 0, 11f,
+ "group");
+ fs.addFeature(sf5);
+ SequenceFeature sf6 = new SequenceFeature("type", "desc", 0, 0, -7f,
+ "group");
+ fs.addFeature(sf6);
+ assertEquals(fs.getMinimumScore(true), 1f);
+ assertEquals(fs.getMaximumScore(true), 4f);
+ assertEquals(fs.getMinimumScore(false), -7f);
+ assertEquals(fs.getMaximumScore(false), 11f);
+
+ // delete one positional and one non-positional
+ // min-max should be recomputed
+ assertTrue(fs.delete(sf6));
+ assertTrue(fs.delete(sf3));
+ assertEquals(fs.getMinimumScore(true), 4f);
+ assertEquals(fs.getMaximumScore(true), 4f);
+ assertEquals(fs.getMinimumScore(false), 11f);
+ assertEquals(fs.getMaximumScore(false), 11f);
+
+ // delete remaining features with score
+ assertTrue(fs.delete(sf4));
+ assertTrue(fs.delete(sf5));
+ assertEquals(fs.getMinimumScore(true), Float.NaN);
+ assertEquals(fs.getMaximumScore(true), Float.NaN);
+ assertEquals(fs.getMinimumScore(false), Float.NaN);
+ assertEquals(fs.getMaximumScore(false), Float.NaN);
+
+ // delete all features
+ assertTrue(fs.delete(sf1));
+ assertTrue(fs.delete(sf2));
+ assertTrue(fs.isEmpty());
+ assertEquals(fs.getMinimumScore(true), Float.NaN);
+ assertEquals(fs.getMaximumScore(true), Float.NaN);
+ assertEquals(fs.getMinimumScore(false), Float.NaN);
+ assertEquals(fs.getMaximumScore(false), Float.NaN);
+ }
+
+ @Test(groups = "Functional")
+ public void testContains()
+ {
+ assertFalse(FeatureStore.contains(null, null));
+ List<SequenceFeature> features = new ArrayList<SequenceFeature>();
+ assertFalse(FeatureStore.contains(features, null));
+
+ SequenceFeature sf1 = new SequenceFeature("type1", "desc1", 20, 30, 3f,
+ "group1");
+ assertFalse(FeatureStore.contains(null, sf1));
+ assertFalse(FeatureStore.contains(features, sf1));
+
+ features.add(sf1);
+ SequenceFeature sf2 = new SequenceFeature("type1", "desc1", 20, 30, 3f,
+ "group1");
+ SequenceFeature sf3 = new SequenceFeature("type1", "desc1", 20, 40, 3f,
+ "group1");
+
+ // sf2.equals(sf1) so contains should return true
+ assertTrue(FeatureStore.contains(features, sf2));
+ assertFalse(FeatureStore.contains(features, sf3));
+ }
+}
--- /dev/null
+package jalview.datamodel.features;
+import static org.testng.Assert.assertEquals;
+import static org.testng.Assert.assertFalse;
+import static org.testng.Assert.assertSame;
+import static org.testng.Assert.assertTrue;
+
+import jalview.datamodel.SequenceFeature;
+
+import java.util.ArrayList;
+import java.util.Collections;
+import java.util.Comparator;
+import java.util.List;
+import java.util.Random;
+
+import junit.extensions.PA;
+
+import org.testng.annotations.DataProvider;
+import org.testng.annotations.Test;
+
+public class NCListTest
+{
+
+ private Random random = new Random(107);
+
+ private Comparator<ContiguousI> sorter = new RangeComparator(true);
+
+ /**
+ * A basic sanity test of the constructor
+ */
+ @Test(groups = "Functional")
+ public void testConstructor()
+ {
+ List<Range> ranges = new ArrayList<Range>();
+ ranges.add(new Range(20, 20));
+ ranges.add(new Range(10, 20));
+ ranges.add(new Range(15, 30));
+ ranges.add(new Range(10, 30));
+ ranges.add(new Range(11, 19));
+ ranges.add(new Range(10, 20));
+ ranges.add(new Range(1, 100));
+
+ NCList<Range> ncl = new NCList<Range>(ranges);
+ String expected = "[1-100 [10-30 [10-20 [10-20 [11-19]]]], 15-30 [20-20]]";
+ assertEquals(ncl.toString(), expected);
+ assertTrue(ncl.isValid());
+
+ Collections.reverse(ranges);
+ ncl = new NCList<Range>(ranges);
+ assertEquals(ncl.toString(), expected);
+ assertTrue(ncl.isValid());
+ }
+
+ @Test(groups = "Functional")
+ public void testFindOverlaps()
+ {
+ List<Range> ranges = new ArrayList<Range>();
+ ranges.add(new Range(20, 50));
+ ranges.add(new Range(30, 70));
+ ranges.add(new Range(1, 100));
+ ranges.add(new Range(70, 120));
+
+ NCList<Range> ncl = new NCList<Range>(ranges);
+
+ List<Range> overlaps = ncl.findOverlaps(121, 122);
+ assertEquals(overlaps.size(), 0);
+
+ overlaps = ncl.findOverlaps(21, 22);
+ assertEquals(overlaps.size(), 2);
+ assertEquals(((ContiguousI) overlaps.get(0)).getBegin(), 1);
+ assertEquals(((ContiguousI) overlaps.get(0)).getEnd(), 100);
+ assertEquals(((ContiguousI) overlaps.get(1)).getBegin(), 20);
+ assertEquals(((ContiguousI) overlaps.get(1)).getEnd(), 50);
+
+ overlaps = ncl.findOverlaps(110, 110);
+ assertEquals(overlaps.size(), 1);
+ assertEquals(((ContiguousI) overlaps.get(0)).getBegin(), 70);
+ assertEquals(((ContiguousI) overlaps.get(0)).getEnd(), 120);
+ }
+
+ @Test(groups = "Functional")
+ public void testAdd_onTheEnd()
+ {
+ List<Range> ranges = new ArrayList<Range>();
+ ranges.add(new Range(20, 50));
+ NCList<Range> ncl = new NCList<Range>(ranges);
+ assertEquals(ncl.toString(), "[20-50]");
+ assertTrue(ncl.isValid());
+
+ ncl.add(new Range(60, 70));
+ assertEquals(ncl.toString(), "[20-50, 60-70]");
+ assertTrue(ncl.isValid());
+ }
+
+ @Test(groups = "Functional")
+ public void testAdd_inside()
+ {
+ List<Range> ranges = new ArrayList<Range>();
+ ranges.add(new Range(20, 50));
+ NCList<Range> ncl = new NCList<Range>(ranges);
+ assertEquals(ncl.toString(), "[20-50]");
+ assertTrue(ncl.isValid());
+
+ ncl.add(new Range(30, 40));
+ assertEquals(ncl.toString(), "[20-50 [30-40]]");
+ }
+
+ @Test(groups = "Functional")
+ public void testAdd_onTheFront()
+ {
+ List<Range> ranges = new ArrayList<Range>();
+ ranges.add(new Range(20, 50));
+ NCList<Range> ncl = new NCList<Range>(ranges);
+ assertEquals(ncl.toString(), "[20-50]");
+ assertTrue(ncl.isValid());
+
+ ncl.add(new Range(5, 15));
+ assertEquals(ncl.toString(), "[5-15, 20-50]");
+ assertTrue(ncl.isValid());
+ }
+
+ @Test(groups = "Functional")
+ public void testAdd_enclosing()
+ {
+ List<Range> ranges = new ArrayList<Range>();
+ ranges.add(new Range(20, 50));
+ ranges.add(new Range(30, 60));
+ NCList<Range> ncl = new NCList<Range>(ranges);
+ assertEquals(ncl.toString(), "[20-50, 30-60]");
+ assertTrue(ncl.isValid());
+ assertEquals(ncl.getStart(), 20);
+
+ ncl.add(new Range(10, 70));
+ assertEquals(ncl.toString(), "[10-70 [20-50, 30-60]]");
+ assertTrue(ncl.isValid());
+ }
+
+ @Test(groups = "Functional")
+ public void testAdd_spanning()
+ {
+ List<Range> ranges = new ArrayList<Range>();
+ ranges.add(new Range(20, 40));
+ ranges.add(new Range(60, 70));
+ NCList<Range> ncl = new NCList<Range>(ranges);
+ assertEquals(ncl.toString(), "[20-40, 60-70]");
+ assertTrue(ncl.isValid());
+
+ ncl.add(new Range(30, 50));
+ assertEquals(ncl.toString(), "[20-40, 30-50, 60-70]");
+ assertTrue(ncl.isValid());
+
+ ncl.add(new Range(40, 65));
+ assertEquals(ncl.toString(), "[20-40, 30-50, 40-65, 60-70]");
+ assertTrue(ncl.isValid());
+ }
+
+ /**
+ * Provides the scales for pseudo-random NCLists i.e. the range of the maximal
+ * [0-scale] interval to be stored
+ *
+ * @return
+ */
+ @DataProvider(name = "scalesOfLife")
+ public Object[][] getScales()
+ {
+ return new Object[][] { new Integer[] { 10 }, new Integer[] { 100 } };
+ }
+
+ /**
+ * Do a number of pseudo-random (reproducible) builds of an NCList, to
+ * exercise as many methods of the class as possible while generating the
+ * range of possible structure topologies
+ * <ul>
+ * <li>verify that add adds an entry and increments size</li>
+ * <li>...except where the entry is already contained (by equals test)</li>
+ * <li>verify that the structure is valid at all stages of construction</li>
+ * <li>generate, run and verify a range of overlap queries</li>
+ * <li>tear down the structure by deleting entries, verifying correctness at
+ * each stage</li>
+ * </ul>
+ */
+ @Test(groups = "Functional", dataProvider = "scalesOfLife")
+ public void test_pseudoRandom(Integer scale)
+ {
+ NCList<SequenceFeature> ncl = new NCList<SequenceFeature>();
+ List<SequenceFeature> features = new ArrayList<SequenceFeature>(scale);
+
+ testAdd_pseudoRandom(scale, ncl, features);
+
+ /*
+ * sort the list of added ranges - this doesn't affect the test,
+ * just makes it easier to inspect the data in the debugger
+ */
+ Collections.sort(features, sorter);
+
+ testFindOverlaps_pseudoRandom(ncl, scale, features);
+
+ testDelete_pseudoRandom(ncl, features);
+ }
+
+ /**
+ * Pick randomly selected entries to delete in turn, checking the NCList size
+ * and validity at each stage, until it is empty
+ *
+ * @param ncl
+ * @param features
+ */
+ protected void testDelete_pseudoRandom(NCList<SequenceFeature> ncl,
+ List<SequenceFeature> features)
+ {
+ int deleted = 0;
+
+ while (!features.isEmpty())
+ {
+ assertEquals(ncl.size(), features.size());
+ int toDelete = random.nextInt(features.size());
+ SequenceFeature entry = features.get(toDelete);
+ assertTrue(ncl.contains(entry), String.format(
+ "NCList doesn't contain entry [%d] '%s'!", deleted,
+ entry.toString()));
+
+ ncl.delete(entry);
+ assertFalse(ncl.contains(entry), String.format(
+ "NCList still contains deleted entry [%d] '%s'!", deleted,
+ entry.toString()));
+ features.remove(toDelete);
+ deleted++;
+
+ assertTrue(ncl.isValid(), String.format(
+ "NCList invalid after %d deletions, last deleted was '%s'",
+ deleted, entry.toString()));
+
+ /*
+ * brute force check that deleting one entry didn't delete any others
+ */
+ for (int i = 0; i < features.size(); i++)
+ {
+ SequenceFeature sf = features.get(i);
+ assertTrue(ncl.contains(sf), String.format(
+ "NCList doesn't contain entry [%d] %s after deleting '%s'!",
+ i, sf.toString(), entry.toString()));
+ }
+ }
+ assertEquals(ncl.size(), 0); // all gone
+ }
+
+ /**
+ * Randomly generate entries and add them to the NCList, checking its validity
+ * and size at each stage. A few entries should be duplicates (by equals test)
+ * so not get added.
+ *
+ * @param scale
+ * @param ncl
+ * @param features
+ */
+ protected void testAdd_pseudoRandom(Integer scale,
+ NCList<SequenceFeature> ncl,
+ List<SequenceFeature> features)
+ {
+ int count = 0;
+ final int size = 50;
+
+ for (int i = 0; i < size; i++)
+ {
+ int r1 = random.nextInt(scale + 1);
+ int r2 = random.nextInt(scale + 1);
+ int from = Math.min(r1, r2);
+ int to = Math.max(r1, r2);
+
+ /*
+ * choice of two feature values means that occasionally an identical
+ * feature may be generated, in which case it should not be added
+ */
+ float value = (float) i % 2;
+ SequenceFeature feature = new SequenceFeature("Pfam", "", from, to,
+ value, "group");
+
+ /*
+ * add to NCList - with duplicate entries (by equals) disallowed
+ */
+ ncl.add(feature, false);
+ if (features.contains(feature))
+ {
+ System.out.println("Duplicate feature generated "
+ + feature.toString());
+ }
+ else
+ {
+ features.add(feature);
+ count++;
+ }
+
+ /*
+ * check list format is valid at each stage of its construction
+ */
+ assertTrue(ncl.isValid(),
+ String.format("Failed for scale = %d, i=%d", scale, i));
+ assertEquals(ncl.size(), count);
+ }
+ // System.out.println(ncl.prettyPrint());
+ }
+
+ /**
+ * A helper method that generates pseudo-random range queries and veries that
+ * findOverlaps returns the correct matches
+ *
+ * @param ncl
+ * the NCList to query
+ * @param scale
+ * ncl maximal range is [0, scale]
+ * @param features
+ * a list of the ranges stored in ncl
+ */
+ protected void testFindOverlaps_pseudoRandom(NCList<SequenceFeature> ncl,
+ int scale,
+ List<SequenceFeature> features)
+ {
+ int halfScale = scale / 2;
+ int minIterations = 20;
+
+ /*
+ * generates ranges in [-halfScale, scale+halfScale]
+ * - some should be internal to [0, scale] P = 1/4
+ * - some should lie before 0 P = 1/16
+ * - some should lie after scale P = 1/16
+ * - some should overlap left P = 1/4
+ * - some should overlap right P = 1/4
+ * - some should enclose P = 1/8
+ *
+ * 50 iterations give a 96% probability of including the
+ * unlikeliest case; keep going until we have done all!
