2 // FORESTER -- software libraries and applications
3 // for evolutionary biology research and applications.
5 // Copyright (C) 2014 Christian M. Zmasek
6 // Copyright (C) 2014 Sanford-Burnham Medical Research Institute
9 // This library is free software; you can redistribute it and/or
10 // modify it under the terms of the GNU Lesser General Public
11 // License as published by the Free Software Foundation; either
12 // version 2.1 of the License, or (at your option) any later version.
14 // This library is distributed in the hope that it will be useful,
15 // but WITHOUT ANY WARRANTY; without even the implied warranty of
16 // MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
17 // Lesser General Public License for more details.
19 // You should have received a copy of the GNU Lesser General Public
20 // License along with this library; if not, write to the Free Software
21 // Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301, USA
23 // WWW: https://sites.google.com/site/cmzmasek/home/software/forester
25 package org.forester.test;
27 import java.io.ByteArrayInputStream;
29 import java.io.FileInputStream;
30 import java.io.IOException;
31 import java.io.StringWriter;
32 import java.io.Writer;
34 import java.util.ArrayList;
35 import java.util.Date;
36 import java.util.HashSet;
37 import java.util.Iterator;
38 import java.util.List;
39 import java.util.Locale;
41 import java.util.SortedSet;
43 import javax.net.ssl.HttpsURLConnection;
44 import javax.net.ssl.SSLContext;
46 import org.forester.application.support_transfer;
47 import org.forester.archaeopteryx.AptxUtil;
48 import org.forester.archaeopteryx.TreePanelUtil;
49 import org.forester.archaeopteryx.webservices.WebserviceUtil;
50 import org.forester.development.DevelopmentTools;
51 import org.forester.evoinference.TestPhylogenyReconstruction;
52 import org.forester.evoinference.matrix.character.CharacterStateMatrix;
53 import org.forester.evoinference.matrix.character.CharacterStateMatrix.BinaryStates;
54 import org.forester.go.TestGo;
55 import org.forester.io.parsers.FastaParser;
56 import org.forester.io.parsers.GeneralMsaParser;
57 import org.forester.io.parsers.HmmscanPerDomainTableParser;
58 import org.forester.io.parsers.HmmscanPerDomainTableParser.INDIVIDUAL_SCORE_CUTOFF;
59 import org.forester.io.parsers.nexus.NexusBinaryStatesMatrixParser;
60 import org.forester.io.parsers.nexus.NexusCharactersParser;
61 import org.forester.io.parsers.nexus.NexusPhylogeniesParser;
62 import org.forester.io.parsers.nhx.NHXParser;
63 import org.forester.io.parsers.nhx.NHXParser.TAXONOMY_EXTRACTION;
64 import org.forester.io.parsers.phyloxml.PhyloXmlParser;
65 import org.forester.io.parsers.tol.TolParser;
66 import org.forester.io.parsers.util.ParserUtils;
67 import org.forester.io.writers.PhylogenyWriter;
68 import org.forester.io.writers.SequenceWriter;
69 import org.forester.msa.BasicMsa;
70 import org.forester.msa.DeleteableMsa;
71 import org.forester.msa.Mafft;
72 import org.forester.msa.Msa;
73 import org.forester.msa.Msa.MSA_FORMAT;
74 import org.forester.msa.MsaInferrer;
75 import org.forester.msa.MsaMethods;
76 import org.forester.pccx.TestPccx;
77 import org.forester.phylogeny.Phylogeny;
78 import org.forester.phylogeny.PhylogenyBranch;
79 import org.forester.phylogeny.PhylogenyMethods;
80 import org.forester.phylogeny.PhylogenyNode;
81 import org.forester.phylogeny.PhylogenyNode.NH_CONVERSION_SUPPORT_VALUE_STYLE;
82 import org.forester.phylogeny.data.Accession;
83 import org.forester.phylogeny.data.Accession.Source;
84 import org.forester.phylogeny.data.BinaryCharacters;
85 import org.forester.phylogeny.data.BranchWidth;
86 import org.forester.phylogeny.data.Confidence;
87 import org.forester.phylogeny.data.Distribution;
88 import org.forester.phylogeny.data.DomainArchitecture;
89 import org.forester.phylogeny.data.Event;
90 import org.forester.phylogeny.data.Identifier;
91 import org.forester.phylogeny.data.PhylogenyData;
92 import org.forester.phylogeny.data.PhylogenyDataUtil;
93 import org.forester.phylogeny.data.Polygon;
94 import org.forester.phylogeny.data.PropertiesMap;
95 import org.forester.phylogeny.data.Property;
96 import org.forester.phylogeny.data.Property.AppliesTo;
97 import org.forester.phylogeny.data.ProteinDomain;
98 import org.forester.phylogeny.data.Taxonomy;
99 import org.forester.phylogeny.factories.ParserBasedPhylogenyFactory;
100 import org.forester.phylogeny.factories.PhylogenyFactory;
101 import org.forester.phylogeny.iterators.PhylogenyNodeIterator;
102 import org.forester.protein.BasicDomain;
103 import org.forester.protein.BasicProtein;
104 import org.forester.protein.Domain;
105 import org.forester.protein.Protein;
106 import org.forester.protein.ProteinId;
107 import org.forester.rio.TestRIO;
108 import org.forester.sdi.SDI;
109 import org.forester.sdi.SDIR;
110 import org.forester.sdi.TestGSDI;
111 import org.forester.sequence.BasicSequence;
112 import org.forester.sequence.MolecularSequence;
113 import org.forester.species.BasicSpecies;
114 import org.forester.species.Species;
115 import org.forester.surfacing.TestSurfacing;
116 import org.forester.tools.ConfidenceAssessor;
117 import org.forester.tools.SupportCount;
118 import org.forester.tools.TreeSplitMatrix;
119 import org.forester.util.AsciiHistogram;
120 import org.forester.util.BasicDescriptiveStatistics;
121 import org.forester.util.BasicTable;
122 import org.forester.util.BasicTableParser;
123 import org.forester.util.DescriptiveStatistics;
124 import org.forester.util.ForesterConstants;
125 import org.forester.util.ForesterUtil;
126 import org.forester.util.GeneralTable;
127 import org.forester.util.SequenceAccessionTools;
128 import org.forester.ws.seqdb.SequenceDatabaseEntry;
129 import org.forester.ws.seqdb.SequenceDbWsTools;
130 import org.forester.ws.seqdb.UniProtTaxonomy;
133 @SuppressWarnings( "unused")
134 public final class Test {
136 private final static String PATH_TO_RESOURCES = System.getProperty( "user.dir" )
137 + ForesterUtil.getFileSeparator() + "resources"
138 + ForesterUtil.getFileSeparator();
139 private final static String PATH_TO_TEST_DATA = System.getProperty( "user.dir" )
140 + ForesterUtil.getFileSeparator() + "test_data"
141 + ForesterUtil.getFileSeparator();
142 private final static boolean PERFORM_DB_TESTS = true;
143 private static final boolean PERFORM_WEB_TREE_ACCESS = true;
144 private static final String PHYLOXML_LOCAL_XSD = PATH_TO_RESOURCES + "phyloxml_schema/"
145 + ForesterConstants.PHYLO_XML_VERSION + "/"
146 + ForesterConstants.PHYLO_XML_XSD;
147 private static final String PHYLOXML_REMOTE_XSD = ForesterConstants.PHYLO_XML_LOCATION + "/"
148 + ForesterConstants.PHYLO_XML_VERSION + "/"
149 + ForesterConstants.PHYLO_XML_XSD;
150 private final static boolean USE_LOCAL_PHYLOXML_SCHEMA = true;
151 private final static double ZERO_DIFF = 1.0E-9;
153 private static boolean isEqual( final double a, final double b ) {
154 return ( ( Math.abs( a - b ) ) < Test.ZERO_DIFF );
157 public static void main( final String[] args ) {
158 System.out.println( "[Java version: " + ForesterUtil.JAVA_VERSION + " " + ForesterUtil.JAVA_VENDOR + "]" );
159 System.out.println( "[OS: " + ForesterUtil.OS_NAME + " " + ForesterUtil.OS_ARCH + " " + ForesterUtil.OS_VERSION
161 Locale.setDefault( Locale.US );
162 System.out.println( "[Locale: " + Locale.getDefault() + "]" );
165 System.out.print( "[Test if directory with files for testing exists/is readable: " );
166 if ( Test.testDir( PATH_TO_TEST_DATA ) ) {
167 System.out.println( "OK.]" );
170 System.out.println( "could not find/read from directory \"" + PATH_TO_TEST_DATA + "\".]" );
171 System.out.println( "Testing aborted." );
174 System.out.print( "[Test if resources directory exists/is readable: " );
175 if ( testDir( PATH_TO_RESOURCES ) ) {
176 System.out.println( "OK.]" );
179 System.out.println( "could not find/read from directory \"" + Test.PATH_TO_RESOURCES + "\".]" );
180 System.out.println( "Testing aborted." );
183 final long start_time = new Date().getTime();
185 System.out.print( "Basic node methods: " );
186 if ( Test.testBasicNodeMethods() ) {
187 System.out.println( "OK." );
191 System.out.println( "failed." );
194 System.out.print( "Protein id: " );
195 if ( !testProteinId() ) {
196 System.out.println( "failed." );
202 System.out.println( "OK." );
203 System.out.print( "Species: " );
204 if ( !testSpecies() ) {
205 System.out.println( "failed." );
211 System.out.println( "OK." );
212 System.out.print( "Basic domain: " );
213 if ( !testBasicDomain() ) {
214 System.out.println( "failed." );
220 System.out.println( "OK." );
221 System.out.print( "Basic protein: " );
222 if ( !testBasicProtein() ) {
223 System.out.println( "failed." );
229 System.out.println( "OK." );
230 System.out.print( "Sequence writer: " );
231 if ( testSequenceWriter() ) {
232 System.out.println( "OK." );
236 System.out.println( "failed." );
239 System.out.print( "Sequence id parsing: " );
240 if ( testSequenceIdParsing() ) {
241 System.out.println( "OK." );
245 System.out.println( "failed." );
248 System.out.print( "UniProtKB id extraction: " );
249 if ( Test.testExtractUniProtKbProteinSeqIdentifier() ) {
250 System.out.println( "OK." );
254 System.out.println( "failed." );
257 System.out.print( "Sequence DB tools 1: " );
258 if ( testSequenceDbWsTools1() ) {
259 System.out.println( "OK." );