+ */
+ boolean inside = false;
+ boolean enclosing = false;
+ boolean before = false;
+ boolean after = false;
+ boolean overlapLeft = false;
+ boolean overlapRight = false;
+ boolean allCasesCovered = false;
+
+ int i = 0;
+ while (i < minIterations || !allCasesCovered)
+ {
+ i++;
+ int r1 = random.nextInt((scale + 1) * 2);
+ int r2 = random.nextInt((scale + 1) * 2);
+ int from = Math.min(r1, r2) - halfScale;
+ int to = Math.max(r1, r2) - halfScale;
+
+ /*
+ * ensure all cases of interest get covered
+ */
+ inside |= from >= 0 && to <= scale;
+ enclosing |= from <= 0 && to >= scale;
+ before |= to < 0;
+ after |= from > scale;
+ overlapLeft |= from < 0 && to >= 0 && to <= scale;
+ overlapRight |= from >= 0 && from <= scale && to > scale;
+ if (!allCasesCovered)
+ {
+ allCasesCovered |= inside && enclosing && before && after
+ && overlapLeft && overlapRight;
+ if (allCasesCovered)
+ {
+ System.out
+ .println(String
+ .format("Covered all findOverlaps cases after %d iterations for scale %d",
+ i, scale));
+ }
+ }
+
+ verifyFindOverlaps(ncl, from, to, features);
+ }
+ }
+
+ /**
+ * A helper method that verifies that overlaps found by interrogating an
+ * NCList correctly match those found by brute force search
+ *
+ * @param ncl
+ * @param from
+ * @param to
+ * @param features
+ */
+ protected void verifyFindOverlaps(NCList<SequenceFeature> ncl, int from,
+ int to, List<SequenceFeature> features)
+ {
+ List<SequenceFeature> overlaps = ncl.findOverlaps(from, to);
+
+ /*
+ * check returned entries do indeed overlap from-to range
+ */
+ for (ContiguousI sf : overlaps)
+ {
+ int begin = sf.getBegin();
+ int end = sf.getEnd();
+ assertTrue(begin <= to && end >= from, String.format(
+ "[%d, %d] does not overlap query range [%d, %d]", begin, end,
+ from, to));
+ }
+
+ /*
+ * check overlapping ranges are included in the results
+ * (the test above already shows non-overlapping ranges are not)
+ */
+ for (ContiguousI sf : features)
+ {
+ int begin = sf.getBegin();
+ int end = sf.getEnd();
+ if (begin <= to && end >= from)
+ {
+ boolean found = overlaps.contains(sf);
+ assertTrue(found, String.format(
+ "[%d, %d] missing in query range [%d, %d]", begin, end,
+ from, to));
+ }
+ }
+ }
+
+ @Test(groups = "Functional")
+ public void testGetEntries()
+ {
+ List<Range> ranges = new ArrayList<Range>();
+ Range r1 = new Range(20, 20);
+ Range r2 = new Range(10, 20);
+ Range r3 = new Range(15, 30);
+ Range r4 = new Range(10, 30);
+ Range r5 = new Range(11, 19);
+ Range r6 = new Range(10, 20);
+ ranges.add(r1);
+ ranges.add(r2);
+ ranges.add(r3);
+ ranges.add(r4);
+ ranges.add(r5);
+ ranges.add(r6);
+
+ NCList<Range> ncl = new NCList<Range>(ranges);
+ Range r7 = new Range(1, 100);
+ ncl.add(r7);
+
+ List<Range> contents = ncl.getEntries();
+ assertEquals(contents.size(), 7);
+ assertTrue(contents.contains(r1));
+ assertTrue(contents.contains(r2));
+ assertTrue(contents.contains(r3));
+ assertTrue(contents.contains(r4));
+ assertTrue(contents.contains(r5));
+ assertTrue(contents.contains(r6));
+ assertTrue(contents.contains(r7));
+
+ ncl = new NCList<Range>();
+ assertTrue(ncl.getEntries().isEmpty());
+ }
+
+ @Test(groups = "Functional")
+ public void testDelete()
+ {
+ List<Range> ranges = new ArrayList<Range>();
+ Range r1 = new Range(20, 30);
+ ranges.add(r1);
+ NCList<Range> ncl = new NCList<Range>(ranges);
+ assertTrue(ncl.getEntries().contains(r1));
+
+ Range r2 = new Range(20, 30);
+ assertFalse(ncl.delete(null)); // null argument
+ assertFalse(ncl.delete(r2)); // never added
+ assertTrue(ncl.delete(r1)); // success
+ assertTrue(ncl.getEntries().isEmpty());
+
+ /*
+ * tests where object.equals() == true
+ */
+ NCList<SequenceFeature> features = new NCList<SequenceFeature>();
+ SequenceFeature sf1 = new SequenceFeature("type", "desc", 1, 10, 2f,
+ "group");
+ SequenceFeature sf2 = new SequenceFeature("type", "desc", 1, 10, 2f,
+ "group");
+ features.add(sf1);
+ assertEquals(sf1, sf2); // sf1.equals(sf2)
+ assertFalse(features.delete(sf2)); // equality is not enough for deletion
+ assertTrue(features.getEntries().contains(sf1)); // still there!
+ assertTrue(features.delete(sf1));
+ assertTrue(features.getEntries().isEmpty()); // gone now
+
+ /*
+ * test with duplicate objects in NCList
+ */
+ features.add(sf1);
+ features.add(sf1);
+ assertEquals(features.getEntries().size(), 2);
+ assertSame(features.getEntries().get(0), sf1);
+ assertSame(features.getEntries().get(1), sf1);
+ assertTrue(features.delete(sf1)); // first match only is deleted
+ assertTrue(features.contains(sf1));
+ assertEquals(features.size(), 1);
+ assertTrue(features.delete(sf1));
+ assertTrue(features.getEntries().isEmpty());
+ }
+
+ @Test(groups = "Functional")
+ public void testAdd_overlapping()
+ {
+ List<Range> ranges = new ArrayList<Range>();
+ ranges.add(new Range(40, 50));
+ ranges.add(new Range(20, 30));
+ NCList<Range> ncl = new NCList<Range>(ranges);
+ assertEquals(ncl.toString(), "[20-30, 40-50]");
+ assertTrue(ncl.isValid());
+
+ /*
+ * add range overlapping internally
+ */
+ ncl.add(new Range(25, 35));
+ assertEquals(ncl.toString(), "[20-30, 25-35, 40-50]");
+ assertTrue(ncl.isValid());
+
+ /*
+ * add range overlapping last range
+ */
+ ncl.add(new Range(45, 55));
+ assertEquals(ncl.toString(), "[20-30, 25-35, 40-50, 45-55]");
+ assertTrue(ncl.isValid());
+
+ /*
+ * add range overlapping first range
+ */
+ ncl.add(new Range(15, 25));
+ assertEquals(ncl.toString(), "[15-25, 20-30, 25-35, 40-50, 45-55]");
+ assertTrue(ncl.isValid());
+ }
+
+ /**
+ * Test the contains method (which uses object equals test)
+ */
+ @Test(groups = "Functional")
+ public void testContains()
+ {
+ NCList<SequenceFeature> ncl = new NCList<SequenceFeature>();
+ SequenceFeature sf1 = new SequenceFeature("type", "desc", 1, 10, 2f,
+ "group");
+ SequenceFeature sf2 = new SequenceFeature("type", "desc", 1, 10, 2f,
+ "group");
+ SequenceFeature sf3 = new SequenceFeature("type", "desc", 1, 10, 2f,
+ "anothergroup");
+ ncl.add(sf1);
+
+ assertTrue(ncl.contains(sf1));
+ assertTrue(ncl.contains(sf2)); // sf1.equals(sf2)
+ assertFalse(ncl.contains(sf3)); // !sf1.equals(sf3)
+
+ /*
+ * make some deeper structure in the NCList
+ */
+ SequenceFeature sf4 = new SequenceFeature("type", "desc", 2, 9, 2f,
+ "group");
+ ncl.add(sf4);
+ assertTrue(ncl.contains(sf4));
+ SequenceFeature sf5 = new SequenceFeature("type", "desc", 4, 5, 2f,
+ "group");
+ SequenceFeature sf6 = new SequenceFeature("type", "desc", 6, 8, 2f,
+ "group");
+ ncl.add(sf5);
+ ncl.add(sf6);
+ assertTrue(ncl.contains(sf5));
+ assertTrue(ncl.contains(sf6));
+ }
+
+ @Test(groups = "Functional")
+ public void testIsValid()
+ {
+ List<Range> ranges = new ArrayList<Range>();
+ Range r1 = new Range(40, 50);
+ ranges.add(r1);
+ NCList<Range> ncl = new NCList<Range>(ranges);
+ assertTrue(ncl.isValid());
+
+ Range r2 = new Range(42, 44);
+ ncl.add(r2);
+ assertTrue(ncl.isValid());
+ Range r3 = new Range(46, 48);
+ ncl.add(r3);
+ assertTrue(ncl.isValid());
+ Range r4 = new Range(43, 43);
+ ncl.add(r4);
+ assertTrue(ncl.isValid());
+
+ assertEquals(ncl.toString(), "[40-50 [42-44 [43-43], 46-48]]");
+ assertTrue(ncl.isValid());
+
+ PA.setValue(r1, "start", 43);
+ assertFalse(ncl.isValid()); // r2 not inside r1
+ PA.setValue(r1, "start", 40);
+ assertTrue(ncl.isValid());
+
+ PA.setValue(r3, "start", 41);
+ assertFalse(ncl.isValid()); // r3 should precede r2
+ PA.setValue(r3, "start", 46);
+ assertTrue(ncl.isValid());
+
+ PA.setValue(r4, "start", 41);
+ assertFalse(ncl.isValid()); // r4 not inside r2
+ PA.setValue(r4, "start", 43);
+ assertTrue(ncl.isValid());
+
+ PA.setValue(r4, "start", 44);
+ assertFalse(ncl.isValid()); // r4 has reverse range
+ }
+
+ @Test(groups = "Functional")
+ public void testPrettyPrint()
+ {
+ /*
+ * construct NCList from a list of ranges
+ * they are sorted then assembled into NCList subregions
+ * notice that 42-42 end up inside 41-46
+ */
+ List<Range> ranges = new ArrayList<Range>();
+ ranges.add(new Range(40, 50));
+ ranges.add(new Range(45, 55));
+ ranges.add(new Range(40, 45));
+ ranges.add(new Range(41, 46));
+ ranges.add(new Range(42, 42));
+ ranges.add(new Range(42, 42));
+ NCList<Range> ncl = new NCList<Range>(ranges);
+ assertTrue(ncl.isValid());
+ assertEquals(ncl.toString(),
+ "[40-50 [40-45], 41-46 [42-42 [42-42]], 45-55]");
+ String expected = "40-50\n 40-45\n41-46\n 42-42\n 42-42\n45-55\n";
+ assertEquals(ncl.prettyPrint(), expected);
+
+ /*
+ * repeat but now add ranges one at a time
+ * notice that 42-42 end up inside 40-50 so we get
+ * a different but equal valid NCList structure
+ */
+ ranges.clear();
+ ncl = new NCList<Range>(ranges);
+ ncl.add(new Range(40, 50));
+ ncl.add(new Range(45, 55));
+ ncl.add(new Range(40, 45));
+ ncl.add(new Range(41, 46));
+ ncl.add(new Range(42, 42));
+ ncl.add(new Range(42, 42));
+ assertTrue(ncl.isValid());
+ assertEquals(ncl.toString(),
+ "[40-50 [40-45 [42-42 [42-42]], 41-46], 45-55]");
+ expected = "40-50\n 40-45\n 42-42\n 42-42\n 41-46\n45-55\n";
+ assertEquals(ncl.prettyPrint(), expected);
+ }
+
+ /**
+ * A test that shows different valid trees can be constructed from the same
+ * set of ranges, depending on the order of construction
+ */
+ @Test(groups = "Functional")
+ public void testConstructor_alternativeTrees()
+ {
+ List<Range> ranges = new ArrayList<Range>();
+ ranges.add(new Range(10, 60));
+ ranges.add(new Range(20, 30));
+ ranges.add(new Range(40, 50));
+
+ /*
+ * constructor with greedy traversal of sorted ranges to build nested
+ * containment lists results in 20-30 inside 10-60, 40-50 a sibling
+ */
+ NCList<Range> ncl = new NCList<Range>(ranges);
+ assertEquals(ncl.toString(), "[10-60 [20-30], 40-50]");
+ assertTrue(ncl.isValid());
+
+ /*
+ * adding ranges one at a time results in 40-50
+ * a sibling of 20-30 inside 10-60
+ */
+ ncl = new NCList<Range>(new Range(10, 60));
+ ncl.add(new Range(20, 30));
+ ncl.add(new Range(40, 50));
+ assertEquals(ncl.toString(), "[10-60 [20-30, 40-50]]");
+ assertTrue(ncl.isValid());
+ }
+}
--- /dev/null
+package jalview.datamodel.features;
+
+import static org.testng.Assert.assertEquals;
+import static org.testng.Assert.assertFalse;
+import static org.testng.Assert.assertTrue;
+
+import jalview.datamodel.SequenceFeature;
+
+import java.util.ArrayList;
+import java.util.List;
+
+import junit.extensions.PA;
+
+import org.testng.annotations.Test;
+
+public class NCNodeTest
+{
+ @Test(groups = "Functional")
+ public void testAdd()
+ {
+ Range r1 = new Range(10, 20);
+ NCNode<Range> node = new NCNode<Range>(r1);
+ assertEquals(node.getBegin(), 10);
+ Range r2 = new Range(10, 15);
+ node.add(r2);
+
+ List<Range> contents = new ArrayList<Range>();
+ node.getEntries(contents);
+ assertEquals(contents.size(), 2);
+ assertTrue(contents.contains(r1));
+ assertTrue(contents.contains(r2));
+ }
+
+ @Test(
+ groups = "Functional",
+ expectedExceptions = { IllegalArgumentException.class })
+ public void testAdd_invalidRangeStart()
+ {
+ Range r1 = new Range(10, 20);
+ NCNode<Range> node = new NCNode<Range>(r1);
+ assertEquals(node.getBegin(), 10);
+ Range r2 = new Range(9, 15);
+ node.add(r2);
+ }
+
+ @Test(
+ groups = "Functional",
+ expectedExceptions = { IllegalArgumentException.class })
+ public void testAdd_invalidRangeEnd()
+ {
+ Range r1 = new Range(10, 20);
+ NCNode<Range> node = new NCNode<Range>(r1);
+ assertEquals(node.getBegin(), 10);
+ Range r2 = new Range(12, 21);
+ node.add(r2);
+ }
+
+ @Test(groups = "Functional")
+ public void testGetEntries()
+ {
+ Range r1 = new Range(10, 20);
+ NCNode<Range> node = new NCNode<Range>(r1);
+ List<Range> entries = new ArrayList<Range>();
+
+ node.getEntries(entries);
+ assertEquals(entries.size(), 1);
+ assertTrue(entries.contains(r1));
+
+ // clearing the returned list does not affect the NCNode
+ entries.clear();
+ node.getEntries(entries);
+ assertEquals(entries.size(), 1);
+ assertTrue(entries.contains(r1));
+
+ Range r2 = new Range(15, 18);
+ node.add(r2);
+ entries.clear();
+ node.getEntries(entries);
+ assertEquals(entries.size(), 2);
+ assertTrue(entries.contains(r1));
+ assertTrue(entries.contains(r2));
+ }
+
+ /**
+ * Tests for the contains method (uses entry.equals() test)
+ */
+ @Test(groups = "Functional")
+ public void testContains()
+ {
+ SequenceFeature sf1 = new SequenceFeature("type", "desc", 1, 10, 2f,
+ "group");
+ SequenceFeature sf2 = new SequenceFeature("type", "desc", 1, 10, 2f,
+ "group");
+ SequenceFeature sf3 = new SequenceFeature("type", "desc", 1, 10, 2f,
+ "anothergroup");
+ NCNode<SequenceFeature> node = new NCNode<SequenceFeature>(sf1);
+
+ assertFalse(node.contains(null));
+ assertTrue(node.contains(sf1));
+ assertTrue(node.contains(sf2)); // sf1.equals(sf2)
+ assertFalse(node.contains(sf3)); // !sf1.equals(sf3)
+ }
+
+ /**
+ * Test method that checks for valid structure. Valid means that all
+ * subregions (if any) lie within the root range, and that all subregions have
+ * valid structure.