263 System.out.println( "failed." );
266 System.out.print( "Hmmscan output parser: " );
267 if ( testHmmscanOutputParser() ) {
268 System.out.println( "OK." );
272 System.out.println( "failed." );
275 System.out.print( "Overlap removal: " );
276 if ( !org.forester.test.Test.testOverlapRemoval() ) {
277 System.out.println( "failed." );
283 System.out.println( "OK." );
284 System.out.print( "Engulfing overlap removal: " );
285 if ( !Test.testEngulfingOverlapRemoval() ) {
286 System.out.println( "failed." );
292 System.out.println( "OK." );
293 System.out.print( "Taxonomy data extraction: " );
294 if ( Test.testExtractTaxonomyDataFromNodeName() ) {
295 System.out.println( "OK." );
299 System.out.println( "failed." );
302 System.out.print( "Taxonomy code extraction: " );
303 if ( Test.testExtractTaxonomyCodeFromNodeName() ) {
304 System.out.println( "OK." );
308 System.out.println( "failed." );
311 System.out.print( "SN extraction: " );
312 if ( Test.testExtractSNFromNodeName() ) {
313 System.out.println( "OK." );
317 System.out.println( "failed." );
320 System.out.print( "Taxonomy extraction (general): " );
321 if ( Test.testTaxonomyExtraction() ) {
322 System.out.println( "OK." );
326 System.out.println( "failed." );
329 System.out.print( "Uri for Aptx web sequence accession: " );
330 if ( Test.testCreateUriForSeqWeb() ) {
331 System.out.println( "OK." );
335 System.out.println( "failed." );
338 System.out.print( "Basic node construction and parsing of NHX (node level): " );
339 if ( Test.testNHXNodeParsing() ) {
340 System.out.println( "OK." );
344 System.out.println( "failed." );
347 System.out.print( "NHX parsing iterating: " );
348 if ( Test.testNHParsingIter() ) {
349 System.out.println( "OK." );
353 System.out.println( "failed." );
356 System.out.print( "NH parsing: " );
357 if ( Test.testNHParsing() ) {
358 System.out.println( "OK." );
362 System.out.println( "failed." );
365 System.out.print( "NH parsing - special chars: " );
366 if ( Test.testNHParsingSpecialChars() ) {
367 System.out.println( "OK." );
371 System.out.println( "failed." );
374 System.out.print( "Conversion to NHX (node level): " );
375 if ( Test.testNHXconversion() ) {
376 System.out.println( "OK." );
380 System.out.println( "failed." );
383 System.out.print( "NHX parsing: " );
384 if ( Test.testNHXParsing() ) {
385 System.out.println( "OK." );
389 System.out.println( "failed." );
392 System.out.print( "NHX parsing with quotes: " );
393 if ( Test.testNHXParsingQuotes() ) {
394 System.out.println( "OK." );
398 System.out.println( "failed." );
401 System.out.print( "NHX parsing (MrBayes): " );
402 if ( Test.testNHXParsingMB() ) {
403 System.out.println( "OK." );
407 System.out.println( "failed." );
410 System.out.print( "Nexus characters parsing: " );
411 if ( Test.testNexusCharactersParsing() ) {
412 System.out.println( "OK." );
416 System.out.println( "failed." );
419 System.out.print( "Nexus tree parsing iterating: " );
420 if ( Test.testNexusTreeParsingIterating() ) {
421 System.out.println( "OK." );
425 System.out.println( "failed." );
428 System.out.print( "Nexus tree parsing: " );
429 if ( Test.testNexusTreeParsing() ) {
430 System.out.println( "OK." );
434 System.out.println( "failed." );
437 System.out.print( "Nexus tree parsing (translating): " );
438 if ( Test.testNexusTreeParsingTranslating() ) {
439 System.out.println( "OK." );
443 System.out.println( "failed." );
446 System.out.print( "Nexus matrix parsing: " );
447 if ( Test.testNexusMatrixParsing() ) {
448 System.out.println( "OK." );
452 System.out.println( "failed." );
455 System.out.print( "Basic phyloXML parsing: " );
456 if ( Test.testBasicPhyloXMLparsing() ) {
457 System.out.println( "OK." );
461 System.out.println( "failed." );
464 System.out.print( "Basic phyloXML parsing (validating against schema): " );
465 if ( testBasicPhyloXMLparsingValidating() ) {
466 System.out.println( "OK." );
470 System.out.println( "failed." );
473 System.out.print( "Roundtrip phyloXML parsing (validating against schema): " );
474 if ( Test.testBasicPhyloXMLparsingRoundtrip() ) {
475 System.out.println( "OK." );
479 System.out.println( "failed." );
482 System.out.print( "phyloXML Distribution Element: " );
483 if ( Test.testPhyloXMLparsingOfDistributionElement() ) {
484 System.out.println( "OK." );
488 System.out.println( "failed." );
491 System.out.print( "Tol XML parsing: " );
492 if ( Test.testBasicTolXMLparsing() ) {
493 System.out.println( "OK." );
497 System.out.println( "failed." );
500 System.out.print( "UTF-8 parsing from file: " );
501 if ( Test.testUTF8ParsingFromFile() ) {
502 System.out.println( "OK." );
506 System.out.println( "failed." );
509 System.out.print( "Copying of node data: " );
510 if ( Test.testCopyOfNodeData() ) {
511 System.out.println( "OK." );
515 System.out.println( "failed." );
518 System.out.print( "Tree copy: " );
519 if ( Test.testTreeCopy() ) {
520 System.out.println( "OK." );
524 System.out.println( "failed." );
527 System.out.print( "Basic tree methods: " );
528 if ( Test.testBasicTreeMethods() ) {
529 System.out.println( "OK." );
533 System.out.println( "failed." );
536 System.out.print( "Tree methods: " );
537 if ( Test.testTreeMethods() ) {
538 System.out.println( "OK." );
542 System.out.println( "failed." );
545 System.out.print( "Postorder Iterator: " );
546 if ( Test.testPostOrderIterator() ) {
547 System.out.println( "OK." );
551 System.out.println( "failed." );
554 System.out.print( "Preorder Iterator: " );
555 if ( Test.testPreOrderIterator() ) {
556 System.out.println( "OK." );
560 System.out.println( "failed." );
563 System.out.print( "Levelorder Iterator: " );
564 if ( Test.testLevelOrderIterator() ) {
565 System.out.println( "OK." );
569 System.out.println( "failed." );
572 System.out.print( "Re-id methods: " );
573 if ( Test.testReIdMethods() ) {
574 System.out.println( "OK." );
578 System.out.println( "failed." );
581 System.out.print( "Methods on last external nodes: " );
582 if ( Test.testLastExternalNodeMethods() ) {
583 System.out.println( "OK." );
587 System.out.println( "failed." );
590 System.out.print( "Methods on external nodes: " );
591 if ( Test.testExternalNodeRelatedMethods() ) {
592 System.out.println( "OK." );
596 System.out.println( "failed." );
599 System.out.print( "Deletion of external nodes: " );
600 if ( Test.testDeletionOfExternalNodes() ) {
601 System.out.println( "OK." );
605 System.out.println( "failed." );
608 System.out.print( "Subtree deletion: " );
609 if ( Test.testSubtreeDeletion() ) {
610 System.out.println( "OK." );
614 System.out.println( "failed." );
617 System.out.print( "Phylogeny branch: " );
618 if ( Test.testPhylogenyBranch() ) {
619 System.out.println( "OK." );
623 System.out.println( "failed." );
626 System.out.print( "Rerooting: " );
627 if ( Test.testRerooting() ) {
628 System.out.println( "OK." );
632 System.out.println( "failed." );
635 System.out.print( "Mipoint rooting: " );
636 if ( Test.testMidpointrooting() ) {
637 System.out.println( "OK." );
641 System.out.println( "failed." );
644 System.out.print( "Node removal: " );
645 if ( Test.testNodeRemoval() ) {
646 System.out.println( "OK." );
650 System.out.println( "failed." );
653 System.out.print( "Support count: " );
654 if ( Test.testSupportCount() ) {
655 System.out.println( "OK." );
659 System.out.println( "failed." );
662 System.out.print( "Support transfer: " );
663 if ( Test.testSupportTransfer() ) {
664 System.out.println( "OK." );
668 System.out.println( "failed." );
671 System.out.print( "Finding of LCA: " );
672 if ( Test.testGetLCA() ) {
673 System.out.println( "OK." );
677 System.out.println( "failed." );
680 System.out.print( "Finding of LCA 2: " );
681 if ( Test.testGetLCA2() ) {
682 System.out.println( "OK." );
686 System.out.println( "failed." );
689 System.out.print( "Calculation of distance between nodes: " );
690 if ( Test.testGetDistance() ) {
691 System.out.println( "OK." );
695 System.out.println( "failed." );
698 System.out.print( "Descriptive statistics: " );
699 if ( Test.testDescriptiveStatistics() ) {
700 System.out.println( "OK." );
704 System.out.println( "failed." );
707 System.out.print( "Data objects and methods: " );
708 if ( Test.testDataObjects() ) {
709 System.out.println( "OK." );
713 System.out.println( "failed." );
716 System.out.print( "Properties map: " );
717 if ( Test.testPropertiesMap() ) {
718 System.out.println( "OK." );
722 System.out.println( "failed." );
725 System.out.print( "SDIse: " );
726 if ( Test.testSDIse() ) {
727 System.out.println( "OK." );
731 System.out.println( "failed." );
734 System.out.print( "SDIunrooted: " );
735 if ( Test.testSDIunrooted() ) {
736 System.out.println( "OK." );
740 System.out.println( "failed." );
743 System.out.print( "GSDI: " );
744 if ( TestGSDI.test() ) {
745 System.out.println( "OK." );
749 System.out.println( "failed." );
752 System.out.print( "RIO: " );
753 if ( TestRIO.test() ) {
754 System.out.println( "OK." );
758 System.out.println( "failed." );
761 System.out.print( "Phylogeny reconstruction:" );
762 System.out.println();
763 if ( TestPhylogenyReconstruction.test( new File( PATH_TO_TEST_DATA ) ) ) {
764 System.out.println( "OK." );
768 System.out.println( "failed." );
771 System.out.print( "Analysis of domain architectures: " );
772 System.out.println();
773 if ( TestSurfacing.test( new File( PATH_TO_TEST_DATA ) ) ) {
774 System.out.println( "OK." );
778 System.out.println( "failed." );
781 System.out.print( "GO: " );
782 System.out.println();
783 if ( TestGo.test( new File( PATH_TO_TEST_DATA ) ) ) {
784 System.out.println( "OK." );
788 System.out.println( "failed." );
791 System.out.print( "Modeling tools: " );
792 if ( TestPccx.test() ) {
793 System.out.println( "OK." );
797 System.out.println( "failed." );
800 System.out.print( "Split Matrix strict: " );
801 if ( Test.testSplitStrict() ) {
802 System.out.println( "OK." );
806 System.out.println( "failed." );
809 System.out.print( "Split Matrix: " );
810 if ( Test.testSplit() ) {
811 System.out.println( "OK." );
815 System.out.println( "failed." );
818 System.out.print( "Confidence Assessor: " );
819 if ( Test.testConfidenceAssessor() ) {
820 System.out.println( "OK." );
824 System.out.println( "failed." );
827 System.out.print( "Basic table: " );
828 if ( Test.testBasicTable() ) {
829 System.out.println( "OK." );
833 System.out.println( "failed." );
836 System.out.print( "General table: " );
837 if ( Test.testGeneralTable() ) {
838 System.out.println( "OK." );
842 System.out.println( "failed." );
845 System.out.print( "Amino acid sequence: " );
846 if ( Test.testAminoAcidSequence() ) {
847 System.out.println( "OK." );
851 System.out.println( "failed." );
854 System.out.print( "General MSA parser: " );
855 if ( Test.testGeneralMsaParser() ) {
856 System.out.println( "OK." );
860 System.out.println( "failed." );
863 System.out.print( "Fasta parser for msa: " );
864 if ( Test.testFastaParser() ) {
865 System.out.println( "OK." );
869 System.out.println( "failed." );
872 System.out.print( "Creation of balanced phylogeny: " );
873 if ( Test.testCreateBalancedPhylogeny() ) {
874 System.out.println( "OK." );
878 System.out.println( "failed." );
881 System.out.print( "Genbank accessor parsing: " );
882 if ( Test.testGenbankAccessorParsing() ) {
883 System.out.println( "OK." );
887 System.out.println( "failed." );
891 final String os = ForesterUtil.OS_NAME.toLowerCase();
892 if ( ( os.indexOf( "mac" ) >= 0 ) && ( os.indexOf( "os" ) > 0 ) ) {
893 path = "/usr/local/bin/mafft";
895 else if ( os.indexOf( "win" ) >= 0 ) {
896 path = "C:\\Program Files\\mafft-win\\mafft.bat";
900 if ( !MsaInferrer.isInstalled( path ) ) {
901 path = "/usr/bin/mafft";
903 if ( !MsaInferrer.isInstalled( path ) ) {
904 path = "/usr/local/bin/mafft";
907 if ( MsaInferrer.isInstalled( path ) ) {
908 System.out.print( "MAFFT (external program): " );
909 if ( Test.testMafft( path ) ) {
910 System.out.println( "OK." );
914 System.out.println( "failed [will not count towards failed tests]" );
917 System.out.print( "Next nodes with collapsed: " );
918 if ( Test.testNextNodeWithCollapsing() ) {
919 System.out.println( "OK." );
923 System.out.println( "failed." );
926 System.out.print( "Simple MSA quality: " );
927 if ( Test.testMsaQualityMethod() ) {
928 System.out.println( "OK." );
932 System.out.println( "failed." );
935 System.out.print( "Deleteable MSA: " );
936 if ( Test.testDeleteableMsa() ) {
937 System.out.println( "OK." );
941 System.out.println( "failed." );
944 System.out.print( "MSA entropy: " );
945 if ( Test.testMsaEntropy() ) {
946 System.out.println( "OK." );
950 System.out.println( "failed." );
953 if ( PERFORM_DB_TESTS ) {
954 System.out.print( "Uniprot Entry Retrieval: " );
955 if ( Test.testUniprotEntryRetrieval() ) {
956 System.out.println( "OK." );
960 System.out.println( "failed." );
963 System.out.print( "Ebi Entry Retrieval: " );
964 if ( Test.testEbiEntryRetrieval() ) {
965 System.out.println( "OK." );
969 System.out.println( "failed." );
972 System.out.print( "Sequence DB tools 2: " );
973 if ( testSequenceDbWsTools2() ) {
974 System.out.println( "OK." );
978 System.out.println( "failed." );
982 System.out.print( "Uniprot Taxonomy Search: " );
983 if ( Test.testUniprotTaxonomySearch() ) {
984 System.out.println( "OK." );
988 System.out.println( "failed." );
992 if ( PERFORM_WEB_TREE_ACCESS ) {
993 System.out.print( "TreeBase acccess: " );
994 if ( Test.testTreeBaseReading() ) {
995 System.out.println( "OK." );
999 System.out.println( "failed." );
1002 System.out.print( "ToL access: " );
1003 if ( Test.testToLReading() ) {
1004 System.out.println( "OK." );
1008 System.out.println( "failed." );
1011 System.out.print( "NHX parsing from URL: " );
1012 if ( Test.testNHXparsingFromURL() ) {
1013 System.out.println( "OK." );
1017 System.out.println( "failed." );
1020 System.out.print( "NHX parsing from URL 2: " );
1021 if ( Test.testNHXparsingFromURL2() ) {
1022 System.out.println( "OK." );
1026 System.out.println( "failed." );
1029 System.out.print( "phyloXML parsing from URL: " );
1030 if ( Test.testPhyloXMLparsingFromURL() ) {
1031 System.out.println( "OK." );
1035 System.out.println( "failed." );
1038 System.out.print( "TreeFam access: " );
1039 if ( Test.testTreeFamReading() ) {
1040 System.out.println( "OK." );
1044 System.out.println( "failed." );
1047 System.out.print( "Pfam tree access: " );
1048 if ( Test.testPfamTreeReading() ) {
1049 System.out.println( "OK." );
1053 System.out.println( "failed." );
1057 System.out.println();
1058 final Runtime rt = java.lang.Runtime.getRuntime();
1059 final long free_memory = rt.freeMemory() / 1000000;
1060 final long total_memory = rt.totalMemory() / 1000000;
1061 System.out.println( "Running time : " + ( new Date().getTime() - start_time ) + "ms " + "(free memory: "
1062 + free_memory + "MB, total memory: " + total_memory + "MB)" );
1063 System.out.println();
1064 System.out.println( "Successful tests: " + succeeded );
1065 System.out.println( "Failed tests: " + failed );
1066 System.out.println();
1068 System.out.println( "OK." );
1071 System.out.println( "Not OK." );
1075 private static boolean testEngulfingOverlapRemoval() {
1077 final Domain d0 = new BasicDomain( "d0", 0, 8, ( short ) 1, ( short ) 1, 0.1, 1 );
1078 final Domain d1 = new BasicDomain( "d1", 0, 1, ( short ) 1, ( short ) 1, 0.1, 1 );
1079 final Domain d2 = new BasicDomain( "d2", 0, 2, ( short ) 1, ( short ) 1, 0.1, 1 );
1080 final Domain d3 = new BasicDomain( "d3", 7, 8, ( short ) 1, ( short ) 1, 0.1, 1 );
1081 final Domain d4 = new BasicDomain( "d4", 7, 9, ( short ) 1, ( short ) 1, 0.1, 1 );
1082 final Domain d5 = new BasicDomain( "d4", 0, 9, ( short ) 1, ( short ) 1, 0.1, 1 );
1083 final Domain d6 = new BasicDomain( "d4", 4, 5, ( short ) 1, ( short ) 1, 0.1, 1 );
1084 final List<Boolean> covered = new ArrayList<Boolean>();
1085 covered.add( true ); // 0
1086 covered.add( false ); // 1
1087 covered.add( true ); // 2
1088 covered.add( false ); // 3
1089 covered.add( true ); // 4
1090 covered.add( true ); // 5
1091 covered.add( false ); // 6
1092 covered.add( true ); // 7
1093 covered.add( true ); // 8
1094 if ( ForesterUtil.isEngulfed( d0, covered ) ) {
1097 if ( ForesterUtil.isEngulfed( d1, covered ) ) {
1100 if ( ForesterUtil.isEngulfed( d2, covered ) ) {
1103 if ( !ForesterUtil.isEngulfed( d3, covered ) ) {
1106 if ( ForesterUtil.isEngulfed( d4, covered ) ) {
1109 if ( ForesterUtil.isEngulfed( d5, covered ) ) {
1112 if ( !ForesterUtil.isEngulfed( d6, covered ) ) {
1115 final Domain a = new BasicDomain( "a", 0, 10, ( short ) 1, ( short ) 1, 0.1, 1 );
1116 final Domain b = new BasicDomain( "b", 8, 20, ( short ) 1, ( short ) 1, 0.2, 1 );
1117 final Domain c = new BasicDomain( "c", 15, 16, ( short ) 1, ( short ) 1, 0.3, 1 );
1118 final Protein abc = new BasicProtein( "abc", "nemve", 0 );
1119 abc.addProteinDomain( a );
1120 abc.addProteinDomain( b );
1121 abc.addProteinDomain( c );
1122 final Protein abc_r1 = ForesterUtil.removeOverlappingDomains( 3, false, abc );
1123 final Protein abc_r2 = ForesterUtil.removeOverlappingDomains( 3, true, abc );
1124 if ( abc.getNumberOfProteinDomains() != 3 ) {
1127 if ( abc_r1.getNumberOfProteinDomains() != 3 ) {
1130 if ( abc_r2.getNumberOfProteinDomains() != 2 ) {
1133 if ( !abc_r2.getProteinDomain( 0 ).getDomainId().equals( "a" ) ) {
1136 if ( !abc_r2.getProteinDomain( 1 ).getDomainId().equals( "b" ) ) {
1139 final Domain d = new BasicDomain( "d", 0, 10, ( short ) 1, ( short ) 1, 0.1, 1 );
1140 final Domain e = new BasicDomain( "e", 8, 20, ( short ) 1, ( short ) 1, 0.3, 1 );
1141 final Domain f = new BasicDomain( "f", 15, 16, ( short ) 1, ( short ) 1, 0.2, 1 );
1142 final Protein def = new BasicProtein( "def", "nemve", 0 );
1143 def.addProteinDomain( d );
1144 def.addProteinDomain( e );
1145 def.addProteinDomain( f );
1146 final Protein def_r1 = ForesterUtil.removeOverlappingDomains( 5, false, def );
1147 final Protein def_r2 = ForesterUtil.removeOverlappingDomains( 5, true, def );
1148 if ( def.getNumberOfProteinDomains() != 3 ) {
1151 if ( def_r1.getNumberOfProteinDomains() != 3 ) {
1154 if ( def_r2.getNumberOfProteinDomains() != 3 ) {
1157 if ( !def_r2.getProteinDomain( 0 ).getDomainId().equals( "d" ) ) {
1160 if ( !def_r2.getProteinDomain( 1 ).getDomainId().equals( "f" ) ) {
1163 if ( !def_r2.getProteinDomain( 2 ).getDomainId().equals( "e" ) ) {
1167 catch ( final Exception e ) {
1168 e.printStackTrace( System.out );
1174 private static final boolean testNHXparsingFromURL2() {
1176 final String s = "https://sites.google.com/site/cmzmasek/home/software/archaeopteryx/examples/simple/simple_1.nh";
1177 final Phylogeny phys[] = AptxUtil.readPhylogeniesFromUrl( new URL( s ),
1181 TAXONOMY_EXTRACTION.NO,
1183 if ( ( phys == null ) || ( phys.length != 5 ) ) {