+ */
+ @Test(groups = "Functional")
+ public void testIsValid()
+ {
+ Range r1 = new Range(10, 20);
+ Range r2 = new Range(14, 15);
+ Range r3 = new Range(16, 17);
+ NCNode<Range> node = new NCNode<Range>(r1);
+ node.add(r2);
+ node.add(r3);
+
+ /*
+ * node has root range [10-20] and contains an
+ * NCList of [14-15, 16-17]
+ */
+ assertTrue(node.isValid());
+ PA.setValue(r1, "start", 15);
+ assertFalse(node.isValid()); // r2 not within r1
+ PA.setValue(r1, "start", 10);
+ assertTrue(node.isValid());
+ PA.setValue(r1, "end", 16);
+ assertFalse(node.isValid()); // r3 not within r1
+ PA.setValue(r1, "end", 20);
+ assertTrue(node.isValid());
+ PA.setValue(r3, "start", 12);
+ assertFalse(node.isValid()); // r3 should precede r2
+ }
+}
--- /dev/null
+package jalview.datamodel.features;
+
+import static org.testng.Assert.assertEquals;
+
+import java.util.Comparator;
+
+import org.testng.annotations.Test;
+
+public class RangeComparatorTest
+{
+
+ @Test(groups = "Functional")
+ public void testCompare()
+ {
+ RangeComparator comp = new RangeComparator(true);
+
+ // same position, same length
+ assertEquals(comp.compare(10, 10, 20, 20), 0);
+ // same position, len1 > len2
+ assertEquals(comp.compare(10, 10, 20, 19), -1);
+ // same position, len1 < len2
+ assertEquals(comp.compare(10, 10, 20, 21), 1);
+ // pos1 > pos2
+ assertEquals(comp.compare(11, 10, 20, 20), 1);
+ // pos1 < pos2
+ assertEquals(comp.compare(10, 11, 20, 10), -1);
+ }
+
+ @Test(groups = "Functional")
+ public void testCompare_byStart()
+ {
+ Comparator<ContiguousI> comp = RangeComparator.BY_START_POSITION;
+
+ // same start position, same length
+ assertEquals(comp.compare(new Range(10, 20), new Range(10, 20)), 0);
+ // same start position, len1 > len2
+ assertEquals(comp.compare(new Range(10, 20), new Range(10, 19)), -1);
+ // same start position, len1 < len2
+ assertEquals(comp.compare(new Range(10, 18), new Range(10, 20)), 1);
+ // pos1 > pos2
+ assertEquals(comp.compare(new Range(11, 20), new Range(10, 20)), 1);
+ // pos1 < pos2
+ assertEquals(comp.compare(new Range(10, 20), new Range(11, 20)), -1);
+ }
+
+ @Test(groups = "Functional")
+ public void testCompare_byEnd()
+ {
+ Comparator<ContiguousI> comp = RangeComparator.BY_END_POSITION;
+
+ // same end position, same length
+ assertEquals(comp.compare(new Range(10, 20), new Range(10, 20)), 0);
+ // same end position, len1 > len2
+ assertEquals(comp.compare(new Range(10, 20), new Range(11, 20)), -1);
+ // same end position, len1 < len2
+ assertEquals(comp.compare(new Range(11, 20), new Range(10, 20)), 1);
+ // end1 > end2
+ assertEquals(comp.compare(new Range(10, 21), new Range(10, 20)), 1);
+ // end1 < end2
+ assertEquals(comp.compare(new Range(10, 20), new Range(10, 21)), -1);
+ }
+}
--- /dev/null
+package jalview.datamodel.features;
+
+import static org.testng.Assert.assertEquals;
+import static org.testng.Assert.assertFalse;
+import static org.testng.Assert.assertSame;
+import static org.testng.Assert.assertTrue;
+
+import jalview.datamodel.SequenceFeature;
+
+import java.util.ArrayList;
+import java.util.Iterator;
+import java.util.List;
+import java.util.Set;
+
+import org.testng.annotations.Test;
+
+public class SequenceFeaturesTest
+{
+ @Test(groups = "Functional")
+ public void testGetPositionalFeatures()
+ {
+ SequenceFeaturesI store = new SequenceFeatures();
+ SequenceFeature sf1 = new SequenceFeature("Metal", "desc", 10, 20,
+ Float.NaN, null);
+ store.add(sf1);
+ // same range, different description
+ SequenceFeature sf2 = new SequenceFeature("Metal", "desc2", 10, 20,
+ Float.NaN, null);
+ store.add(sf2);
+ // discontiguous range
+ SequenceFeature sf3 = new SequenceFeature("Metal", "desc", 30, 40,
+ Float.NaN, null);
+ store.add(sf3);
+ // overlapping range
+ SequenceFeature sf4 = new SequenceFeature("Metal", "desc", 15, 35,
+ Float.NaN, null);
+ store.add(sf4);
+ // enclosing range
+ SequenceFeature sf5 = new SequenceFeature("Metal", "desc", 5, 50,
+ Float.NaN, null);
+ store.add(sf5);
+ // non-positional feature
+ SequenceFeature sf6 = new SequenceFeature("Metal", "desc", 0, 0,
+ Float.NaN, null);
+ store.add(sf6);
+ // contact feature
+ SequenceFeature sf7 = new SequenceFeature("Disulphide bond", "desc",
+ 18, 45, Float.NaN, null);
+ store.add(sf7);
+ // different feature type
+ SequenceFeature sf8 = new SequenceFeature("Pfam", "desc", 30, 40,
+ Float.NaN, null);
+ store.add(sf8);
+ SequenceFeature sf9 = new SequenceFeature("Pfam", "desc", 15, 35,
+ Float.NaN, null);
+ store.add(sf9);
+
+ /*
+ * get all positional features
+ */
+ List<SequenceFeature> features = store.getPositionalFeatures();
+ assertEquals(features.size(), 8);
+ assertTrue(features.contains(sf1));
+ assertTrue(features.contains(sf2));
+ assertTrue(features.contains(sf3));
+ assertTrue(features.contains(sf4));
+ assertTrue(features.contains(sf5));
+ assertFalse(features.contains(sf6)); // non-positional
+ assertTrue(features.contains(sf7));
+ assertTrue(features.contains(sf8));
+ assertTrue(features.contains(sf9));
+
+ /*
+ * get features by type
+ */
+ assertTrue(store.getPositionalFeatures((String) null).isEmpty());
+ assertTrue(store.getPositionalFeatures("Cath").isEmpty());
+ assertTrue(store.getPositionalFeatures("METAL").isEmpty());
+
+ features = store.getPositionalFeatures("Metal");
+ assertEquals(features.size(), 5);
+ assertTrue(features.contains(sf1));
+ assertTrue(features.contains(sf2));
+ assertTrue(features.contains(sf3));
+ assertTrue(features.contains(sf4));
+ assertTrue(features.contains(sf5));
+ assertFalse(features.contains(sf6));
+
+ features = store.getPositionalFeatures("Disulphide bond");
+ assertEquals(features.size(), 1);
+ assertTrue(features.contains(sf7));
+
+ features = store.getPositionalFeatures("Pfam");
+ assertEquals(features.size(), 2);
+ assertTrue(features.contains(sf8));
+ assertTrue(features.contains(sf9));
+ }
+
+ @Test(groups = "Functional")
+ public void testGetContactFeatures()
+ {
+ SequenceFeaturesI store = new SequenceFeatures();
+ // non-contact
+ SequenceFeature sf1 = new SequenceFeature("Metal", "desc", 10, 20,
+ Float.NaN, null);
+ store.add(sf1);
+ // non-positional
+ SequenceFeature sf2 = new SequenceFeature("Metal", "desc", 0, 0,
+ Float.NaN, null);
+ store.add(sf2);
+ // contact feature
+ SequenceFeature sf3 = new SequenceFeature("Disulphide bond", "desc",
+ 18, 45, Float.NaN, null);
+ store.add(sf3);
+ // repeat for different feature type
+ SequenceFeature sf4 = new SequenceFeature("Pfam", "desc", 10, 20,
+ Float.NaN, null);
+ store.add(sf4);
+ SequenceFeature sf5 = new SequenceFeature("Pfam", "desc", 0, 0,
+ Float.NaN, null);
+ store.add(sf5);
+ SequenceFeature sf6 = new SequenceFeature("Disulfide bond", "desc", 18,
+ 45, Float.NaN, null);
+ store.add(sf6);
+
+ /*
+ * get all contact features
+ */
+ List<SequenceFeature> features = store.getContactFeatures();
+ assertEquals(features.size(), 2);
+ assertTrue(features.contains(sf3));
+ assertTrue(features.contains(sf6));
+
+ /*
+ * get contact features by type
+ */
+ assertTrue(store.getContactFeatures((String) null).isEmpty());
+ assertTrue(store.getContactFeatures("Cath").isEmpty());
+ assertTrue(store.getContactFeatures("Pfam").isEmpty());
+ assertTrue(store.getContactFeatures("DISULPHIDE BOND").isEmpty());
+
+ features = store.getContactFeatures("Disulphide bond");
+ assertEquals(features.size(), 1);
+ assertTrue(features.contains(sf3));
+
+ features = store.getContactFeatures("Disulfide bond");
+ assertEquals(features.size(), 1);
+ assertTrue(features.contains(sf6));
+ }
+
+ @Test(groups = "Functional")
+ public void testGetNonPositionalFeatures()
+ {
+ SequenceFeaturesI store = new SequenceFeatures();
+ // positional
+ SequenceFeature sf1 = new SequenceFeature("Metal", "desc", 10, 20,
+ Float.NaN, null);
+ store.add(sf1);
+ // non-positional
+ SequenceFeature sf2 = new SequenceFeature("Metal", "desc", 0, 0,
+ Float.NaN, null);
+ store.add(sf2);
+ // contact feature
+ SequenceFeature sf3 = new SequenceFeature("Disulphide bond", "desc",
+ 18, 45, Float.NaN, null);
+ store.add(sf3);
+ // repeat for different feature type
+ SequenceFeature sf4 = new SequenceFeature("Pfam", "desc", 10, 20,
+ Float.NaN, null);
+ store.add(sf4);
+ SequenceFeature sf5 = new SequenceFeature("Pfam", "desc", 0, 0,
+ Float.NaN, null);
+ store.add(sf5);
+ SequenceFeature sf6 = new SequenceFeature("Disulfide bond", "desc", 18,
+ 45, Float.NaN, null);
+ store.add(sf6);
+ // one more non-positional, different description
+ SequenceFeature sf7 = new SequenceFeature("Pfam", "desc2", 0, 0,
+ Float.NaN, null);
+ store.add(sf7);
+
+ /*
+ * get all non-positional features
+ */
+ List<SequenceFeature> features = store.getNonPositionalFeatures();
+ assertEquals(features.size(), 3);
+ assertTrue(features.contains(sf2));
+ assertTrue(features.contains(sf5));
+ assertTrue(features.contains(sf7));
+
+ /*
+ * get non-positional features by type
+ */
+ assertTrue(store.getNonPositionalFeatures((String) null).isEmpty());
+ assertTrue(store.getNonPositionalFeatures("Cath").isEmpty());
+ assertTrue(store.getNonPositionalFeatures("PFAM").isEmpty());
+
+ features = store.getNonPositionalFeatures("Metal");
+ assertEquals(features.size(), 1);
+ assertTrue(features.contains(sf2));
+
+ features = store.getNonPositionalFeatures("Pfam");
+ assertEquals(features.size(), 2);
+ assertTrue(features.contains(sf5));
+ assertTrue(features.contains(sf7));
+ }
+
+ /**