1186 if ( !phys[ 0 ].toNewHampshire().equals( "((((A,B),C),D),(E,F));" ) ) {
1187 System.out.println( phys[ 0 ].toNewHampshire() );
1190 if ( !phys[ 1 ].toNewHampshire().equals( "((1,2,3),(4,5,6),(7,8,9));" ) ) {
1191 System.out.println( phys[ 1 ].toNewHampshire() );
1194 final Phylogeny phys2[] = AptxUtil.readPhylogeniesFromUrl( new URL( s ),
1198 TAXONOMY_EXTRACTION.NO,
1200 if ( ( phys2 == null ) || ( phys2.length != 5 ) ) {
1203 if ( !phys2[ 0 ].toNewHampshire().equals( "((((A,B),C),D),(E,F));" ) ) {
1204 System.out.println( phys2[ 0 ].toNewHampshire() );
1207 if ( !phys2[ 1 ].toNewHampshire().equals( "((1,2,3),(4,5,6),(7,8,9));" ) ) {
1208 System.out.println( phys2[ 1 ].toNewHampshire() );
1211 final Phylogeny phys3[] = AptxUtil.readPhylogeniesFromUrl( new URL( "http://swisstree.vital-it.ch:80/"
1212 + "SwissTree/ST001/consensus_tree.nhx" ), false, false, false, TAXONOMY_EXTRACTION.NO, false );
1213 if ( ( phys3 == null ) || ( phys3.length != 1 ) ) {
1218 .equals( "((((POP23a_CIOIN_ENSCING00000016202,POP23b_CIOIN_ENSCING00000016169),POP23_CIOSA_ENSCSAVG00000000248),((POP23a_BRAFL_C3ZMF1,POP23b_BRAFL_121417),(((POP3_ORYLA_ENSORLG00000019669,POP3_GASAC_ENSGACG00000014023,POP3_DANRE_Q6JWW1),(POP3_XENTR_B1H1F6,(POP3_CHICK_Q9DG25,(POP3_ORNAN_ENSOANG00000004179,POP3_MONDO_ENSMODG00000018033,((POP3_MOUSE_Q9ES81,POP3_RAT_Q3BCU3),POP3_RABIT_ENSOCUG00000025973,POP3_MACMU_ENSMMUG00000014473,POP3_HUMAN_Q9HBV1))))),(((POP2_GASAC_ENSGACG00000001420,POP2_ORYLA_ENSORLG00000008627,POP2_TAKRU_ENSTRUG00000015933),POP2_DANRE_ENSDARG00000069922),POP2_XENTR_ENSXETG00000018064,(((POP2_TAEGU_ENSTGUG00000013383,POP2_CHICK_Q6T9Z5),POP2_ANOCA_ENSACAG00000003557),((POP2_MACEU_ENSMEUG00000015825,POP2_MONDO_ENSMODG00000018205),((POP2_RABIT_ENSOCUG00000009515,(POP2_RAT_Q6P722,POP2_MOUSE_Q9ES82)),(POP2_MACMU_ENSMMUG00000000905,POP2_HUMAN_Q9HBU9)))))))),((POP1_CIOSA_ENSCSAVG00000000247,POP1_CIOIN_ENSCING00000000496),((POP1_DANRE_Q5PQZ7,(POP1_ORYLA_ENSORLG00000019663,POP1_GASAC_ENSGACG00000014015,POP1_TAKRU_ENSORLG00000019663)),(POP1_XENTR_B1H1G2,(POP1_ANOCA_ENSACAG00000003910,(POP1_TAEGU_ENSTGUG00000012218,POP1_CHICK_Q9DG23)),POP1_ORNAN_ENSOANG00000004180,POP1_MONDO_ENSMODG00000018034,(POP1_RABIT_ENSOCUG00000016944,(POP1_RAT_Q3BCU4,POP1_MOUSE_Q9ES83),(POP1_HUMAN_Q8NE79,POP1_MACMU_ENSMMUG00000014471))))));" ) ) {
1219 System.out.println( phys3[ 0 ].toNewHampshire() );
1222 final Phylogeny phys4[] = AptxUtil.readPhylogeniesFromUrl( new URL( "http://swisstree.vital-it.ch:80/"
1223 + "SwissTree/ST001/consensus_tree.nhx" ), false, false, false, TAXONOMY_EXTRACTION.NO, false );
1224 if ( ( phys4 == null ) || ( phys4.length != 1 ) ) {
1229 .equals( "((((POP23a_CIOIN_ENSCING00000016202,POP23b_CIOIN_ENSCING00000016169),POP23_CIOSA_ENSCSAVG00000000248),((POP23a_BRAFL_C3ZMF1,POP23b_BRAFL_121417),(((POP3_ORYLA_ENSORLG00000019669,POP3_GASAC_ENSGACG00000014023,POP3_DANRE_Q6JWW1),(POP3_XENTR_B1H1F6,(POP3_CHICK_Q9DG25,(POP3_ORNAN_ENSOANG00000004179,POP3_MONDO_ENSMODG00000018033,((POP3_MOUSE_Q9ES81,POP3_RAT_Q3BCU3),POP3_RABIT_ENSOCUG00000025973,POP3_MACMU_ENSMMUG00000014473,POP3_HUMAN_Q9HBV1))))),(((POP2_GASAC_ENSGACG00000001420,POP2_ORYLA_ENSORLG00000008627,POP2_TAKRU_ENSTRUG00000015933),POP2_DANRE_ENSDARG00000069922),POP2_XENTR_ENSXETG00000018064,(((POP2_TAEGU_ENSTGUG00000013383,POP2_CHICK_Q6T9Z5),POP2_ANOCA_ENSACAG00000003557),((POP2_MACEU_ENSMEUG00000015825,POP2_MONDO_ENSMODG00000018205),((POP2_RABIT_ENSOCUG00000009515,(POP2_RAT_Q6P722,POP2_MOUSE_Q9ES82)),(POP2_MACMU_ENSMMUG00000000905,POP2_HUMAN_Q9HBU9)))))))),((POP1_CIOSA_ENSCSAVG00000000247,POP1_CIOIN_ENSCING00000000496),((POP1_DANRE_Q5PQZ7,(POP1_ORYLA_ENSORLG00000019663,POP1_GASAC_ENSGACG00000014015,POP1_TAKRU_ENSORLG00000019663)),(POP1_XENTR_B1H1G2,(POP1_ANOCA_ENSACAG00000003910,(POP1_TAEGU_ENSTGUG00000012218,POP1_CHICK_Q9DG23)),POP1_ORNAN_ENSOANG00000004180,POP1_MONDO_ENSMODG00000018034,(POP1_RABIT_ENSOCUG00000016944,(POP1_RAT_Q3BCU4,POP1_MOUSE_Q9ES83),(POP1_HUMAN_Q8NE79,POP1_MACMU_ENSMMUG00000014471))))));" ) ) {
1230 System.out.println( phys4[ 0 ].toNewHampshire() );
1234 catch ( final Exception e ) {
1235 e.printStackTrace();
1241 private static final boolean testNHXparsingFromURL() {
1243 final String s = "https://sites.google.com/site/cmzmasek/home/software/archaeopteryx/examples/simple/simple_1.nh";
1244 final URL u = new URL( s );
1245 final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
1246 final Phylogeny[] phys = factory.create( u, new NHXParser() );
1247 if ( ( phys == null ) || ( phys.length != 5 ) ) {
1250 if ( !phys[ 0 ].toNewHampshire().equals( "((((A,B),C),D),(E,F));" ) ) {
1251 System.out.println( phys[ 0 ].toNewHampshire() );
1254 if ( !phys[ 1 ].toNewHampshire().equals( "((1,2,3),(4,5,6),(7,8,9));" ) ) {
1255 System.out.println( phys[ 1 ].toNewHampshire() );
1258 final URL u2 = new URL( s );
1259 final Phylogeny[] phys2 = factory.create( u2.openStream(), new NHXParser() );
1260 if ( ( phys2 == null ) || ( phys2.length != 5 ) ) {
1263 if ( !phys2[ 0 ].toNewHampshire().equals( "((((A,B),C),D),(E,F));" ) ) {
1264 System.out.println( phys2[ 0 ].toNewHampshire() );
1267 final PhylogenyFactory factory2 = ParserBasedPhylogenyFactory.getInstance();
1268 final NHXParser p = new NHXParser();
1269 final URL u3 = new URL( s );
1271 if ( !p.hasNext() ) {
1274 if ( !p.next().toNewHampshire().equals( "((((A,B),C),D),(E,F));" ) ) {
1277 if ( !p.hasNext() ) {
1281 if ( !p.hasNext() ) {
1284 if ( !p.next().toNewHampshire().equals( "((((A,B),C),D),(E,F));" ) ) {
1287 if ( !p.next().toNewHampshire().equals( "((1,2,3),(4,5,6),(7,8,9));" ) ) {
1291 if ( !p.hasNext() ) {
1294 if ( !p.next().toNewHampshire().equals( "((((A,B),C),D),(E,F));" ) ) {
1297 if ( !p.next().toNewHampshire().equals( "((1,2,3),(4,5,6),(7,8,9));" ) ) {
1301 catch ( final Exception e ) {
1302 System.out.println( e.toString() );
1303 e.printStackTrace();
1309 private static boolean testOverlapRemoval() {
1311 final Domain d0 = new BasicDomain( "d0", ( short ) 2, ( short ) 5, ( short ) 1, ( short ) 1, 0.1, 1 );
1312 final Domain d1 = new BasicDomain( "d1", ( short ) 7, ( short ) 10, ( short ) 1, ( short ) 1, 0.1, 1 );
1313 final Domain d2 = new BasicDomain( "d2", ( short ) 0, ( short ) 20, ( short ) 1, ( short ) 1, 0.1, 1 );
1314 final Domain d3 = new BasicDomain( "d3", ( short ) 9, ( short ) 10, ( short ) 1, ( short ) 1, 0.1, 1 );
1315 final Domain d4 = new BasicDomain( "d4", ( short ) 7, ( short ) 8, ( short ) 1, ( short ) 1, 0.1, 1 );
1316 final List<Boolean> covered = new ArrayList<Boolean>();
1317 covered.add( true ); // 0
1318 covered.add( false ); // 1
1319 covered.add( true ); // 2
1320 covered.add( false ); // 3
1321 covered.add( true ); // 4
1322 covered.add( true ); // 5
1323 covered.add( false ); // 6
1324 covered.add( true ); // 7
1325 covered.add( true ); // 8
1326 if ( ForesterUtil.calculateOverlap( d0, covered ) != 3 ) {
1329 if ( ForesterUtil.calculateOverlap( d1, covered ) != 2 ) {
1332 if ( ForesterUtil.calculateOverlap( d2, covered ) != 6 ) {
1335 if ( ForesterUtil.calculateOverlap( d3, covered ) != 0 ) {
1338 if ( ForesterUtil.calculateOverlap( d4, covered ) != 2 ) {
1341 final Domain a = new BasicDomain( "a", ( short ) 2, ( short ) 5, ( short ) 1, ( short ) 1, 1, -1 );
1342 final Domain b = new BasicDomain( "b", ( short ) 2, ( short ) 10, ( short ) 1, ( short ) 1, 0.1, -1 );
1343 final Protein ab = new BasicProtein( "ab", "varanus", 0 );
1344 ab.addProteinDomain( a );
1345 ab.addProteinDomain( b );
1346 final Protein ab_s0 = ForesterUtil.removeOverlappingDomains( 3, false, ab );
1347 if ( ab.getNumberOfProteinDomains() != 2 ) {
1350 if ( ab_s0.getNumberOfProteinDomains() != 1 ) {
1353 if ( !ab_s0.getProteinDomain( 0 ).getDomainId().equals( "b" ) ) {
1356 final Protein ab_s1 = ForesterUtil.removeOverlappingDomains( 4, false, ab );
1357 if ( ab.getNumberOfProteinDomains() != 2 ) {
1360 if ( ab_s1.getNumberOfProteinDomains() != 2 ) {
1363 final Domain c = new BasicDomain( "c", ( short ) 20000, ( short ) 20500, ( short ) 1, ( short ) 1, 10, 1 );
1364 final Domain d = new BasicDomain( "d",
1371 final Domain e = new BasicDomain( "e", ( short ) 5000, ( short ) 5500, ( short ) 1, ( short ) 1, 0.0001, 1 );
1372 final Protein cde = new BasicProtein( "cde", "varanus", 0 );
1373 cde.addProteinDomain( c );
1374 cde.addProteinDomain( d );
1375 cde.addProteinDomain( e );
1376 final Protein cde_s0 = ForesterUtil.removeOverlappingDomains( 0, false, cde );
1377 if ( cde.getNumberOfProteinDomains() != 3 ) {
1380 if ( cde_s0.getNumberOfProteinDomains() != 3 ) {
1383 final Domain f = new BasicDomain( "f", ( short ) 10, ( short ) 20, ( short ) 1, ( short ) 1, 10, 1 );
1384 final Domain g = new BasicDomain( "g", ( short ) 10, ( short ) 20, ( short ) 1, ( short ) 1, 0.01, 1 );
1385 final Domain h = new BasicDomain( "h", ( short ) 10, ( short ) 20, ( short ) 1, ( short ) 1, 0.0001, 1 );
1386 final Domain i = new BasicDomain( "i", ( short ) 10, ( short ) 20, ( short ) 1, ( short ) 1, 0.5, 1 );
1387 final Domain i2 = new BasicDomain( "i", ( short ) 5, ( short ) 30, ( short ) 1, ( short ) 1, 0.5, 10 );
1388 final Protein fghi = new BasicProtein( "fghi", "varanus", 0 );
1389 fghi.addProteinDomain( f );
1390 fghi.addProteinDomain( g );
1391 fghi.addProteinDomain( h );
1392 fghi.addProteinDomain( i );
1393 fghi.addProteinDomain( i );
1394 fghi.addProteinDomain( i );
1395 fghi.addProteinDomain( i2 );
1396 final Protein fghi_s0 = ForesterUtil.removeOverlappingDomains( 10, false, fghi );