+ * Helper method to add a feature of no particular type
+ *
+ * @param sf
+ * @param type
+ * @param from
+ * @param to
+ * @return
+ */
+ SequenceFeature addFeature(SequenceFeaturesI sf, String type, int from,
+ int to)
+ {
+ SequenceFeature sf1 = new SequenceFeature(type, "", from, to,
+ Float.NaN,
+ null);
+ sf.add(sf1);
+ return sf1;
+ }
+
+ @Test(groups = "Functional")
+ public void testFindFeatures()
+ {
+ SequenceFeaturesI sf = new SequenceFeatures();
+ SequenceFeature sf1 = addFeature(sf, "Pfam", 10, 50);
+ SequenceFeature sf2 = addFeature(sf, "Pfam", 1, 15);
+ SequenceFeature sf3 = addFeature(sf, "Pfam", 20, 30);
+ SequenceFeature sf4 = addFeature(sf, "Pfam", 40, 100);
+ SequenceFeature sf5 = addFeature(sf, "Pfam", 60, 100);
+ SequenceFeature sf6 = addFeature(sf, "Pfam", 70, 70);
+ SequenceFeature sf7 = addFeature(sf, "Cath", 10, 50);
+ SequenceFeature sf8 = addFeature(sf, "Cath", 1, 15);
+ SequenceFeature sf9 = addFeature(sf, "Cath", 20, 30);
+ SequenceFeature sf10 = addFeature(sf, "Cath", 40, 100);
+ SequenceFeature sf11 = addFeature(sf, "Cath", 60, 100);
+ SequenceFeature sf12 = addFeature(sf, "Cath", 70, 70);
+
+ List<SequenceFeature> overlaps = sf.findFeatures(200, 200, "Pfam");
+ assertTrue(overlaps.isEmpty());
+
+ overlaps = sf.findFeatures( 1, 9, "Pfam");
+ assertEquals(overlaps.size(), 1);
+ assertTrue(overlaps.contains(sf2));
+
+ overlaps = sf.findFeatures( 5, 18, "Pfam");
+ assertEquals(overlaps.size(), 2);
+ assertTrue(overlaps.contains(sf1));
+ assertTrue(overlaps.contains(sf2));
+
+ overlaps = sf.findFeatures(30, 40, "Pfam");
+ assertEquals(overlaps.size(), 3);
+ assertTrue(overlaps.contains(sf1));
+ assertTrue(overlaps.contains(sf3));
+ assertTrue(overlaps.contains(sf4));
+
+ overlaps = sf.findFeatures( 80, 90, "Pfam");
+ assertEquals(overlaps.size(), 2);
+ assertTrue(overlaps.contains(sf4));
+ assertTrue(overlaps.contains(sf5));
+
+ overlaps = sf.findFeatures( 68, 70, "Pfam");
+ assertEquals(overlaps.size(), 3);
+ assertTrue(overlaps.contains(sf4));
+ assertTrue(overlaps.contains(sf5));
+ assertTrue(overlaps.contains(sf6));
+
+ overlaps = sf.findFeatures(16, 69, "Cath");
+ assertEquals(overlaps.size(), 4);
+ assertTrue(overlaps.contains(sf7));
+ assertFalse(overlaps.contains(sf8));
+ assertTrue(overlaps.contains(sf9));
+ assertTrue(overlaps.contains(sf10));
+ assertTrue(overlaps.contains(sf11));
+ assertFalse(overlaps.contains(sf12));
+
+ assertTrue(sf.findFeatures(0, 1000, "Metal").isEmpty());
+
+ overlaps = sf.findFeatures(7, 7, (String) null);
+ assertTrue(overlaps.isEmpty());
+ }
+
+ @Test(groups = "Functional")
+ public void testDelete()
+ {
+ SequenceFeaturesI sf = new SequenceFeatures();
+ SequenceFeature sf1 = addFeature(sf, "Pfam", 10, 50);
+ assertTrue(sf.getPositionalFeatures().contains(sf1));
+
+ assertFalse(sf.delete(null));
+ SequenceFeature sf2 = new SequenceFeature("Cath", "", 10, 15, 0f, null);
+ assertFalse(sf.delete(sf2)); // not added, can't delete it
+ assertTrue(sf.delete(sf1));
+ assertTrue(sf.getPositionalFeatures().isEmpty());
+ }
+
+ @Test(groups = "Functional")
+ public void testHasFeatures()
+ {
+ SequenceFeaturesI sf = new SequenceFeatures();
+ assertFalse(sf.hasFeatures());
+
+ SequenceFeature sf1 = addFeature(sf, "Pfam", 10, 50);
+ assertTrue(sf.hasFeatures());
+
+ sf.delete(sf1);
+ assertFalse(sf.hasFeatures());
+ }
+
+ /**
+ * Tests for the method that gets feature groups for positional or
+ * non-positional features
+ */
+ @Test(groups = "Functional")
+ public void testGetFeatureGroups()
+ {
+ SequenceFeaturesI sf = new SequenceFeatures();
+ assertTrue(sf.getFeatureGroups(true).isEmpty());
+ assertTrue(sf.getFeatureGroups(false).isEmpty());
+
+ /*
+ * add a non-positional feature (begin/end = 0/0)
+ */
+ SequenceFeature sfx = new SequenceFeature("AType", "Desc", 0, 0, 0f,
+ "AGroup");
+ sf.add(sfx);
+ Set<String> groups = sf.getFeatureGroups(true); // for positional
+ assertTrue(groups.isEmpty());
+ groups = sf.getFeatureGroups(false); // for non-positional
+ assertEquals(groups.size(), 1);
+ assertTrue(groups.contains("AGroup"));
+
+ /*
+ * add, then delete, more non-positional features of different types
+ */
+ SequenceFeature sfy = new SequenceFeature("AnotherType", "Desc", 0, 0,
+ 0f,
+ "AnotherGroup");
+ sf.add(sfy);
+ SequenceFeature sfz = new SequenceFeature("AThirdType", "Desc", 0, 0,
+ 0f,
+ null);
+ sf.add(sfz);
+ groups = sf.getFeatureGroups(false);
+ assertEquals(groups.size(), 3);
+ assertTrue(groups.contains("AGroup"));
+ assertTrue(groups.contains("AnotherGroup"));
+ assertTrue(groups.contains(null)); // null is a possible group
+ sf.delete(sfz);
+ sf.delete(sfy);
+ groups = sf.getFeatureGroups(false);
+ assertEquals(groups.size(), 1);
+ assertTrue(groups.contains("AGroup"));
+
+ /*
+ * add positional features
+ */
+ SequenceFeature sf1 = new SequenceFeature("Pfam", "Desc", 10, 50, 0f,
+ "PfamGroup");
+ sf.add(sf1);
+ groups = sf.getFeatureGroups(true);
+ assertEquals(groups.size(), 1);
+ assertTrue(groups.contains("PfamGroup"));
+ groups = sf.getFeatureGroups(false); // non-positional unchanged
+ assertEquals(groups.size(), 1);
+ assertTrue(groups.contains("AGroup"));
+
+ SequenceFeature sf2 = new SequenceFeature("Cath", "Desc", 10, 50, 0f,
+ null);
+ sf.add(sf2);
+ groups = sf.getFeatureGroups(true);
+ assertEquals(groups.size(), 2);
+ assertTrue(groups.contains("PfamGroup"));
+ assertTrue(groups.contains(null));
+
+ sf.delete(sf1);
+ sf.delete(sf2);
+ assertTrue(sf.getFeatureGroups(true).isEmpty());
+
+ SequenceFeature sf3 = new SequenceFeature("CDS", "", 10, 50, 0f,
+ "Ensembl");
+ sf.add(sf3);
+ SequenceFeature sf4 = new SequenceFeature("exon", "", 10, 50, 0f,
+ "Ensembl");
+ sf.add(sf4);
+ groups = sf.getFeatureGroups(true);
+ assertEquals(groups.size(), 1);
+ assertTrue(groups.contains("Ensembl"));
+
+ /*
+ * delete last Ensembl group feature from CDS features
+ * but still have one in exon features
+ */
+ sf.delete(sf3);
+ groups = sf.getFeatureGroups(true);
+ assertEquals(groups.size(), 1);
+ assertTrue(groups.contains("Ensembl"));
+
+ /*
+ * delete the last non-positional feature
+ */
+ sf.delete(sfx);
+ groups = sf.getFeatureGroups(false);
+ assertTrue(groups.isEmpty());
+ }
+
+ @Test(groups = "Functional")
+ public void testGetFeatureTypesForGroups()
+ {
+ SequenceFeaturesI sf = new SequenceFeatures();
+ assertTrue(sf.getFeatureTypesForGroups(true, (String) null).isEmpty());
+
+ /*
+ * add feature with group = "Uniprot", type = "helix"
+ */
+ String groupUniprot = "Uniprot";
+ SequenceFeature sf1 = new SequenceFeature("helix", "Desc", 10, 50, 0f,
+ groupUniprot);
+ sf.add(sf1);
+ Set<String> groups = sf.getFeatureTypesForGroups(true, groupUniprot);
+ assertEquals(groups.size(), 1);
+ assertTrue(groups.contains("helix"));
+ assertTrue(sf.getFeatureTypesForGroups(true, (String) null).isEmpty());
+
+ /*
+ * add feature with group = "Uniprot", type = "strand"
+ */
+ SequenceFeature sf2 = new SequenceFeature("strand", "Desc", 10, 50, 0f,
+ groupUniprot);
+ sf.add(sf2);
+ groups = sf.getFeatureTypesForGroups(true, groupUniprot);
+ assertEquals(groups.size(), 2);
+ assertTrue(groups.contains("helix"));
+ assertTrue(groups.contains("strand"));
+
+ /*
+ * delete the "strand" Uniprot feature - still have "helix"
+ */
+ sf.delete(sf2);
+ groups = sf.getFeatureTypesForGroups(true, groupUniprot);
+ assertEquals(groups.size(), 1);
+ assertTrue(groups.contains("helix"));
+
+ /*
+ * delete the "helix" Uniprot feature - none left
+ */
+ sf.delete(sf1);
+ assertTrue(sf.getFeatureTypesForGroups(true, groupUniprot).isEmpty());
+
+ /*
+ * add some null group features
+ */
+ SequenceFeature sf3 = new SequenceFeature("strand", "Desc", 10, 50, 0f,
+ null);
+ sf.add(sf3);
+ SequenceFeature sf4 = new SequenceFeature("turn", "Desc", 10, 50, 0f,
+ null);
+ sf.add(sf4);
+ groups = sf.getFeatureTypesForGroups(true, (String) null);
+ assertEquals(groups.size(), 2);
+ assertTrue(groups.contains("strand"));
+ assertTrue(groups.contains("turn"));
+
+ /*
+ * add strand/Cath and turn/Scop and query for one or both groups
+ * (find feature types for groups selected in Feature Settings)
+ */
+ SequenceFeature sf5 = new SequenceFeature("strand", "Desc", 10, 50, 0f,
+ "Cath");
+ sf.add(sf5);
+ SequenceFeature sf6 = new SequenceFeature("turn", "Desc", 10, 50, 0f,
+ "Scop");
+ sf.add(sf6);
+ groups = sf.getFeatureTypesForGroups(true, "Cath");
+ assertEquals(groups.size(), 1);
+ assertTrue(groups.contains("strand"));
+ groups = sf.getFeatureTypesForGroups(true, "Scop");
+ assertEquals(groups.size(), 1);
+ assertTrue(groups.contains("turn"));
+ groups = sf.getFeatureTypesForGroups(true, "Cath", "Scop");
+ assertEquals(groups.size(), 2);
+ assertTrue(groups.contains("turn"));
+ assertTrue(groups.contains("strand"));
+ // alternative vararg syntax
+ groups = sf.getFeatureTypesForGroups(true, new String[] { "Cath",
+ "Scop" });
+ assertEquals(groups.size(), 2);
+ assertTrue(groups.contains("turn"));
+ assertTrue(groups.contains("strand"));
+ }
+
+ @Test(groups = "Functional")
+ public void testGetFeatureTypes()
+ {
+ SequenceFeaturesI store = new SequenceFeatures();
+ Set<String> types = store.getFeatureTypes();
+ assertTrue(types.isEmpty());
+
+ SequenceFeature sf1 = new SequenceFeature("Metal", "desc", 10, 20,
+ Float.NaN, null);
+ store.add(sf1);
+ types = store.getFeatureTypes();
+ assertEquals(types.size(), 1);
+ assertTrue(types.contains("Metal"));
+
+ // null type is rejected...