1397 if ( fghi.getNumberOfProteinDomains() != 7 ) {
1400 if ( fghi_s0.getNumberOfProteinDomains() != 1 ) {
1403 if ( !fghi_s0.getProteinDomain( 0 ).getDomainId().equals( "h" ) ) {
1406 final Protein fghi_s1 = ForesterUtil.removeOverlappingDomains( 11, false, fghi );
1407 if ( fghi.getNumberOfProteinDomains() != 7 ) {
1410 if ( fghi_s1.getNumberOfProteinDomains() != 7 ) {
1413 final Domain j = new BasicDomain( "j", ( short ) 10, ( short ) 20, ( short ) 1, ( short ) 1, 10, 1 );
1414 final Domain k = new BasicDomain( "k", ( short ) 10, ( short ) 20, ( short ) 1, ( short ) 1, 0.01, 1 );
1415 final Domain l = new BasicDomain( "l", ( short ) 10, ( short ) 20, ( short ) 1, ( short ) 1, 0.0001, 1 );
1416 final Domain m = new BasicDomain( "m", ( short ) 10, ( short ) 20, ( short ) 1, ( short ) 4, 0.5, 1 );
1417 final Domain m0 = new BasicDomain( "m", ( short ) 10, ( short ) 20, ( short ) 2, ( short ) 4, 0.5, 1 );
1418 final Domain m1 = new BasicDomain( "m", ( short ) 10, ( short ) 20, ( short ) 3, ( short ) 4, 0.5, 1 );
1419 final Domain m2 = new BasicDomain( "m", ( short ) 5, ( short ) 30, ( short ) 4, ( short ) 4, 0.5, 10 );
1420 final Protein jklm = new BasicProtein( "jklm", "varanus", 0 );
1421 jklm.addProteinDomain( j );
1422 jklm.addProteinDomain( k );
1423 jklm.addProteinDomain( l );
1424 jklm.addProteinDomain( m );
1425 jklm.addProteinDomain( m0 );
1426 jklm.addProteinDomain( m1 );
1427 jklm.addProteinDomain( m2 );
1428 final Protein jklm_s0 = ForesterUtil.removeOverlappingDomains( 10, false, jklm );
1429 if ( jklm.getNumberOfProteinDomains() != 7 ) {
1432 if ( jklm_s0.getNumberOfProteinDomains() != 1 ) {
1435 if ( !jklm_s0.getProteinDomain( 0 ).getDomainId().equals( "l" ) ) {
1438 final Protein jklm_s1 = ForesterUtil.removeOverlappingDomains( 11, false, jklm );
1439 if ( jklm.getNumberOfProteinDomains() != 7 ) {
1442 if ( jklm_s1.getNumberOfProteinDomains() != 7 ) {
1445 final Domain only = new BasicDomain( "only", ( short ) 5, ( short ) 30, ( short ) 4, ( short ) 4, 0.5, 10 );
1446 final Protein od = new BasicProtein( "od", "varanus", 0 );
1447 od.addProteinDomain( only );
1448 final Protein od_s0 = ForesterUtil.removeOverlappingDomains( 0, false, od );
1449 if ( od.getNumberOfProteinDomains() != 1 ) {
1452 if ( od_s0.getNumberOfProteinDomains() != 1 ) {
1456 catch ( final Exception e ) {
1457 e.printStackTrace( System.out );
1463 private static final boolean testPfamTreeReading() {
1465 final URL u = new URL( WebserviceUtil.PFAM_SERVER + "/family/PF" + "01849" + "/tree/download" );
1466 final NHXParser parser = new NHXParser();
1467 parser.setTaxonomyExtraction( NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
1468 parser.setReplaceUnderscores( false );
1469 parser.setGuessRootedness( true );
1470 final Phylogeny[] phys = ForesterUtil.readPhylogeniesFromUrl( u, parser);
1471 if ( ( phys == null ) || ( phys.length != 1 ) ) {
1474 if ( phys[ 0 ].getNumberOfExternalNodes() < 10 ) {
1478 catch ( final Exception e ) {
1479 e.printStackTrace();
1485 private static final boolean testPhyloXMLparsingFromURL() {
1487 final String s = "https://sites.google.com/site/cmzmasek/home/software/archaeopteryx/examples/archaeopteryx_a/apaf_bcl2.xml";
1488 final URL u = new URL( s );
1489 final Phylogeny[] phys = ForesterUtil.readPhylogeniesFromUrl( u, PhyloXmlParser.createPhyloXmlParser() );
1491 if ( ( phys == null ) || ( phys.length != 2 ) ) {
1494 final Phylogeny[] phys2 = ForesterUtil.readPhylogeniesFromUrl( u, PhyloXmlParser.createPhyloXmlParser() );
1496 if ( ( phys2 == null ) || ( phys2.length != 2 ) ) {
1500 catch ( final Exception e ) {
1501 e.printStackTrace();
1507 private static final boolean testToLReading() {
1509 final URL u = new URL( WebserviceUtil.TOL_URL_BASE + "15079" );
1510 final Phylogeny[] phys = ForesterUtil.readPhylogeniesFromUrl( u, new TolParser() );
1511 if ( ( phys == null ) || ( phys.length != 1 ) ) {
1514 if ( !phys[ 0 ].getRoot().getNodeData().getTaxonomy().getIdentifier().getValue().equals( "15079" ) ) {
1517 if ( !phys[ 0 ].getRoot().getNodeData().getTaxonomy().getScientificName().equals( "Protacanthopterygii" ) ) {
1520 if ( phys[ 0 ].getNumberOfExternalNodes() < 5 ) {
1524 final URL u2 = new URL( WebserviceUtil.TOL_URL_BASE + "17706" );
1525 final Phylogeny[] phys2 = ForesterUtil.readPhylogeniesFromUrl( u2, new TolParser() );
1526 if ( ( phys2 == null ) || ( phys2.length != 1 ) ) {
1529 if ( !phys2[ 0 ].getRoot().getNodeData().getTaxonomy().getIdentifier().getValue().equals( "17706" ) ) {
1532 if ( phys2[ 0 ].getNumberOfExternalNodes() < 5 ) {
1536 catch ( final Exception e ) {
1537 e.printStackTrace();
1543 private static final boolean testTreeBaseReading() {
1545 final URL u = new URL( WebserviceUtil.TREEBASE_PHYLOWS_TREE_URL_BASE + "72557?format=nexus" );
1546 final NexusPhylogeniesParser parser = new NexusPhylogeniesParser();
1547 parser.setReplaceUnderscores( true );
1548 final Phylogeny[] phys = ForesterUtil.readPhylogeniesFromUrl( u, parser );
1549 if ( ( phys == null ) || ( phys.length != 1 ) ) {
1552 final URL u_1 = new URL( WebserviceUtil.TREEBASE_PHYLOWS_TREE_URL_BASE + "2406?format=nexus" );
1553 final NexusPhylogeniesParser parser_1 = new NexusPhylogeniesParser();
1554 final Phylogeny[] phys_1 = ForesterUtil.readPhylogeniesFromUrl( u_1, parser_1 );
1555 if ( ( phys_1 == null ) || ( phys_1.length != 1 ) ) {
1558 final URL u_2 = new URL( WebserviceUtil.TREEBASE_PHYLOWS_TREE_URL_BASE + "422?format=nexus" );
1559 final NexusPhylogeniesParser parser_2 = new NexusPhylogeniesParser();
1560 final Phylogeny[] phys_2 = ForesterUtil.readPhylogeniesFromUrl( u_2, parser_2 );
1561 if ( ( phys_2 == null ) || ( phys_2.length != 1 ) ) {
1564 final URL u_3 = new URL( WebserviceUtil.TREEBASE_PHYLOWS_TREE_URL_BASE + "2654?format=nexus" );
1565 final NexusPhylogeniesParser parser_3 = new NexusPhylogeniesParser();
1566 final Phylogeny[] phys_3 = ForesterUtil.readPhylogeniesFromUrl( u_3, parser_3 );
1567 if ( ( phys_3 == null ) || ( phys_3.length != 1 ) ) {
1570 final URL u_4 = new URL( WebserviceUtil.TREEBASE_PHYLOWS_TREE_URL_BASE + "825?format=nexus" );
1571 final NexusPhylogeniesParser parser_4 = new NexusPhylogeniesParser();
1572 final Phylogeny[] phys_4 = ForesterUtil.readPhylogeniesFromUrl( u_4, parser_4 );
1573 if ( ( phys_4 == null ) || ( phys_4.length != 1 ) ) {
1576 final URL u2 = new URL( WebserviceUtil.TREEBASE_PHYLOWS_STUDY_URL_BASE + "15613?format=nexus" );
1577 final NexusPhylogeniesParser parser2 = new NexusPhylogeniesParser();
1578 parser2.setReplaceUnderscores( true );
1579 final Phylogeny[] phys2 = ForesterUtil.readPhylogeniesFromUrl( u2, parser2 );
1580 if ( ( phys2 == null ) || ( phys2.length != 9 ) ) {
1583 final URL u3 = new URL( WebserviceUtil.TREEBASE_PHYLOWS_STUDY_URL_BASE + "14909?format=nexus" );
1584 final NexusPhylogeniesParser parser3 = new NexusPhylogeniesParser();
1585 final Phylogeny[] phys3 = ForesterUtil.readPhylogeniesFromUrl( u3, parser3 );
1586 if ( ( phys3 == null ) || ( phys3.length != 2 ) ) {
1589 final Phylogeny[] phys4 = ForesterUtil.readPhylogeniesFromUrl( new URL( WebserviceUtil.TREEBASE_PHYLOWS_STUDY_URL_BASE + "14525?format=nexus" ),
1590 new NexusPhylogeniesParser() );
1591 if ( ( phys4 == null ) || ( phys4.length != 1 ) ) {
1594 final Phylogeny[] phys5 = ForesterUtil.readPhylogeniesFromUrl( new URL( WebserviceUtil.TREEBASE_PHYLOWS_STUDY_URL_BASE + "15632?format=nexus" ) ,
1595 new NexusPhylogeniesParser() );
1596 if ( ( phys5 == null ) || ( phys5.length != 1 ) ) {
1599 final Phylogeny[] phys6 = ForesterUtil.readPhylogeniesFromUrl( new URL( WebserviceUtil.TREEBASE_PHYLOWS_STUDY_URL_BASE + "10190?format=nexus" ) ,
1600 new NexusPhylogeniesParser() );
1601 if ( ( phys6 == null ) || ( phys6.length != 1 ) ) {
1604 final Phylogeny[] phys7 = ForesterUtil.readPhylogeniesFromUrl( new URL( WebserviceUtil.TREEBASE_PHYLOWS_STUDY_URL_BASE + "13246?format=nexus" ) ,
1605 new NexusPhylogeniesParser() );
1606 if ( ( phys7 == null ) || ( phys7.length != 2 ) ) {
1609 final Phylogeny[] phys8 = ForesterUtil.readPhylogeniesFromUrl( new URL( WebserviceUtil.TREEBASE_PHYLOWS_STUDY_URL_BASE + "11662?format=nexus" ) ,
1610 new NexusPhylogeniesParser() );
1611 if ( ( phys8 == null ) || ( phys8.length != 2 ) ) {
1614 final Phylogeny[] phys9 = ForesterUtil.readPhylogeniesFromUrl( new URL( WebserviceUtil.TREEBASE_PHYLOWS_STUDY_URL_BASE + "562?format=nexus" ) ,
1615 new NexusPhylogeniesParser() );
1616 if ( ( phys9 == null ) || ( phys9.length != 4 ) ) {
1619 final Phylogeny[] phys16424 = ForesterUtil.readPhylogeniesFromUrl( new URL( WebserviceUtil.TREEBASE_PHYLOWS_STUDY_URL_BASE + "16424?format=nexus" ) ,
1620 new NexusPhylogeniesParser() );
1621 if ( ( phys16424 == null ) || ( phys16424.length != 1 ) ) {
1624 final Phylogeny[] phys17878 = ForesterUtil.readPhylogeniesFromUrl( new URL( WebserviceUtil.TREEBASE_PHYLOWS_STUDY_URL_BASE + "17878?format=nexus" ) ,
1625 new NexusPhylogeniesParser() );
1626 if ( ( phys17878 == null ) || ( phys17878.length != 17 ) ) {
1629 final Phylogeny[] phys18804 = ForesterUtil.readPhylogeniesFromUrl( new URL( WebserviceUtil.TREEBASE_PHYLOWS_STUDY_URL_BASE + "18804?format=nexus" ) ,
1630 new NexusPhylogeniesParser() );
1631 if ( ( phys18804 == null ) || ( phys18804.length != 2 ) ) {
1634 final Phylogeny[] phys346 = ForesterUtil.readPhylogeniesFromUrl( new URL( WebserviceUtil.TREEBASE_PHYLOWS_STUDY_URL_BASE + "346?format=nexus" ) ,
1635 new NexusPhylogeniesParser() );
1636 if ( ( phys346 == null ) || ( phys346.length != 1 ) ) {
1640 catch ( final Exception e ) {
1641 e.printStackTrace();
1647 private static final boolean testTreeFamReading() {
1649 final URL u = new URL( WebserviceUtil.TREE_FAM_URL_BASE + "101004" + "/tree/newick" );
1650 final NHXParser parser = new NHXParser();
1651 parser.setTaxonomyExtraction( NHXParser.TAXONOMY_EXTRACTION.NO );
1652 parser.setReplaceUnderscores( false );
1653 parser.setGuessRootedness( true );
1654 final Phylogeny[] phys = ForesterUtil.readPhylogeniesFromUrl( u, parser );
1655 if ( ( phys == null ) || ( phys.length != 1 ) ) {
1658 if ( phys[ 0 ].getNumberOfExternalNodes() < 10 ) {
1662 catch ( final Exception e ) {
1663 e.printStackTrace();
1669 private final static Phylogeny createPhylogeny( final String nhx ) throws IOException {
1670 final Phylogeny p = ParserBasedPhylogenyFactory.getInstance().create( nhx, new NHXParser() )[ 0 ];
1674 private final static Event getEvent( final Phylogeny p, final String n1, final String n2 ) {
1675 return PhylogenyMethods.calculateLCA( p.getNode( n1 ), p.getNode( n2 ) ).getNodeData().getEvent();
1678 private static boolean testAminoAcidSequence() {
1680 final MolecularSequence aa1 = BasicSequence.createAaSequence( "aa1", "aAklm-?xX*z$#" );
1681 if ( aa1.getLength() != 13 ) {
1684 if ( aa1.getResidueAt( 0 ) != 'A' ) {
1687 if ( aa1.getResidueAt( 2 ) != 'K' ) {
1690 if ( !new String( aa1.getMolecularSequence() ).equals( "AAKLM-XXX*ZXX" ) ) {
1693 final MolecularSequence aa2 = BasicSequence.createAaSequence( "aa3", "ARNDCQEGHILKMFPSTWYVX*-BZOJU" );
1694 if ( !new String( aa2.getMolecularSequence() ).equals( "ARNDCQEGHILKMFPSTWYVX*-BZOXU" ) ) {
1697 final MolecularSequence dna1 = BasicSequence.createDnaSequence( "dna1", "ACGTUX*-?RYMKWSN" );
1698 if ( !new String( dna1.getMolecularSequence() ).equals( "ACGTNN*-NRYMKWSN" ) ) {
1701 final MolecularSequence rna1 = BasicSequence.createRnaSequence( "rna1", "..ACGUTX*-?RYMKWSN" );
1702 if ( !new String( rna1.getMolecularSequence() ).equals( "--ACGUNN*-NRYMKWSN" ) ) {
1706 catch ( final Exception e ) {
1707 e.printStackTrace();
1713 private static boolean testBasicDomain() {
1715 final Domain pd = new BasicDomain( "id", 23, 25, ( short ) 1, ( short ) 4, 0.1, -12 );
1716 if ( !pd.getDomainId().equals( "id" ) ) {
1719 if ( pd.getNumber() != 1 ) {
1722 if ( pd.getTotalCount() != 4 ) {
1725 if ( !pd.equals( new BasicDomain( "id", 22, 111, ( short ) 1, ( short ) 4, 0.2, -12 ) ) ) {
1728 final Domain a1 = new BasicDomain( "a", 1, 10, ( short ) 1, ( short ) 4, 0.1, -12 );
1729 final BasicDomain a1_copy = new BasicDomain( "a", 1, 10, ( short ) 1, ( short ) 4, 0.1, -12 );
1730 final BasicDomain a1_equal = new BasicDomain( "a", 524, 743994, ( short ) 1, ( short ) 300, 3.0005, 230 );
1731 final BasicDomain a2 = new BasicDomain( "a", 1, 10, ( short ) 2, ( short ) 4, 0.1, -12 );
1732 final BasicDomain a3 = new BasicDomain( "A", 1, 10, ( short ) 1, ( short ) 4, 0.1, -12 );
1733 if ( !a1.equals( a1 ) ) {
1736 if ( !a1.equals( a1_copy ) ) {
1739 if ( !a1.equals( a1_equal ) ) {
1742 if ( !a1.equals( a2 ) ) {
1745 if ( a1.equals( a3 ) ) {
1748 if ( a1.compareTo( a1 ) != 0 ) {
1751 if ( a1.compareTo( a1_copy ) != 0 ) {
1754 if ( a1.compareTo( a1_equal ) != 0 ) {
1757 if ( a1.compareTo( a2 ) != 0 ) {
1760 if ( a1.compareTo( a3 ) == 0 ) {
1764 catch ( final Exception e ) {
1765 e.printStackTrace( System.out );
1771 private static boolean testBasicNodeMethods() {
1773 if ( PhylogenyNode.getNodeCount() != 0 ) {
1776 final PhylogenyNode n1 = new PhylogenyNode();
1777 final PhylogenyNode n2 = PhylogenyNode
1778 .createInstanceFromNhxString( "", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
1779 final PhylogenyNode n3 = PhylogenyNode
1780 .createInstanceFromNhxString( "n3", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
1781 final PhylogenyNode n4 = PhylogenyNode
1782 .createInstanceFromNhxString( "n4:0.01", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
1783 if ( n1.isHasAssignedEvent() ) {
1786 if ( PhylogenyNode.getNodeCount() != 4 ) {
1789 if ( n3.getIndicator() != 0 ) {
1792 if ( n3.getNumberOfExternalNodes() != 1 ) {
1795 if ( !n3.isExternal() ) {
1798 if ( !n3.isRoot() ) {
1801 if ( !n4.getName().equals( "n4" ) ) {
1805 catch ( final Exception e ) {
1806 e.printStackTrace( System.out );
1812 private static boolean testUTF8ParsingFromFile() {
1814 final PhyloXmlParser xml_parser = PhyloXmlParser.createPhyloXmlParser();
1815 final Phylogeny[] phylogenies_xml = ParserBasedPhylogenyFactory.getInstance().create( new File( Test.PATH_TO_TEST_DATA + "chars.xml" ),
1817 if ( xml_parser.getErrorCount() > 0 ) {
1818 System.out.println( xml_parser.getErrorMessages().toString() );
1821 if ( phylogenies_xml.length != 1 ) {
1825 final Phylogeny[] phylogenies_xml2 = ParserBasedPhylogenyFactory.getInstance().create( new StringBuffer( phylogenies_xml[0].toPhyloXML( 0 )),
1828 final Phylogeny[] phylogenies_nh = ParserBasedPhylogenyFactory.getInstance().create( new File( Test.PATH_TO_TEST_DATA + "chars.nh" ), new NHXParser() );
1829 if ( phylogenies_nh.length != 1 ) {
1833 final Phylogeny[] phylogenies_nex = ParserBasedPhylogenyFactory.getInstance().create( new File( Test.PATH_TO_TEST_DATA + "chars.nex" ), new NexusPhylogeniesParser() );
1834 if ( phylogenies_nex.length != 1 ) {
1838 final String[] xml_n = phylogenies_xml[0].getAllExternalNodeNames();
1839 final String[] xml_n2 = phylogenies_xml2[0].getAllExternalNodeNames();
1840 final String[] nh_n = phylogenies_nh[0].getAllExternalNodeNames();
1841 final String[] nex_n = phylogenies_nex[0].getAllExternalNodeNames();
1842 final String n0 = "AQ~!@#$%^&*()_+-=\\{}|;:\"<>?,./";
1843 final String n1 = "€‚ƒ„…†‡ˆ‰Š‹ŒŽ‘’“”•–—˜˜˜™š›œžŸ¡¢£¤¥¦§¨©ª«¬®¯°±¹²³´µ¶·¸º»¼¿À÷þÿ";
1844 final String n2 = "漢字ひらがなカタカナ";
1845 final String n3 = "อักษรไทย";
1846 final String n4 = "繁體字";
1847 final String n5 = "한글";
1848 final String n6 = "देवनागरी";
1850 final String n7 = "chữ Quốc ngữ";
1851 final String n8 = "ру́сский язы́к";
1852 final String n9 = "អក្សរខ្មែរ";
1854 if ( !xml_n[0].equals( n0 ) ) {
1855 System.out.println( xml_n[0] );
1856 System.out.println( n0 );
1859 if ( !xml_n2[0].equals( n0 ) ) {
1860 System.out.println( xml_n2[0] );
1861 System.out.println( n0 );
1864 if ( !nh_n[0].equals( n0 ) ) {
1865 System.out.println( nh_n[0] );
1866 System.out.println( n0 );
1869 if ( !nex_n[0].equals( n0 ) ) {
1870 System.out.println( nex_n[0] );
1871 System.out.println( n0 );
1875 if ( !xml_n[1].equals( n1 ) ) {
1876 System.out.println( xml_n[1] );
1877 System.out.println( n1 );
1880 if ( !xml_n2[1].equals( n1 ) ) {
1881 System.out.println( xml_n2[1] );
1882 System.out.println( n1 );
1885 if ( !nh_n[1].equals( n1 ) ) {
1886 System.out.println( nh_n[1] );
1887 System.out.println( n1 );
1890 if ( !nex_n[1].equals( n1 ) ) {
1891 System.out.println( nex_n[1] );
1892 System.out.println( n1 );
1896 if ( !xml_n[2].equals( n2 ) ) {
1897 System.out.println( xml_n[2] );
1898 System.out.println( n2 );
1901 if ( !xml_n2[2].equals( n2 ) ) {
1902 System.out.println( xml_n2[2] );
1903 System.out.println( n2 );
1906 if ( !nh_n[2].equals( n2 ) ) {
1907 System.out.println( nh_n[2] );
1908 System.out.println( n2 );
1911 if ( !nex_n[2].equals( n2 ) ) {
1912 System.out.println( nex_n[2] );
1913 System.out.println( n2 );
1917 if ( !xml_n[3].equals( n3 ) ) {
1918 System.out.println( xml_n[3] );
1919 System.out.println( n3 );
1922 if ( !xml_n2[3].equals( n3 ) ) {
1923 System.out.println( xml_n2[3] );
1924 System.out.println( n3 );
1927 if ( !nh_n[3].equals( n3 ) ) {
1928 System.out.println( nh_n[3] );
1929 System.out.println( n3 );
1932 if ( !nex_n[3].equals( n3 ) ) {
1933 System.out.println( nex_n[3] );
1934 System.out.println( n3 );
1938 if ( !xml_n[4].equals( n4 ) ) {
1939 System.out.println( xml_n[4] );
1940 System.out.println( n4 );
1943 if ( !nh_n[4].equals( n4 ) ) {
1944 System.out.println( nh_n[4] );
1945 System.out.println( n4 );
1948 if ( !nex_n[4].equals( n4 ) ) {
1949 System.out.println( nex_n[4] );
1950 System.out.println( n4 );
1954 if ( !xml_n[5].equals( n5 ) ) {
1955 System.out.println( xml_n[5] );
1956 System.out.println( n5 );
1959 if ( !nh_n[5].equals( n5 ) ) {
1960 System.out.println( nh_n[5] );
1961 System.out.println( n5 );
1964 if ( !nex_n[5].equals( n5 ) ) {
1965 System.out.println( nex_n[5] );
1966 System.out.println( n5 );
1970 if ( !xml_n[6].equals( n6 ) ) {
1971 System.out.println( xml_n[6] );
1972 System.out.println( n6 );
1975 if ( !nh_n[6].equals( n6 ) ) {
1976 System.out.println( nh_n[6] );
1977 System.out.println( n6 );
1980 if ( !nex_n[6].equals( n6 ) ) {
1981 System.out.println( nex_n[6] );
1982 System.out.println( n6 );
1986 if ( !xml_n[7].equals( n7 ) ) {
1987 System.out.println( xml_n[7] );
1988 System.out.println( n7 );
1991 if ( !nh_n[7].equals( n7 ) ) {
1992 System.out.println( nh_n[7] );
1993 System.out.println( n7 );
1996 if ( !nex_n[7].equals( n7 ) ) {
1997 System.out.println( nex_n[7] );
1998 System.out.println( n7 );
2001 if ( !xml_n[8].equals( n8 ) ) {
2002 System.out.println( xml_n[8] );
2003 System.out.println( n8 );
2006 if ( !nh_n[8].equals( n8 ) ) {
2007 System.out.println( nh_n[8] );
2008 System.out.println( n8 );
2011 if ( !nex_n[8].equals( n8 ) ) {
2012 System.out.println( nex_n[8] );
2013 System.out.println( n8 );
2016 if ( !xml_n[9].equals( n9 ) ) {
2017 System.out.println( xml_n[9] );