+ SequenceFeature sf2 = new SequenceFeature(null, "desc", 10, 20,
+ Float.NaN, null);
+ assertFalse(store.add(sf2));
+ types = store.getFeatureTypes();
+ assertEquals(types.size(), 1);
+ assertFalse(types.contains(null));
+ assertTrue(types.contains("Metal"));
+
+ /*
+ * add non-positional feature
+ */
+ SequenceFeature sf3 = new SequenceFeature("Pfam", "desc", 0, 0,
+ Float.NaN, null);
+ store.add(sf3);
+ types = store.getFeatureTypes();
+ assertEquals(types.size(), 2);
+ assertTrue(types.contains("Pfam"));
+
+ /*
+ * add contact feature
+ */
+ SequenceFeature sf4 = new SequenceFeature("Disulphide Bond", "desc",
+ 10, 20, Float.NaN, null);
+ store.add(sf4);
+ types = store.getFeatureTypes();
+ assertEquals(types.size(), 3);
+ assertTrue(types.contains("Disulphide Bond"));
+
+ /*
+ * add another Pfam
+ */
+ SequenceFeature sf5 = new SequenceFeature("Pfam", "desc", 10, 20,
+ Float.NaN, null);
+ store.add(sf5);
+ types = store.getFeatureTypes();
+ assertEquals(types.size(), 3); // unchanged
+
+ /*
+ * delete first Pfam - still have one
+ */
+ assertTrue(store.delete(sf3));
+ types = store.getFeatureTypes();
+ assertEquals(types.size(), 3);
+ assertTrue(types.contains("Pfam"));
+
+ /*
+ * delete second Pfam - no longer have one
+ */
+ assertTrue(store.delete(sf5));
+ types = store.getFeatureTypes();
+ assertEquals(types.size(), 2);
+ assertFalse(types.contains("Pfam"));
+ }
+
+ @Test(groups = "Functional")
+ public void testGetFeatureCount()
+ {
+ SequenceFeaturesI store = new SequenceFeatures();
+ assertEquals(store.getFeatureCount(true), 0);
+ assertEquals(store.getFeatureCount(false), 0);
+
+ /*
+ * add positional
+ */
+ SequenceFeature sf1 = new SequenceFeature("Metal", "desc", 10, 20,
+ Float.NaN, null);
+ store.add(sf1);
+ assertEquals(store.getFeatureCount(true), 1);
+ assertEquals(store.getFeatureCount(false), 0);
+
+ /*
+ * null feature type is rejected
+ */
+ SequenceFeature sf2 = new SequenceFeature(null, "desc", 10, 20,
+ Float.NaN, null);
+ assertFalse(store.add(sf2));
+ assertEquals(store.getFeatureCount(true), 1);
+ assertEquals(store.getFeatureCount(false), 0);
+
+ /*
+ * add non-positional feature
+ */
+ SequenceFeature sf3 = new SequenceFeature("Pfam", "desc", 0, 0,
+ Float.NaN, null);
+ store.add(sf3);
+ assertEquals(store.getFeatureCount(true), 1);
+ assertEquals(store.getFeatureCount(false), 1);
+
+ /*
+ * add contact feature (counts as 1)
+ */
+ SequenceFeature sf4 = new SequenceFeature("Disulphide Bond", "desc",
+ 10, 20, Float.NaN, null);
+ store.add(sf4);
+ assertEquals(store.getFeatureCount(true), 2);
+ assertEquals(store.getFeatureCount(false), 1);
+
+ /*
+ * add another Pfam but this time as a positional feature
+ */
+ SequenceFeature sf5 = new SequenceFeature("Pfam", "desc", 10, 20,
+ Float.NaN, null);
+ store.add(sf5);
+ assertEquals(store.getFeatureCount(true), 3); // sf1, sf4, sf5
+ assertEquals(store.getFeatureCount(false), 1); // sf3
+ assertEquals(store.getFeatureCount(true, "Pfam"), 1); // positional
+ assertEquals(store.getFeatureCount(false, "Pfam"), 1); // non-positional
+ // search for type==null
+ assertEquals(store.getFeatureCount(true, (String) null), 0);
+ // search with no type specified
+ assertEquals(store.getFeatureCount(true, (String[]) null), 3);
+ assertEquals(store.getFeatureCount(true, "Metal", "Cath"), 1);
+ assertEquals(store.getFeatureCount(true, "Disulphide Bond"), 1);
+ assertEquals(store.getFeatureCount(true, "Metal", "Pfam", null), 2);
+
+ /*
+ * delete first Pfam (non-positional)
+ */
+ assertTrue(store.delete(sf3));
+ assertEquals(store.getFeatureCount(true), 3);
+ assertEquals(store.getFeatureCount(false), 0);
+
+ /*
+ * delete second Pfam (positional)
+ */
+ assertTrue(store.delete(sf5));
+ assertEquals(store.getFeatureCount(true), 2);
+ assertEquals(store.getFeatureCount(false), 0);
+ }
+
+ @Test(groups = "Functional")
+ public void testGetAllFeatures()
+ {
+ SequenceFeaturesI store = new SequenceFeatures();
+ List<SequenceFeature> features = store.getAllFeatures();
+ assertTrue(features.isEmpty());
+
+ SequenceFeature sf1 = new SequenceFeature("Metal", "desc", 10, 20,
+ Float.NaN, null);
+ store.add(sf1);
+ features = store.getAllFeatures();
+ assertEquals(features.size(), 1);
+ assertTrue(features.contains(sf1));
+
+ SequenceFeature sf2 = new SequenceFeature("Metallic", "desc", 10, 20,
+ Float.NaN, null);
+ store.add(sf2);
+ features = store.getAllFeatures();
+ assertEquals(features.size(), 2);
+ assertTrue(features.contains(sf2));
+
+ /*
+ * add non-positional feature
+ */
+ SequenceFeature sf3 = new SequenceFeature("Pfam", "desc", 0, 0,
+ Float.NaN, null);
+ store.add(sf3);
+ features = store.getAllFeatures();
+ assertEquals(features.size(), 3);
+ assertTrue(features.contains(sf3));
+
+ /*
+ * add contact feature
+ */
+ SequenceFeature sf4 = new SequenceFeature("Disulphide Bond", "desc",
+ 10, 20, Float.NaN, null);
+ store.add(sf4);
+ features = store.getAllFeatures();
+ assertEquals(features.size(), 4);
+ assertTrue(features.contains(sf4));
+
+ /*
+ * add another Pfam
+ */
+ SequenceFeature sf5 = new SequenceFeature("Pfam", "desc", 10, 20,
+ Float.NaN, null);
+ store.add(sf5);
+ features = store.getAllFeatures();
+ assertEquals(features.size(), 5);
+ assertTrue(features.contains(sf5));
+
+ /*
+ * select by type does not apply to non-positional features
+ */
+ features = store.getAllFeatures("Cath");
+ assertEquals(features.size(), 1);
+ assertTrue(features.contains(sf3));
+
+ features = store.getAllFeatures("Pfam", "Cath", "Metal");
+ assertEquals(features.size(), 3);
+ assertTrue(features.contains(sf1));
+ assertTrue(features.contains(sf3));
+ assertTrue(features.contains(sf5));
+
+ /*
+ * delete first Pfam
+ */
+ assertTrue(store.delete(sf3));
+ features = store.getAllFeatures();
+ assertEquals(features.size(), 4);
+ assertFalse(features.contains(sf3));
+
+ /*
+ * delete second Pfam
+ */
+ assertTrue(store.delete(sf5));
+ features = store.getAllFeatures();
+ assertEquals(features.size(), 3);
+ assertFalse(features.contains(sf3));
+ }
+
+ @Test(groups = "Functional")
+ public void testGetTotalFeatureLength()
+ {
+ SequenceFeaturesI store = new SequenceFeatures();
+ assertEquals(store.getTotalFeatureLength(), 0);
+
+ SequenceFeature sf1 = new SequenceFeature("Metal", "desc", 10, 20,
+ Float.NaN, null);
+ assertTrue(store.add(sf1));
+ assertEquals(store.getTotalFeatureLength(), 11);
+
+ // re-add does nothing!
+ assertFalse(store.add(sf1));
+ assertEquals(store.getTotalFeatureLength(), 11);
+
+ /*
+ * add non-positional feature
+ */
+ SequenceFeature sf3 = new SequenceFeature("Pfam", "desc", 0, 0,
+ Float.NaN, null);
+ store.add(sf3);
+ assertEquals(store.getTotalFeatureLength(), 11);
+
+ /*
+ * add contact feature - counts 1 to feature length
+ */
+ SequenceFeature sf4 = new SequenceFeature("Disulphide Bond", "desc",
+ 10, 20, Float.NaN, null);
+ store.add(sf4);
+ assertEquals(store.getTotalFeatureLength(), 12);
+
+ /*
+ * add another Pfam
+ */
+ SequenceFeature sf5 = new SequenceFeature("Pfam", "desc", 10, 20,
+ Float.NaN, null);
+ store.add(sf5);
+ assertEquals(store.getTotalFeatureLength(), 23);
+
+ /*
+ * delete features
+ */
+ assertTrue(store.delete(sf3)); // non-positional
+ assertEquals(store.getTotalFeatureLength(), 23); // no change
+
+ assertTrue(store.delete(sf5));
+ assertEquals(store.getTotalFeatureLength(), 12);
+
+ assertTrue(store.delete(sf4)); // contact
+ assertEquals(store.getTotalFeatureLength(), 11);
+
+ assertTrue(store.delete(sf1));
+ assertEquals(store.getTotalFeatureLength(), 0);
+ }
+
+ @Test(groups = "Functional")
+ public void testGetMinimumScore_getMaximumScore()
+ {
+ SequenceFeatures sf = new SequenceFeatures();
+ SequenceFeature sf1 = new SequenceFeature("Metal", "desc", 0, 0,
+ Float.NaN, "group"); // non-positional, no score
+ sf.add(sf1);
+ SequenceFeature sf2 = new SequenceFeature("Cath", "desc", 10, 20,
+ Float.NaN, "group"); // positional, no score
+ sf.add(sf2);
+ SequenceFeature sf3 = new SequenceFeature("Metal", "desc", 10, 20, 1f,
+ "group");
+ sf.add(sf3);
+ SequenceFeature sf4 = new SequenceFeature("Metal", "desc", 12, 16, 4f,
+ "group");
+ sf.add(sf4);
+ SequenceFeature sf5 = new SequenceFeature("Cath", "desc", 0, 0, 11f,
+ "group");
+ sf.add(sf5);
+ SequenceFeature sf6 = new SequenceFeature("Cath", "desc", 0, 0, -7f,
+ "group");
+ sf.add(sf6);
+
+ assertEquals(sf.getMinimumScore("nosuchtype", true), Float.NaN);
+ assertEquals(sf.getMinimumScore("nosuchtype", false), Float.NaN);
+ assertEquals(sf.getMaximumScore("nosuchtype", true), Float.NaN);
+ assertEquals(sf.getMaximumScore("nosuchtype", false), Float.NaN);
+
+ // positional features min-max:
+ assertEquals(sf.getMinimumScore("Metal", true), 1f);
+ assertEquals(sf.getMaximumScore("Metal", true), 4f);
+ assertEquals(sf.getMinimumScore("Cath", true), Float.NaN);
+ assertEquals(sf.getMaximumScore("Cath", true), Float.NaN);
+
+ // non-positional features min-max:
+ assertEquals(sf.getMinimumScore("Cath", false), -7f);
+ assertEquals(sf.getMaximumScore("Cath", false), 11f);
+ assertEquals(sf.getMinimumScore("Metal", false), Float.NaN);
+ assertEquals(sf.getMaximumScore("Metal", false), Float.NaN);
+
+ // delete features; min-max should get recomputed
+ sf.delete(sf6);
+ assertEquals(sf.getMinimumScore("Cath", false), 11f);
+ assertEquals(sf.getMaximumScore("Cath", false), 11f);
+ sf.delete(sf4);
+ assertEquals(sf.getMinimumScore("Metal", true), 1f);
+ assertEquals(sf.getMaximumScore("Metal", true), 1f);
+ sf.delete(sf5);
+ assertEquals(sf.getMinimumScore("Cath", false), Float.NaN);
+ assertEquals(sf.getMaximumScore("Cath", false), Float.NaN);
+ sf.delete(sf3);
+ assertEquals(sf.getMinimumScore("Metal", true), Float.NaN);
+ assertEquals(sf.getMaximumScore("Metal", true), Float.NaN);
+ sf.delete(sf1);
+ sf.delete(sf2);
+ assertFalse(sf.hasFeatures());
+ assertEquals(sf.getMinimumScore("Cath", false), Float.NaN);
+ assertEquals(sf.getMaximumScore("Cath", false), Float.NaN);
+ assertEquals(sf.getMinimumScore("Metal", true), Float.NaN);
+ assertEquals(sf.getMaximumScore("Metal", true), Float.NaN);
+ }
+
+ @Test(groups = "Functional")
+ public void testVarargsToTypes()
+ {
+ SequenceFeatures sf = new SequenceFeatures();
+ sf.add(new SequenceFeature("Metal", "desc", 0, 0, Float.NaN, "group"));
+ sf.add(new SequenceFeature("Cath", "desc", 10, 20, Float.NaN, "group"));
+
+ /*
+ * no type specified - get all types stored
+ * they are returned in keyset (alphabetical) order
+ */
+ Iterable<String> types = sf.varargToTypes();
+ Iterator<String> iterator = types.iterator();
+ assertTrue(iterator.hasNext());
+ assertEquals(iterator.next(), "Cath");
+ assertTrue(iterator.hasNext());
+ assertEquals(iterator.next(), "Metal");
+ assertFalse(iterator.hasNext());
+
+ /*
+ * empty array is the same as no vararg parameter supplied
+ * so treated as all stored types
+ */
+ types = sf.varargToTypes(new String[] {});
+ iterator = types.iterator();
+ assertTrue(iterator.hasNext());
+ assertEquals(iterator.next(), "Cath");
+ assertTrue(iterator.hasNext());
+ assertEquals(iterator.next(), "Metal");
+ assertFalse(iterator.hasNext());
+
+ /*
+ * null type specified; this is passed as vararg
+ * String[1] {null}
+ */
+ types = sf.varargToTypes((String) null);
+ assertFalse(types.iterator().hasNext());
+
+ /*
+ * null types array specified; this is passed as vararg null
+ */
+ types = sf.varargToTypes((String[]) null);
+ iterator = types.iterator();
+ assertTrue(iterator.hasNext());
+ assertEquals(iterator.next(), "Cath");
+ assertTrue(iterator.hasNext());
+ assertEquals(iterator.next(), "Metal");
+ assertFalse(iterator.hasNext());
+
+ /*
+ * one type specified
+ */
+ types = sf.varargToTypes("Metal");
+ iterator = types.iterator();
+ assertTrue(iterator.hasNext());
+ assertEquals(iterator.next(), "Metal");
+ assertFalse(iterator.hasNext());
+
+ /*
+ * two types specified
+ */
+ types = sf.varargToTypes("Metal", "Helix");
+ iterator = types.iterator();
+ assertTrue(iterator.hasNext());
+ assertEquals(iterator.next(), "Metal");
+ assertTrue(iterator.hasNext());
+ assertEquals(iterator.next(), "Helix");
+ assertFalse(iterator.hasNext());
+
+ /*
+ * null type included - should get removed
+ */
+ types = sf.varargToTypes("Metal", null, "Helix");
+ iterator = types.iterator();
+ assertTrue(iterator.hasNext());
+ assertEquals(iterator.next(), "Metal");
+ assertTrue(iterator.hasNext());
+ assertEquals(iterator.next(), "Helix");
+ assertFalse(iterator.hasNext());
+ }
+
+ @Test(groups = "Functional")
+ public void testGetFeatureTypes_byOntology()
+ {
+ SequenceFeaturesI store = new SequenceFeatures();
+
+ SequenceFeature sf1 = new SequenceFeature("transcript", "desc", 10, 20,
+ Float.NaN, null);
+ store.add(sf1);
+ // mRNA isA mature_transcript isA transcript
+ SequenceFeature sf2 = new SequenceFeature("mRNA", "desc", 10, 20,
+ Float.NaN, null);
+ store.add(sf2);
+ // just to prove non-positional feature types are included
+ SequenceFeature sf3 = new SequenceFeature("mRNA", "desc", 0, 0,
+ Float.NaN, null);
+ store.add(sf3);
+ SequenceFeature sf4 = new SequenceFeature("CDS", "desc", 0, 0,
+ Float.NaN, null);
+ store.add(sf4);
+
+ Set<String> types = store.getFeatureTypes("transcript");
+ assertEquals(types.size(), 2);
+ assertTrue(types.contains("transcript"));
+ assertTrue(types.contains("mRNA"));
+
+ // matches include arguments whether SO terms or not
+ types = store.getFeatureTypes("transcript", "CDS");
+ assertEquals(types.size(), 3);
+ assertTrue(types.contains("transcript"));
+ assertTrue(types.contains("mRNA"));
+ assertTrue(types.contains("CDS"));
+
+ types = store.getFeatureTypes("exon");
+ assertTrue(types.isEmpty());
+ }
+
+ @Test(groups = "Functional")
+ public void testGetFeaturesByOntology()
+ {
+ SequenceFeaturesI store = new SequenceFeatures();
+ List<SequenceFeature> features = store.getFeaturesByOntology();
+ assertTrue(features.isEmpty());
+ assertTrue(store.getFeaturesByOntology(new String[] {}).isEmpty());
+ assertTrue(store.getFeaturesByOntology((String[]) null).isEmpty());
+
+ SequenceFeature sf1 = new SequenceFeature("transcript", "desc", 10, 20,
+ Float.NaN, null);
+ store.add(sf1);
+
+ // mRNA isA transcript; added here 'as if' non-positional
+ // just to show that non-positional features are included in results
+ SequenceFeature sf2 = new SequenceFeature("mRNA", "desc", 0, 0,
+ Float.NaN, null);
+ store.add(sf2);
+
+ SequenceFeature sf3 = new SequenceFeature("Pfam", "desc", 30, 40,
+ Float.NaN, null);
+ store.add(sf3);
+
+ features = store.getFeaturesByOntology("transcript");
+ assertEquals(features.size(), 2);
+ assertTrue(features.contains(sf1));
+ assertTrue(features.contains(sf2));
+
+ features = store.getFeaturesByOntology("mRNA");
+ assertEquals(features.size(), 1);
+ assertTrue(features.contains(sf2));
+
+ features = store.getFeaturesByOntology("mRNA", "Pfam");
+ assertEquals(features.size(), 2);
+ assertTrue(features.contains(sf2));
+ assertTrue(features.contains(sf3));
+ }
+
+ @Test(groups = "Functional")
+ public void testSortFeatures()
+ {
+ List<SequenceFeature> sfs = new ArrayList<SequenceFeature>();
+ SequenceFeature sf1 = new SequenceFeature("Pfam", "desc", 30, 80,
+ Float.NaN, null);
+ sfs.add(sf1);
+ SequenceFeature sf2 = new SequenceFeature("Rfam", "desc", 40, 50,
+ Float.NaN, null);
+ sfs.add(sf2);
+ SequenceFeature sf3 = new SequenceFeature("Rfam", "desc", 50, 60,
+ Float.NaN, null);
+ sfs.add(sf3);
+
+ // sort by end position descending
+ SequenceFeatures.sortFeatures(sfs, false);
+ assertSame(sfs.get(0), sf1);
+ assertSame(sfs.get(1), sf3);
+ assertSame(sfs.get(2), sf2);
+
+ // sort by start position ascending
+ SequenceFeatures.sortFeatures(sfs, true);
+ assertSame(sfs.get(0), sf1);
+ assertSame(sfs.get(1), sf2);
+ assertSame(sfs.get(2), sf3);
+ }
+}
import static org.testng.AssertJUnit.assertEquals;
import static org.testng.AssertJUnit.assertFalse;
-import static org.testng.AssertJUnit.assertSame;
import static org.testng.AssertJUnit.assertTrue;
import jalview.api.FeatureSettingsModelI;
genomic.setEnd(50000);
String geneId = "ABC123";
- // gene at (start+10000) length 501
+ // gene at (start+20000) length 501
+ // should be ignored - the first 'gene' found defines the whole range
+ // (note features are found in position order, not addition order)
SequenceFeature sf = new SequenceFeature("gene", "", 20000, 20500, 0f,
null);
sf.setValue("ID", "gene:" + geneId);
genomic.addSequenceFeature(sf);
// gene at (start + 10500) length 101
- // should be ignored - the first 'gene' found defines the whole range
sf = new SequenceFeature("gene", "", 10500, 10600, 0f, null);
sf.setValue("ID", "gene:" + geneId);
sf.setStrand("+");
23);
List<int[]> fromRanges = ranges.getFromRanges();
assertEquals(1, fromRanges.size());
- assertEquals(20000, fromRanges.get(0)[0]);
- assertEquals(20500, fromRanges.get(0)[1]);
+ assertEquals(10500, fromRanges.get(0)[0]);
+ assertEquals(10600, fromRanges.get(0)[1]);
// to range should start from given start numbering
List<int[]> toRanges = ranges.getToRanges();
assertEquals(1, toRanges.size());
assertEquals(23, toRanges.get(0)[0]);
- assertEquals(523, toRanges.get(0)[1]);
+ assertEquals(123, toRanges.get(0)[1]);
}
/**
genomic.setEnd(50000);
String geneId = "ABC123";
- // gene at (start+10000) length 501
+ // gene at (start+20000) length 501
+ // should be ignored - the first 'gene' found defines the whole range
+ // (real data would only have one such feature)
SequenceFeature sf = new SequenceFeature("ncRNA_gene", "", 20000,
20500, 0f, null);
sf.setValue("ID", "gene:" + geneId);
genomic.addSequenceFeature(sf);
// gene at (start + 10500) length 101
- // should be ignored - the first 'gene' found defines the whole range
- // (real data would only have one such feature)
sf = new SequenceFeature("gene", "", 10500, 10600, 0f, null);
sf.setValue("ID", "gene:" + geneId);
sf.setStrand("+");
List<int[]> fromRanges = ranges.getFromRanges();
assertEquals(1, fromRanges.size());
// from range on reverse strand:
- assertEquals(20500, fromRanges.get(0)[0]);
- assertEquals(20000, fromRanges.get(0)[1]);
+ assertEquals(10500, fromRanges.get(0)[0]);
+ assertEquals(10600, fromRanges.get(0)[1]);
// to range should start from given start numbering
List<int[]> toRanges = ranges.getToRanges();
assertEquals(1, toRanges.size());
assertEquals(23, toRanges.get(0)[0]);
- assertEquals(523, toRanges.get(0)[1]);
+ assertEquals(123, toRanges.get(0)[1]);
}
/**
genomic.addSequenceFeature(sf1);
// transcript sub-type feature
- SequenceFeature sf2 = new SequenceFeature("snRNA", "", 20000, 20500,
+ SequenceFeature sf2 = new SequenceFeature("snRNA", "", 21000, 21500,
0f, null);
sf2.setValue("Parent", "gene:" + geneId);
sf2.setValue("transcript_id", "transcript2");
// NMD_transcript_variant treated like transcript in Ensembl
SequenceFeature sf3 = new SequenceFeature("NMD_transcript_variant", "",
- 20000, 20500, 0f, null);
+ 22000, 22500, 0f, null);
sf3.setValue("Parent", "gene:" + geneId);
sf3.setValue("transcript_id", "transcript3");
genomic.addSequenceFeature(sf3);
// transcript for a different gene - ignored
- SequenceFeature sf4 = new SequenceFeature("snRNA", "", 20000, 20500,
+ SequenceFeature sf4 = new SequenceFeature("snRNA", "", 23000, 23500,
0f, null);
sf4.setValue("Parent", "gene:XYZ");
sf4.setValue("transcript_id", "transcript4");
List<SequenceFeature> features = testee.getTranscriptFeatures(geneId,
genomic);
assertEquals(3, features.size());
- assertSame(sf1, features.get(0));
- assertSame(sf2, features.get(1));
- assertSame(sf3, features.get(2));
+ assertTrue(features.contains(sf1));
+ assertTrue(features.contains(sf2));
+ assertTrue(features.contains(sf3));
}
/**
import static org.testng.AssertJUnit.assertEquals;
import static org.testng.AssertJUnit.assertFalse;
+import static org.testng.AssertJUnit.assertSame;
import static org.testng.AssertJUnit.assertTrue;
-import static org.testng.internal.junit.ArrayAsserts.assertArrayEquals;
import jalview.datamodel.Alignment;
import jalview.datamodel.SequenceFeature;
import jalview.datamodel.SequenceI;
+import jalview.datamodel.features.SequenceFeatures;
import jalview.gui.JvOptionPane;
import jalview.io.DataSourceType;
import jalview.io.FastaFile;
import java.lang.reflect.Method;
import java.util.Arrays;
+import java.util.List;
import org.testng.Assert;
import org.testng.annotations.AfterClass;
Alignment ral = new Alignment(sqs);
for (SequenceI tr : trueSqs)
{
+ // 12/05/2017 failing for EnsemblCdna which is returning protein
+ // Ensembl helpdesk ticket 187998
SequenceI[] rseq;
Assert.assertNotNull(
rseq = ral.findSequenceMatch(tr.getName()),
SequenceFeature sf2 = new SequenceFeature("", "", 8, 12, 0f, null);
SequenceFeature sf3 = new SequenceFeature("", "", 8, 13, 0f, null);
SequenceFeature sf4 = new SequenceFeature("", "", 11, 11, 0f, null);
- SequenceFeature[] sfs = new SequenceFeature[] { sf1, sf2, sf3, sf4 };
+ List<SequenceFeature> sfs = Arrays.asList(new SequenceFeature[] { sf1,
+ sf2, sf3, sf4 });
// sort by start position ascending (forward strand)
// sf2 and sf3 tie and should not be reordered by sorting
- EnsemblSeqProxy.sortFeatures(sfs, true);