2018 System.out.println( n9 );
2021 if ( !xml_n2[9].equals( n9 ) ) {
2022 System.out.println( xml_n2[9] );
2023 System.out.println( n9 );
2026 if ( !nh_n[9].equals( n9 ) ) {
2027 System.out.println( nh_n[9] );
2028 System.out.println( n9 );
2031 if ( !nex_n[9].equals( n9 ) ) {
2032 System.out.println( nex_n[9] );
2033 System.out.println( n9 );
2036 if (!phylogenies_xml[0].toNewHampshire().equals(
2037 phylogenies_nh[0].toNewHampshire() ) ) {
2038 System.out.println( phylogenies_xml[0].toNewHampshire() );
2039 System.out.println( phylogenies_nh[0].toNewHampshire() );
2042 if (!phylogenies_xml[0].toNewHampshire().equals(
2043 phylogenies_nex[0].toNewHampshire() ) ) {
2044 System.out.println( phylogenies_xml[0].toNewHampshire() );
2045 System.out.println( phylogenies_nex[0].toNewHampshire() );
2049 catch ( final Exception e ) {
2050 e.printStackTrace( System.out );
2058 private static boolean testBasicPhyloXMLparsing() {
2060 final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
2061 final PhyloXmlParser xml_parser = PhyloXmlParser.createPhyloXmlParser();
2062 final Phylogeny[] phylogenies_0 = factory.create( new File( Test.PATH_TO_TEST_DATA + "phyloxml_test_t1.xml" ),
2064 if ( xml_parser.getErrorCount() > 0 ) {
2065 System.out.println( xml_parser.getErrorMessages().toString() );
2068 if ( phylogenies_0.length != 4 ) {
2071 final Phylogeny t1 = phylogenies_0[ 0 ];
2072 final Phylogeny t2 = phylogenies_0[ 1 ];
2073 final Phylogeny t3 = phylogenies_0[ 2 ];
2074 final Phylogeny t4 = phylogenies_0[ 3 ];
2075 if ( t1.getNumberOfExternalNodes() != 1 ) {
2078 if ( !t1.isRooted() ) {
2081 if ( t1.isRerootable() ) {
2084 if ( !t1.getType().equals( "gene_tree" ) ) {
2087 if ( t2.getNumberOfExternalNodes() != 2 ) {
2090 if ( !isEqual( t2.getNode( "node a" ).getDistanceToParent(), 1.0 ) ) {
2093 if ( !isEqual( t2.getNode( "node b" ).getDistanceToParent(), 2.0 ) ) {
2096 if ( t2.getNode( "node a" ).getNodeData().getTaxonomies().size() != 2 ) {
2099 if ( !t2.getNode( "node a" ).getNodeData().getTaxonomy( 0 ).getCommonName().equals( "some parasite" ) ) {
2102 if ( !t2.getNode( "node a" ).getNodeData().getTaxonomy( 1 ).getCommonName().equals( "the host" ) ) {
2105 if ( t2.getNode( "node a" ).getNodeData().getSequences().size() != 2 ) {
2108 if ( !t2.getNode( "node a" ).getNodeData().getSequence( 0 ).getMolecularSequence()
2109 .startsWith( "actgtgggggt" ) ) {
2112 if ( !t2.getNode( "node a" ).getNodeData().getSequence( 1 ).getMolecularSequence()
2113 .startsWith( "ctgtgatgcat" ) ) {
2116 if ( t3.getNumberOfExternalNodes() != 4 ) {
2119 if ( !t1.getName().equals( "t1" ) ) {
2122 if ( !t2.getName().equals( "t2" ) ) {
2125 if ( !t3.getName().equals( "t3" ) ) {
2128 if ( !t4.getName().equals( "t4" ) ) {
2131 if ( !t3.getIdentifier().getValue().equals( "1-1" ) ) {
2134 if ( !t3.getIdentifier().getProvider().equals( "treebank" ) ) {
2137 if ( !t3.getNode( "root node" ).isDuplication() ) {
2140 if ( !t3.getNode( "node a" ).isDuplication() ) {
2143 if ( t3.getNode( "node a" ).isSpeciation() ) {
2146 if ( t3.getNode( "node bc" ).isDuplication() ) {
2149 if ( !t3.getNode( "node bc" ).isSpeciation() ) {
2152 if ( !t3.getNode( "root node" ).getNodeData().getSequence().getType().equals( "protein" ) ) {
2155 if ( !t3.getNode( "root node" ).getNodeData().getSequence().getName()
2156 .equals( "Apoptosis facilitator Bcl-2-like 14 protein" ) ) {
2159 if ( !t3.getNode( "root node" ).getNodeData().getSequence().getSymbol().equals( "BCL2L14" ) ) {
2162 if ( !t3.getNode( "root node" ).getNodeData().getSequence().getAccession().getValue().equals( "Q9BZR8" ) ) {
2165 if ( !t3.getNode( "root node" ).getNodeData().getSequence().getAccession().getSource().equals( "UniProtKB" ) ) {
2168 if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getDesc()
2169 .equals( "apoptosis" ) ) {
2172 if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getRef()
2173 .equals( "GO:0006915" ) ) {
2176 if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getSource()
2177 .equals( "UniProtKB" ) ) {
2180 if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getEvidence()
2181 .equals( "experimental" ) ) {
2184 if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getType()
2185 .equals( "function" ) ) {
2188 if ( ( t3.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getConfidence()
2189 .getValue() != 1 ) {
2192 if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getConfidence()
2193 .getType().equals( "ml" ) ) {
2196 if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getDesc()
2197 .equals( "apoptosis" ) ) {
2200 if ( ( t3.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getProperties()
2201 .getProperty( "AFFY:expression" ).getAppliesTo() != AppliesTo.ANNOTATION ) {
2204 if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getProperties()
2205 .getProperty( "AFFY:expression" ).getDataType().equals( "xsd:double" ) ) {
2208 if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getProperties()
2209 .getProperty( "AFFY:expression" ).getRef().equals( "AFFY:expression" ) ) {
2212 if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getProperties()
2213 .getProperty( "AFFY:expression" ).getUnit().equals( "AFFY:x" ) ) {
2216 if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getProperties()
2217 .getProperty( "AFFY:expression" ).getValue().equals( "0.2" ) ) {
2220 if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getProperties()
2221 .getProperty( "MED:disease" ).getValue().equals( "lymphoma" ) ) {
2224 if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 1 ) ).getRef()
2225 .equals( "GO:0005829" ) ) {
2228 if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 0 ) ).getDesc()
2229 .equals( "intracellular organelle" ) ) {
2232 if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getUri( 0 ).getType().equals( "source" ) ) ) {
2235 if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getUri( 0 ).getDescription()
2236 .equals( "UniProt link" ) ) ) {
2239 if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getLocation().equals( "12p13-p12" ) ) ) {
2242 final SortedSet<Accession> x = t3.getNode( "root node" ).getNodeData().getSequence().getCrossReferences();
2243 if ( x.size() != 4 ) {
2247 for( final Accession acc : x ) {
2249 if ( !acc.getSource().equals( "KEGG" ) ) {
2252 if ( !acc.getValue().equals( "hsa:596" ) ) {
2259 catch ( final Exception e ) {
2260 e.printStackTrace( System.out );
2266 private static boolean testBasicPhyloXMLparsingRoundtrip() {
2268 final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
2269 final PhyloXmlParser xml_parser = PhyloXmlParser.createPhyloXmlParser();
2270 if ( USE_LOCAL_PHYLOXML_SCHEMA ) {
2271 xml_parser.setValidateAgainstSchema( PHYLOXML_LOCAL_XSD );
2274 xml_parser.setValidateAgainstSchema( PHYLOXML_REMOTE_XSD );
2276 final Phylogeny[] phylogenies_0 = factory.create( new File( Test.PATH_TO_TEST_DATA + "phyloxml_test_t1.xml" ),
2278 if ( xml_parser.getErrorCount() > 0 ) {
2279 System.out.println( xml_parser.getErrorMessages().toString() );
2282 if ( phylogenies_0.length != 4 ) {
2285 final StringBuffer t1_sb = new StringBuffer( phylogenies_0[ 0 ].toPhyloXML( 0 ) );
2286 final Phylogeny[] phylogenies_t1 = factory.create( t1_sb, xml_parser );
2287 if ( phylogenies_t1.length != 1 ) {
2290 final Phylogeny t1_rt = phylogenies_t1[ 0 ];
2291 if ( !t1_rt.getDistanceUnit().equals( "cc" ) ) {
2294 if ( !t1_rt.isRooted() ) {
2297 if ( t1_rt.isRerootable() ) {
2300 if ( !t1_rt.getType().equals( "gene_tree" ) ) {
2303 final StringBuffer t2_sb = new StringBuffer( phylogenies_0[ 1 ].toPhyloXML( 0 ) );
2304 final Phylogeny[] phylogenies_t2 = factory.create( t2_sb, xml_parser );
2305 final Phylogeny t2_rt = phylogenies_t2[ 0 ];
2306 if ( t2_rt.getNode( "node a" ).getNodeData().getTaxonomies().size() != 2 ) {
2309 if ( !t2_rt.getNode( "node a" ).getNodeData().getTaxonomy( 0 ).getCommonName().equals( "some parasite" ) ) {
2312 if ( !t2_rt.getNode( "node a" ).getNodeData().getTaxonomy( 1 ).getCommonName().equals( "the host" ) ) {
2315 if ( t2_rt.getNode( "node a" ).getNodeData().getSequences().size() != 2 ) {
2318 if ( !t2_rt.getNode( "node a" ).getNodeData().getSequence( 0 ).getMolecularSequence()
2319 .startsWith( "actgtgggggt" ) ) {
2322 if ( !t2_rt.getNode( "node a" ).getNodeData().getSequence( 1 ).getMolecularSequence()
2323 .startsWith( "ctgtgatgcat" ) ) {
2326 final StringBuffer t3_sb_0 = new StringBuffer( phylogenies_0[ 2 ].toPhyloXML( 0 ) );
2327 final Phylogeny[] phylogenies_1_0 = factory.create( t3_sb_0, xml_parser );
2328 final StringBuffer t3_sb = new StringBuffer( phylogenies_1_0[ 0 ].toPhyloXML( 0 ) );
2329 final Phylogeny[] phylogenies_1 = factory.create( t3_sb, xml_parser );
2330 if ( phylogenies_1.length != 1 ) {
2333 final Phylogeny t3_rt = phylogenies_1[ 0 ];
2334 if ( !t3_rt.getName().equals( "t3" ) ) {
2337 if ( t3_rt.getNumberOfExternalNodes() != 4 ) {
2340 if ( !t3_rt.getIdentifier().getValue().equals( "1-1" ) ) {
2343 if ( !t3_rt.getIdentifier().getProvider().equals( "treebank" ) ) {
2346 if ( !t3_rt.getNode( "root node" ).getNodeData().getSequence().getType().equals( "protein" ) ) {
2349 if ( !t3_rt.getNode( "root node" ).getNodeData().getSequence().getName()
2350 .equals( "Apoptosis facilitator Bcl-2-like 14 protein" ) ) {
2353 if ( !t3_rt.getNode( "root node" ).getNodeData().getSequence().getSymbol().equals( "BCL2L14" ) ) {
2356 if ( !t3_rt.getNode( "root node" ).getNodeData().getSequence().getAccession().getValue().equals( "Q9BZR8" ) ) {