- assertArrayEquals(new SequenceFeature[] { sf2, sf3, sf1, sf4 }, sfs);
+ SequenceFeatures.sortFeatures(sfs, true);
+ assertSame(sfs.get(0), sf2);
+ assertSame(sfs.get(1), sf3);
+ assertSame(sfs.get(2), sf1);
+ assertSame(sfs.get(3), sf4);
// sort by end position descending (reverse strand)
- EnsemblSeqProxy.sortFeatures(sfs, false);
- assertArrayEquals(new SequenceFeature[] { sf1, sf3, sf2, sf4 }, sfs);
+ SequenceFeatures.sortFeatures(sfs, false);
+ assertSame(sfs.get(0), sf1);
+ assertSame(sfs.get(1), sf3);
+ assertSame(sfs.get(2), sf2);
+ assertSame(sfs.get(3), sf4);
}
}
+ "GAMMA-TURN\tred|0,255,255|20.0|95.0|below|66.0\n"
+ "Pfam\tred\n"
+ "STARTGROUP\tuniprot\n"
+ + "Cath\tFER_CAPAA\t-1\t0\t0\tDomain\n" // non-positional feature
+ "Iron\tFER_CAPAA\t-1\t39\t39\tMETAL\n"
+ "Turn\tFER_CAPAA\t-1\t36\t38\tGAMMA-TURN\n"
+ "<html>Pfam domain<a href=\"http://pfam.xfam.org/family/PF00111\">Pfam_3_4</a></html>\tFER_CAPAA\t-1\t20\t20\tPfam\n"
featuresFile.parse(al.getDataset(), colours, false);
/*
- * first with no features displayed
+ * first with no features displayed, exclude non-positional features
*/
FeatureRenderer fr = af.alignPanel.getFeatureRenderer();
Map<String, FeatureColourI> visible = fr.getDisplayedFeatureCols();
String exported = featuresFile.printJalviewFormat(
- al.getSequencesArray(), visible);
+ al.getSequencesArray(), visible, true, false);
String expected = "No Features Visible";
assertEquals(expected, exported);
/*
+ * include non-positional features
+ */
+ af.getViewport().setShowNPFeats(true);
+ exported = featuresFile.printJalviewFormat(al.getSequencesArray(),
+ visible, true, true);
+ expected = "\nSTARTGROUP\tuniprot\nCath\tFER_CAPAA\t-1\t0\t0\tDomain\t0.0\nENDGROUP\tuniprot\n";
+ assertEquals(expected, exported);
+
+ /*
* set METAL (in uniprot group) and GAMMA-TURN visible, but not Pfam
*/
+ af.getViewport().setShowNPFeats(false);
fr.setVisible("METAL");
fr.setVisible("GAMMA-TURN");
visible = fr.getDisplayedFeatureCols();
exported = featuresFile.printJalviewFormat(al.getSequencesArray(),
- visible);
+ visible, true, false);
expected = "METAL\tcc9900\n"
+ "GAMMA-TURN\tff0000|00ffff|20.0|95.0|below|66.0\n"
+ "\nSTARTGROUP\tuniprot\n"
fr.setVisible("Pfam");
visible = fr.getDisplayedFeatureCols();
exported = featuresFile.printJalviewFormat(al.getSequencesArray(),
- visible);
+ visible, true, false);
/*
* note the order of feature types is uncontrolled - derives from
* FeaturesDisplayed.featuresDisplayed which is a HashSet
import jalview.datamodel.SequenceFeature;
import jalview.datamodel.SequenceGroup;
import jalview.datamodel.SequenceI;
+import jalview.datamodel.features.SequenceFeatures;
import jalview.gui.AlignFrame;
import jalview.gui.JvOptionPane;
import jalview.json.binding.biojson.v1.ColourSchemeMapper;
@BeforeTest(alwaysRun = true)
public void setup() throws Exception
{
+ /*
+ * construct expected values
+ * nb this have to match the data in examples/example.json
+ */
// create and add sequences
Sequence[] seqs = new Sequence[5];
seqs[0] = new Sequence("FER_CAPAN",
// create and add sequence features
SequenceFeature seqFeature2 = new SequenceFeature("feature_x",
- "desciption", "status", 6, 15, "Jalview");
+ "description", "status", 6, 15, "Jalview");
SequenceFeature seqFeature3 = new SequenceFeature("feature_x",
- "desciption", "status", 9, 18, "Jalview");
+ "description", "status", 9, 18, "Jalview");
SequenceFeature seqFeature4 = new SequenceFeature("feature_x",
- "desciption", "status", 9, 18, "Jalview");
+ "description", "status", 9, 18, "Jalview");
+ // non-positional feature:
+ SequenceFeature seqFeature5 = new SequenceFeature("Domain",
+ "My description", "status", 0, 0, "Pfam");
seqs[2].addSequenceFeature(seqFeature2);
seqs[3].addSequenceFeature(seqFeature3);
seqs[4].addSequenceFeature(seqFeature4);
+ seqs[2].addSequenceFeature(seqFeature5);
for (Sequence seq : seqs)
{
return true;
}
- public boolean isSeqMatched(SequenceI expectedSeq, SequenceI actualSeq)
+ boolean isSeqMatched(SequenceI expectedSeq, SequenceI actualSeq)
{
System.out.println("Testing >>> " + actualSeq.getName());
+ actualGrp.getStartRes());
System.out.println(expectedGrp.getEndRes() + " | "
+ actualGrp.getEndRes());
- System.out.println(expectedGrp.cs + " | " + actualGrp.cs);
+ System.out.println(expectedGrp.cs.getColourScheme() + " | "
+ + actualGrp.cs.getColourScheme());
+ boolean colourSchemeMatches = (expectedGrp.cs.getColourScheme() == null && actualGrp.cs
+ .getColourScheme() == null)
+ || expectedGrp.cs.getColourScheme().getClass()
+ .equals(actualGrp.cs.getColourScheme().getClass());
if (expectedGrp.getName().equals(actualGrp.getName())
&& expectedGrp.getColourText() == actualGrp.getColourText()
&& expectedGrp.getDisplayBoxes() == actualGrp.getDisplayBoxes()
&& expectedGrp.getIgnoreGapsConsensus() == actualGrp
.getIgnoreGapsConsensus()
- && (expectedGrp.cs.getClass().equals(actualGrp.cs.getClass()))
+ && colourSchemeMatches
&& expectedGrp.getSequences().size() == actualGrp
.getSequences().size()
&& expectedGrp.getStartRes() == actualGrp.getStartRes()
private boolean featuresMatched(SequenceI seq1, SequenceI seq2)
{
- boolean matched = false;
try
{
if (seq1 == null && seq2 == null)
return true;
}
- SequenceFeature[] inFeature = seq1.getSequenceFeatures();
- SequenceFeature[] outFeature = seq2.getSequenceFeatures();
+ List<SequenceFeature> inFeature = seq1.getFeatures().getAllFeatures();
+ List<SequenceFeature> outFeature = seq2.getFeatures()
+ .getAllFeatures();
- if (inFeature == null && outFeature == null)
- {
- return true;
- }
- else if ((inFeature == null && outFeature != null)
- || (inFeature != null && outFeature == null))
+ if (inFeature.size() != outFeature.size())
{
+ System.err.println("Feature count in: " + inFeature.size()
+ + ", out: " + outFeature.size());
return false;
}
- int testSize = inFeature.length;
- int matchedCount = 0;
+ SequenceFeatures.sortFeatures(inFeature, true);
+ SequenceFeatures.sortFeatures(outFeature, true);
+ int i = 0;
for (SequenceFeature in : inFeature)
{
- for (SequenceFeature out : outFeature)
+ SequenceFeature out = outFeature.get(i);
+ System.out.println(out.getType() + " | " + in.getType());
+ System.out.println(out.getBegin() + " | " + in.getBegin());
+ System.out.println(out.getEnd() + " | " + in.getEnd());
+
+ if (in.getBegin() == out.getBegin() && in.getEnd() == out.getEnd()
+ && in.getScore() == out.getScore()
+ && in.getFeatureGroup().equals(out.getFeatureGroup())
+ && in.getType().equals(out.getType()))
{
- System.out.println(out.getType() + " | " + in.getType());
- System.out.println(out.getBegin() + " | " + in.getBegin());
- System.out.println(out.getEnd() + " | " + in.getEnd());
-
- if (inFeature.length == outFeature.length
- && in.getBegin() == out.getBegin()
- && in.getEnd() == out.getEnd()
- && in.getScore() == out.getScore()
- && in.getFeatureGroup().equals(out.getFeatureGroup())
- && in.getType().equals(out.getType()))
- {
-
- ++matchedCount;
- }
}
- }
- System.out.println("matched count >>>>>> " + matchedCount);
- if (testSize == matchedCount)
- {
- matched = true;
+ else
+ {
+ System.err.println("Feature[" + i + "] mismatch, in: "
+ + in.toString() + ", out: "
+ + outFeature.get(i).toString());
+ return false;
+ }
+ i++;
}
} catch (Exception e)
{
e.printStackTrace();
}
// System.out.println(">>>>>>>>>>>>>> features matched : " + matched);
- return matched;
+ return true;
}
/**
Assert.assertNotNull(newAlignment.getGroups());
for (SequenceGroup seqGrp : newAlignment.getGroups())
{
- SequenceGroup expectedGrp = expectedGrps.get(seqGrp.getName());
+ SequenceGroup expectedGrp = copySg;
AssertJUnit.assertTrue(
"Failed SequenceGroup Test for >>> " + seqGrp.getName(),
isGroupMatched(expectedGrp, seqGrp));
package jalview.io;
import static org.testng.AssertJUnit.assertEquals;
+import static org.testng.AssertJUnit.assertTrue;
+import jalview.datamodel.DBRefEntry;
+import jalview.datamodel.Sequence;
import jalview.datamodel.SequenceFeature;
+import jalview.datamodel.SequenceI;
import jalview.gui.JvOptionPane;
+import jalview.io.gff.GffConstants;
+import java.util.HashMap;
import java.util.Hashtable;
import java.util.Map;
+import junit.extensions.PA;
+
import org.testng.annotations.BeforeClass;
import org.testng.annotations.Test;
// if no <html> tag, html-encodes > and < (only):
assertEquals("METAL 1 3; <br>&kHD>6", sb.toString());
}
+
+ @Test(groups = "Functional")
+ public void testCreateSequenceAnnotationReport()
+ {
+ SequenceAnnotationReport sar = new SequenceAnnotationReport(null);
+ StringBuilder sb = new StringBuilder();
+
+ SequenceI seq = new Sequence("s1", "MAKLKRFQSSTLL");
+ seq.setDescription("SeqDesc");
+
+ sar.createSequenceAnnotationReport(sb, seq, true, true, null);
+
+ /*
+ * positional features are ignored
+ */
+ seq.addSequenceFeature(new SequenceFeature("Domain", "Ferredoxin", 5,
+ 10, 1f, null));
+ assertEquals("<i><br>SeqDesc</i>", sb.toString());
+
+ /*
+ * non-positional feature
+ */
+ seq.addSequenceFeature(new SequenceFeature("Type1", "Nonpos", 0, 0, 1f,
+ null));
+ sb.setLength(0);
+ sar.createSequenceAnnotationReport(sb, seq, true, true, null);
+ String expected = "<i><br>SeqDesc<br>Type1 ; Nonpos</i>";
+ assertEquals(expected, sb.toString());
+
+ /*
+ * non-positional features not wanted
+ */
+ sb.setLength(0);
+ sar.createSequenceAnnotationReport(sb, seq, true, false, null);
+ assertEquals("<i><br>SeqDesc</i>", sb.toString());
+
+ /*
+ * add non-pos feature with score inside min-max range for feature type
+ * minmax holds { [positionalMin, positionalMax], [nonPosMin, nonPosMax] }
+ * score is only appended for positional features so ignored here!
+ * minMax are not recorded for non-positional features
+ */
+ seq.addSequenceFeature(new SequenceFeature("Metal", "Desc", 0, 0, 5f,
+ null));
+ Map<String, float[][]> minmax = new HashMap<String, float[][]>();
+ minmax.put("Metal", new float[][] { null, new float[] { 2f, 5f } });
+ sb.setLength(0);
+ sar.createSequenceAnnotationReport(sb, seq, true, true, minmax);
+ expected = "<i><br>SeqDesc<br>Metal ; Desc<br>Type1 ; Nonpos</i>";
+ assertEquals(expected, sb.toString());
+
+ /*
+ * 'linkonly' features are ignored; this is obsolete, as linkonly
+ * is only set by DasSequenceFetcher, and DAS is history
+ */
+ SequenceFeature sf = new SequenceFeature("Metal", "Desc", 0, 0, 5f,
+ null);
+ sf.setValue("linkonly", Boolean.TRUE);
+ seq.addSequenceFeature(sf);
+ sb.setLength(0);
+ sar.createSequenceAnnotationReport(sb, seq, true, true, minmax);
+ assertEquals(expected, sb.toString()); // unchanged!
+
+ /*
+ * 'clinical_significance' currently being specially included
+ */
+ SequenceFeature sf2 = new SequenceFeature("Variant", "Havana", 0, 0,
+ 5f, null);
+ sf2.setValue(GffConstants.CLINICAL_SIGNIFICANCE, "benign");
+ seq.addSequenceFeature(sf2);
+ sb.setLength(0);
+ sar.createSequenceAnnotationReport(sb, seq, true, true, minmax);
+ expected = "<i><br>SeqDesc<br>Metal ; Desc<br>Type1 ; Nonpos<br>Variant ; Havana; benign</i>";
+ assertEquals(expected, sb.toString());
+
+ /*
+ * add dbrefs
+ */
+ seq.addDBRef(new DBRefEntry("PDB", "0", "3iu1"));
+ seq.addDBRef(new DBRefEntry("Uniprot", "1", "P30419"));
+ // with showDbRefs = false
+ sb.setLength(0);
+ sar.createSequenceAnnotationReport(sb, seq, false, true, minmax);
+ assertEquals(expected, sb.toString()); // unchanged
+ // with showDbRefs = true
+ sb.setLength(0);
+ sar.createSequenceAnnotationReport(sb, seq, true, true, minmax);
+ expected = "<i><br>SeqDesc<br>UNIPROT P30419<br>PDB 3iu1<br>Metal ; Desc<br>Type1 ; Nonpos<br>Variant ; Havana; benign</i>";
+ assertEquals(expected, sb.toString());
+ // with showNonPositionalFeatures = false
+ sb.setLength(0);
+ sar.createSequenceAnnotationReport(sb, seq, true, false, minmax);
+ expected = "<i><br>SeqDesc<br>UNIPROT P30419<br>PDB 3iu1</i>";
+ assertEquals(expected, sb.toString());
+
+ // see other tests for treatment of status and html
+ }
+
+ /**
+ * Test that exercises an abbreviated sequence details report, with ellipsis
+ * where there are more than 40 different sources, or more than 4 dbrefs for a
+ * single source
+ */
+ @Test(groups = "Functional")
+ public void testCreateSequenceAnnotationReport_withEllipsis()
+ {
+ SequenceAnnotationReport sar = new SequenceAnnotationReport(null);
+ StringBuilder sb = new StringBuilder();
+
+ SequenceI seq = new Sequence("s1", "ABC");
+
+ int maxSources = (int) PA.getValue(sar, "MAX_SOURCES");
+ for (int i = 0; i <= maxSources; i++)
+ {
+ seq.addDBRef(new DBRefEntry("PDB" + i, "0", "3iu1"));
+ }
+
+ int maxRefs = (int) PA.getValue(sar, "MAX_REFS_PER_SOURCE");
+ for (int i = 0; i <= maxRefs; i++)
+ {
+ seq.addDBRef(new DBRefEntry("Uniprot", "0", "P3041" + i));
+ }
+
+ sar.createSequenceAnnotationReport(sb, seq, true, true, null, true);
+ String report = sb.toString();
+ assertTrue(report
+ .startsWith("<i><br>UNIPROT P30410, P30411, P30412, P30413,...<br>PDB0 3iu1"));
+ assertTrue(report
+ .endsWith("<br>PDB7 3iu1<br>PDB8,...<br>(Output Sequence Details to list all database references)</i>"));
+ }
}
import java.io.IOException;
import java.util.ArrayList;
+import java.util.HashMap;
import java.util.List;
+import java.util.Map;
import org.testng.annotations.BeforeClass;
import org.testng.annotations.Test;
.getToRanges().get(0));
}
+ @Test(groups = "Functional")
+ public void testGetDescription()
+ {
+ Gff3Helper testee = new Gff3Helper();
+ SequenceFeature sf = new SequenceFeature("type", "desc", 10, 20, 3f,
+ "group");
+ Map<String, List<String>> attributes = new HashMap<String, List<String>>();
+ assertNull(testee.getDescription(sf, attributes));
+
+ // ID if any is a fall-back for description
+ sf.setValue("ID", "Patrick");
+ assertEquals("Patrick", testee.getDescription(sf, attributes));
+
+ // Target is set by Exonerate
+ sf.setValue("Target", "Destination Moon");
+ assertEquals("Destination", testee.getDescription(sf, attributes));
+
+ // Ensembl variant feature - extract "alleles" value
+ // may be sequence_variant or a sub-type in the sequence ontology
+ sf = new SequenceFeature("feature_variant", "desc", 10, 20, 3f, "group");
+ List<String> atts = new ArrayList<String>();
+ atts.add("A");
+ atts.add("C");
+ atts.add("T");
+ attributes.put("alleles", atts);
+ assertEquals("A,C,T", testee.getDescription(sf, attributes));
+
+ // Ensembl transcript or exon feature - extract Name
+ List<String> atts2 = new ArrayList<String>();
+ atts2.add("ENSE00001871077");
+ attributes.put("Name", atts2);
+ sf = new SequenceFeature("transcript", "desc", 10, 20, 3f, "group");
+ assertEquals("ENSE00001871077", testee.getDescription(sf, attributes));
+ // transcript sub-type in SO
+ sf = new SequenceFeature("mRNA", "desc", 10, 20, 3f, "group");
+ assertEquals("ENSE00001871077", testee.getDescription(sf, attributes));
+ // special usage of feature by Ensembl
+ sf = new SequenceFeature("NMD_transcript_variant", "desc", 10, 20, 3f,
+ "group");
+ assertEquals("ENSE00001871077", testee.getDescription(sf, attributes));
+ // exon feature
+ sf = new SequenceFeature("exon", "desc", 10, 20, 3f, "group");
+ assertEquals("ENSE00001871077", testee.getDescription(sf, attributes));
+ }
}
package jalview.io.gff;
import static org.testng.AssertJUnit.assertEquals;
+import static org.testng.AssertJUnit.assertNotNull;
import static org.testng.AssertJUnit.assertSame;
import static org.testng.AssertJUnit.assertTrue;
import static org.testng.internal.junit.ArrayAsserts.assertArrayEquals;
import jalview.datamodel.AlignmentI;
import jalview.datamodel.Sequence;
import jalview.datamodel.SequenceDummy;
+import jalview.datamodel.SequenceFeature;
import jalview.datamodel.SequenceI;
import jalview.gui.JvOptionPane;
assertEquals(1, newseqs.size());
assertTrue(newseqs.get(0) instanceof SequenceDummy);
assertEquals("match$17_5_30", newseqs.get(0).getName());
+
+ assertNotNull(newseqs.get(0).getSequenceFeatures());
+ assertEquals(1, newseqs.get(0).getSequenceFeatures().length);
+ SequenceFeature sf = newseqs.get(0).getSequenceFeatures()[0];
+ assertEquals(1, sf.getBegin());
+ assertEquals(26, sf.getEnd());
+ assertEquals("Pfam", sf.getType());
+ assertEquals("4Fe-4S dicluster domain", sf.getDescription());
+ assertEquals("InterProScan", sf.getFeatureGroup());
+
assertEquals(1, align.getCodonFrames().size());
AlignedCodonFrame mapping = align.getCodonFrames().iterator().next();
--- /dev/null
+package jalview.renderer.seqfeatures;
+
+import static org.testng.Assert.assertEquals;
+import static org.testng.Assert.assertFalse;
+import static org.testng.Assert.assertTrue;
+
+import jalview.api.AlignViewportI;
+import jalview.api.FeatureColourI;
+import jalview.datamodel.SequenceFeature;
+import jalview.datamodel.SequenceI;
+import jalview.gui.AlignFrame;
+import jalview.io.DataSourceType;
+import jalview.io.FileLoader;
+import jalview.schemes.FeatureColour;
+
+import java.awt.Color;
+import java.util.Arrays;
+import java.util.List;
+import java.util.Map;
+
+import org.testng.annotations.Test;
+
+public class FeatureRendererTest
+{
+
+ @Test(groups = "Functional")
+ public void testFindAllFeatures()
+ {
+ String seqData = ">s1\nabcdef\n>s2\nabcdef\n>s3\nabcdef\n>s4\nabcdef\n";
+ AlignFrame af = new FileLoader().LoadFileWaitTillLoaded(seqData,
+ DataSourceType.PASTE);
+ AlignViewportI av = af.getViewport();
+ FeatureRenderer fr = new FeatureRenderer(av);
+
+ /*
+ * with no features
+ */
+ fr.findAllFeatures(true);
+ assertTrue(fr.getRenderOrder().isEmpty());
+ assertTrue(fr.getFeatureGroups().isEmpty());
+
+ List<SequenceI> seqs = av.getAlignment().getSequences();
+
+ // add a non-positional feature - should be ignored by FeatureRenderer
+ SequenceFeature sf1 = new SequenceFeature("Type", "Desc", 0, 0, 1f,
+ "Group");
+ seqs.get(0).addSequenceFeature(sf1);
+ fr.findAllFeatures(true);
+ // ? bug - types and groups added for non-positional features
+ List<String> types = fr.getRenderOrder();
+ List<String> groups = fr.getFeatureGroups();
+ assertEquals(types.size(), 0);
+ assertFalse(types.contains("Type"));
+ assertEquals(groups.size(), 0);
+ assertFalse(groups.contains("Group"));
+
+ // add some positional features
+ seqs.get(1).addSequenceFeature(
+ new SequenceFeature("Pfam", "Desc", 5, 9, 1f, "PfamGroup"));
+ seqs.get(2).addSequenceFeature(
+ new SequenceFeature("Pfam", "Desc", 14, 22, 2f, "RfamGroup"));
+ // bug in findAllFeatures - group not checked for a known feature type
+ seqs.get(2).addSequenceFeature(
+ new SequenceFeature("Rfam", "Desc", 5, 9, Float.NaN,
+ "RfamGroup"));
+ // existing feature type with null group
+ seqs.get(3).addSequenceFeature(
+ new SequenceFeature("Rfam", "Desc", 5, 9, Float.NaN, null));
+ // new feature type with null group
+ seqs.get(3).addSequenceFeature(
+ new SequenceFeature("Scop", "Desc", 5, 9, Float.NaN, null));
+ // null value for type produces NullPointerException
+ fr.findAllFeatures(true);
+ types = fr.getRenderOrder();
+ groups = fr.getFeatureGroups();
+ assertEquals(types.size(), 3);
+ assertFalse(types.contains("Type"));
+ assertTrue(types.contains("Pfam"));
+ assertTrue(types.contains("Rfam"));
+ assertTrue(types.contains("Scop"));
+ assertEquals(groups.size(), 2);
+ assertFalse(groups.contains("Group"));
+ assertTrue(groups.contains("PfamGroup"));
+ assertTrue(groups.contains("RfamGroup"));
+ assertFalse(groups.contains(null)); // null group is ignored
+
+ /*
+ * check min-max values
+ */
+ Map<String, float[][]> minMax = fr.getMinMax();
+ assertEquals(minMax.size(), 1); // non-positional and NaN not stored
+ assertEquals(minMax.get("Pfam")[0][0], 1f); // positional min
+ assertEquals(minMax.get("Pfam")[0][1], 2f); // positional max
+
+ // increase max for Pfam, add scores for Rfam
+ seqs.get(0).addSequenceFeature(
+ new SequenceFeature("Pfam", "Desc", 14, 22, 8f, "RfamGroup"));
+ seqs.get(1).addSequenceFeature(
+ new SequenceFeature("Rfam", "Desc", 5, 9, 6f, "RfamGroup"));
+ fr.findAllFeatures(true);
+ // note minMax is not a defensive copy, shouldn't expose this
+ assertEquals(minMax.size(), 2);
+ assertEquals(minMax.get("Pfam")[0][0], 1f);
+ assertEquals(minMax.get("Pfam")[0][1], 8f);
+ assertEquals(minMax.get("Rfam")[0][0], 6f);
+ assertEquals(minMax.get("Rfam")[0][1], 6f);
+
+ /*
+ * check render order (last is on top)
+ */
+ List<String> renderOrder = fr.getRenderOrder();
+ assertEquals(renderOrder, Arrays.asList("Scop", "Rfam", "Pfam"));
+
+ /*
+ * change render order (todo: an easier way)
+ * nb here last comes first in the data array
+ */
+ Object[][] data = new Object[3][];
+ FeatureColourI colour = new FeatureColour(Color.RED);
+ data[0] = new Object[] { "Rfam", colour, true };
+ data[1] = new Object[] { "Pfam", colour, false };
+ data[2] = new Object[] { "Scop", colour, false };
+ fr.setFeaturePriority(data);
+ assertEquals(fr.getRenderOrder(), Arrays.asList("Scop", "Pfam", "Rfam"));
+ assertEquals(fr.getDisplayedFeatureTypes(), Arrays.asList("Rfam"));
+
+ /*
+ * add a new feature type: should go on top of render order as visible,
+ * other feature ordering and visibility should be unchanged
+ */
+ seqs.get(2).addSequenceFeature(
+ new SequenceFeature("Metal", "Desc", 14, 22, 8f, "MetalGroup"));
+ fr.findAllFeatures(true);
+ assertEquals(fr.getRenderOrder(),
+ Arrays.asList("Scop", "Pfam", "Rfam", "Metal"));
+ assertEquals(fr.getDisplayedFeatureTypes(),
+ Arrays.asList("Rfam", "Metal"));
+ }
+
+ @Test(groups = "Functional")
+ public void testFindFeaturesAtRes()
+ {
+ String seqData = ">s1\nabcdefghijklmnopqrstuvwxyz\n";
+ AlignFrame af = new FileLoader().LoadFileWaitTillLoaded(seqData,
+ DataSourceType.PASTE);
+ AlignViewportI av = af.getViewport();
+ FeatureRenderer fr = new FeatureRenderer(av);
+ SequenceI seq = av.getAlignment().getSequenceAt(0);
+
+ /*
+ * with no features
+ */
+ List<SequenceFeature> features = fr.findFeaturesAtRes(seq, 3);
+ assertTrue(features.isEmpty());
+
+ /*
+ * add features
+ */
+ SequenceFeature sf1 = new SequenceFeature("Type1", "Desc", 0, 0, 1f,
+ "Group"); // non-positional
+ seq.addSequenceFeature(sf1);
+ SequenceFeature sf2 = new SequenceFeature("Type2", "Desc", 5, 15, 1f,
+ "Group1");
+ seq.addSequenceFeature(sf2);
+ SequenceFeature sf3 = new SequenceFeature("Type3", "Desc", 5, 15, 1f,
+ "Group2");
+ seq.addSequenceFeature(sf3);
+ SequenceFeature sf4 = new SequenceFeature("Type3", "Desc", 5, 15, 1f,
+ null); // null group is always treated as visible
+ seq.addSequenceFeature(sf4);
+
+ /*
+ * add contact features
+ */
+ SequenceFeature sf5 = new SequenceFeature("Disulphide Bond", "Desc", 4,
+ 12, 1f, "Group1");
+ seq.addSequenceFeature(sf5);
+ SequenceFeature sf6 = new SequenceFeature("Disulphide Bond", "Desc", 4,
+ 12, 1f, "Group2");
+ seq.addSequenceFeature(sf6);
+ SequenceFeature sf7 = new SequenceFeature("Disulphide Bond", "Desc", 4,
+ 12, 1f, null);
+ seq.addSequenceFeature(sf7);
+
+ /*
+ * let feature renderer discover features (and make visible)
+ */
+ fr.findAllFeatures(true);
+ features = fr.findFeaturesAtRes(seq, 12); // all positional
+ assertEquals(features.size(), 6);
+ assertTrue(features.contains(sf2));
+ assertTrue(features.contains(sf3));
+ assertTrue(features.contains(sf4));
+ assertTrue(features.contains(sf5));
+ assertTrue(features.contains(sf6));
+ assertTrue(features.contains(sf7));
+
+ /*
+ * at a non-contact position
+ */
+ features = fr.findFeaturesAtRes(seq, 11);
+ assertEquals(features.size(), 3);
+ assertTrue(features.contains(sf2));
+ assertTrue(features.contains(sf3));
+ assertTrue(features.contains(sf4));
+
+ /*
+ * make "Type2" not displayed
+ */
+ Object[][] data = new Object[4][];
+ FeatureColourI colour = new FeatureColour(Color.RED);
+ data[0] = new Object[] { "Type1", colour, true };
+ data[1] = new Object[] { "Type2", colour, false };
+ data[2] = new Object[] { "Type3", colour, true };
+ data[3] = new Object[] { "Disulphide Bond", colour, true };
+ fr.setFeaturePriority(data);
+ features = fr.findFeaturesAtRes(seq, 12);
+ assertEquals(features.size(), 5); // no sf2
+ assertTrue(features.contains(sf3));
+ assertTrue(features.contains(sf4));
+ assertTrue(features.contains(sf5));
+ assertTrue(features.contains(sf6));
+ assertTrue(features.contains(sf7));
+
+ /*
+ * make "Group2" not displayed
+ */
+ fr.setGroupVisibility("Group2", false);
+ features = fr.findFeaturesAtRes(seq, 12);
+ assertEquals(features.size(), 3); // no sf2, sf3, sf6
+ assertTrue(features.contains(sf4));
+ assertTrue(features.contains(sf5));
+ assertTrue(features.contains(sf7));
+ }
+}