2359 if ( !t3_rt.getNode( "root node" ).getNodeData().getSequence().getAccession().getSource()
2360 .equals( "UniProtKB" ) ) {
2363 if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getDesc()
2364 .equals( "apoptosis" ) ) {
2367 if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getRef()
2368 .equals( "GO:0006915" ) ) {
2371 if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getSource()
2372 .equals( "UniProtKB" ) ) {
2375 if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getEvidence()
2376 .equals( "experimental" ) ) {
2379 if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getType()
2380 .equals( "function" ) ) {
2383 if ( ( t3_rt.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getConfidence()
2384 .getValue() != 1 ) {
2387 if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getConfidence()
2388 .getType().equals( "ml" ) ) {
2391 if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getDesc()
2392 .equals( "apoptosis" ) ) {
2395 if ( ( t3_rt.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getProperties()
2396 .getProperty( "AFFY:expression" ).getAppliesTo() != AppliesTo.ANNOTATION ) {
2399 if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getProperties()
2400 .getProperty( "AFFY:expression" ).getDataType().equals( "xsd:double" ) ) {
2403 if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getProperties()
2404 .getProperty( "AFFY:expression" ).getRef().equals( "AFFY:expression" ) ) {
2407 if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getProperties()
2408 .getProperty( "AFFY:expression" ).getUnit().equals( "AFFY:x" ) ) {
2411 if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getProperties()
2412 .getProperty( "AFFY:expression" ).getValue().equals( "0.2" ) ) {
2415 if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getProperties()
2416 .getProperty( "MED:disease" ).getValue().equals( "lymphoma" ) ) {
2419 if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 1 ) ).getRef()
2420 .equals( "GO:0005829" ) ) {
2423 if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 0 ) ).getDesc()
2424 .equals( "intracellular organelle" ) ) {
2427 if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getUri( 0 ).getType().equals( "source" ) ) ) {
2430 if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getUri( 0 ).getDescription()
2431 .equals( "UniProt link" ) ) ) {
2434 if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getLocation().equals( "12p13-p12" ) ) ) {
2437 if ( !( t3_rt.getNode( "root node" ).getNodeData().getReference().getDoi().equals( "10.1038/387489a0" ) ) ) {
2440 if ( !( t3_rt.getNode( "root node" ).getNodeData().getReference().getDescription()
2441 .equals( "Aguinaldo, A. M. A.; J. M. Turbeville, L. S. Linford, M. C. Rivera, J. R. Garey, R. A. Raff, & J. A. Lake (1997). \"Evidence for a clade of nematodes, arthropods and other moulting animals\". Nature 387 (6632): 489–493." ) ) ) {
2442 System.out.println( t3_rt.getNode( "root node" ).getNodeData().getReference().getDescription() );
2445 if ( !t3_rt.getNode( "root node" ).getNodeData().getTaxonomy().getTaxonomyCode().equals( "ECDYS" ) ) {
2448 if ( !t3_rt.getNode( "root node" ).getNodeData().getTaxonomy().getScientificName().equals( "ecdysozoa" ) ) {
2451 if ( !t3_rt.getNode( "root node" ).getNodeData().getTaxonomy().getCommonName().equals( "molting animals" ) ) {
2454 if ( !t3_rt.getNode( "root node" ).getNodeData().getTaxonomy().getIdentifier().getValue().equals( "1" ) ) {
2457 if ( !t3_rt.getNode( "root node" ).getNodeData().getTaxonomy().getIdentifier().getProvider()
2458 .equals( "ncbi" ) ) {
2461 if ( t3_rt.getNode( "node bc" ).getNodeData().getSequence().getDomainArchitecture().getTotalLength() != 124 ) {
2464 if ( !t3_rt.getNode( "node bc" ).getNodeData().getSequence().getDomainArchitecture().getDomain( 0 )
2465 .getName().equals( "B" ) ) {
2468 if ( t3_rt.getNode( "node bc" ).getNodeData().getSequence().getDomainArchitecture().getDomain( 0 )
2469 .getFrom() != 21 ) {
2472 if ( t3_rt.getNode( "node bc" ).getNodeData().getSequence().getDomainArchitecture().getDomain( 0 ).getTo() != 44 ) {
2475 if ( t3_rt.getNode( "node bc" ).getNodeData().getSequence().getDomainArchitecture().getDomain( 0 )
2476 .getLength() != 24 ) {
2479 if ( t3_rt.getNode( "node bc" ).getNodeData().getSequence().getDomainArchitecture().getDomain( 0 )
2480 .getConfidence() != 0 ) {
2483 if ( !t3_rt.getNode( "node bc" ).getNodeData().getSequence().getDomainArchitecture().getDomain( 0 ).getId()
2484 .equals( "pfam" ) ) {
2487 if ( t3_rt.getNode( "node bb" ).getNodeData().getBinaryCharacters().getGainedCharacters().size() != 3 ) {
2490 if ( t3_rt.getNode( "node bb" ).getNodeData().getBinaryCharacters().getPresentCharacters().size() != 2 ) {
2493 if ( t3_rt.getNode( "node bb" ).getNodeData().getBinaryCharacters().getLostCharacters().size() != 1 ) {
2496 if ( !t3_rt.getNode( "node bb" ).getNodeData().getBinaryCharacters().getType().equals( "domains" ) ) {
2499 final Taxonomy taxbb = t3_rt.getNode( "node bb" ).getNodeData().getTaxonomy();
2500 if ( !taxbb.getAuthority().equals( "Stephenson, 1935" ) ) {
2503 if ( !taxbb.getCommonName().equals( "starlet sea anemone" ) ) {
2506 if ( !taxbb.getIdentifier().getProvider().equals( "EOL" ) ) {
2509 if ( !taxbb.getIdentifier().getValue().equals( "704294" ) ) {
2512 if ( !taxbb.getTaxonomyCode().equals( "NEMVE" ) ) {
2515 if ( !taxbb.getScientificName().equals( "Nematostella vectensis" ) ) {
2518 if ( taxbb.getSynonyms().size() != 2 ) {
2521 if ( !taxbb.getSynonyms().contains( "Nematostella vectensis Stephenson1935" ) ) {
2524 if ( !taxbb.getSynonyms().contains( "See Anemone" ) ) {
2527 if ( !taxbb.getUri( 0 ).getDescription().equals( "EOL" ) ) {
2530 if ( !taxbb.getUri( 0 ).getType().equals( "linkout" ) ) {
2533 if ( !taxbb.getUri( 0 ).getValue().toString().equals( "http://www.eol.org/pages/704294" ) ) {
2536 if ( ( ( BinaryCharacters ) t3_rt.getNode( "node bb" ).getNodeData().getBinaryCharacters().copy() )
2537 .getLostCount() != BinaryCharacters.COUNT_DEFAULT ) {
2540 if ( t3_rt.getNode( "node b" ).getNodeData().getBinaryCharacters().getGainedCount() != 1 ) {
2543 if ( t3_rt.getNode( "node b" ).getNodeData().getBinaryCharacters().getGainedCharacters().size() != 1 ) {
2546 if ( t3_rt.getNode( "node b" ).getNodeData().getBinaryCharacters().getLostCount() != 3 ) {
2549 if ( t3_rt.getNode( "node b" ).getNodeData().getBinaryCharacters().getLostCharacters().size() != 3 ) {
2552 if ( t3_rt.getNode( "node b" ).getNodeData().getBinaryCharacters().getPresentCount() != 2 ) {
2555 if ( t3_rt.getNode( "node b" ).getNodeData().getBinaryCharacters().getPresentCharacters().size() != 2 ) {
2558 if ( !t3_rt.getNode( "node b" ).getNodeData().getBinaryCharacters().getType().equals( "characters" ) ) {
2561 if ( !t3_rt.getNode( "node ba" ).getNodeData().getDate().getDesc().equals( "Silurian" ) ) {
2564 if ( !t3_rt.getNode( "node ba" ).getNodeData().getDate().getValue().toPlainString()
2565 .equalsIgnoreCase( "435" ) ) {
2568 if ( !t3_rt.getNode( "node ba" ).getNodeData().getDate().getMin().toPlainString().equalsIgnoreCase( "416" ) ) {
2571 if ( !t3_rt.getNode( "node ba" ).getNodeData().getDate().getMax().toPlainString()
2572 .equalsIgnoreCase( "443.7" ) ) {
2575 if ( !t3_rt.getNode( "node ba" ).getNodeData().getDate().getUnit().equals( "mya" ) ) {
2578 if ( !t3_rt.getNode( "node bb" ).getNodeData().getDate().getDesc().equals( "Triassic" ) ) {
2581 if ( !t3_rt.getNode( "node bc" ).getNodeData().getDate().getValue().toPlainString()
2582 .equalsIgnoreCase( "433" ) ) {
2585 final SortedSet<Accession> x = t3_rt.getNode( "root node" ).getNodeData().getSequence()
2586 .getCrossReferences();
2587 if ( x.size() != 4 ) {
2591 for( final Accession acc : x ) {
2593 if ( !acc.getSource().equals( "KEGG" ) ) {
2596 if ( !acc.getValue().equals( "hsa:596" ) ) {
2603 catch ( final Exception e ) {
2604 e.printStackTrace( System.out );
2610 private static boolean testBasicPhyloXMLparsingValidating() {
2612 final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
2613 PhyloXmlParser xml_parser = null;
2615 xml_parser = PhyloXmlParser.createPhyloXmlParserXsdValidating();
2617 catch ( final Exception e ) {
2618 // Do nothing -- means were not running from jar.
2620 if ( xml_parser == null ) {
2621 xml_parser = PhyloXmlParser.createPhyloXmlParser();
2622 if ( USE_LOCAL_PHYLOXML_SCHEMA ) {
2623 xml_parser.setValidateAgainstSchema( PHYLOXML_LOCAL_XSD );
2626 xml_parser.setValidateAgainstSchema( PHYLOXML_REMOTE_XSD );
2629 final Phylogeny[] phylogenies_0 = factory.create( new File( Test.PATH_TO_TEST_DATA + "phyloxml_test_t1.xml" ),
2631 if ( xml_parser.getErrorCount() > 0 ) {
2632 System.out.println( xml_parser.getErrorMessages().toString() );
2635 if ( phylogenies_0.length != 4 ) {
2638 final Phylogeny t1 = phylogenies_0[ 0 ];
2639 final Phylogeny t2 = phylogenies_0[ 1 ];
2640 final Phylogeny t3 = phylogenies_0[ 2 ];
2641 final Phylogeny t4 = phylogenies_0[ 3 ];
2642 if ( !t1.getName().equals( "t1" ) ) {
2645 if ( !t2.getName().equals( "t2" ) ) {
2648 if ( !t3.getName().equals( "t3" ) ) {
2651 if ( !t4.getName().equals( "t4" ) ) {
2654 if ( t1.getNumberOfExternalNodes() != 1 ) {
2657 if ( t2.getNumberOfExternalNodes() != 2 ) {
2660 if ( t3.getNumberOfExternalNodes() != 4 ) {
2663 final String x2 = Test.PATH_TO_TEST_DATA + "phyloxml_test_t1.xml";
2664 final Phylogeny[] phylogenies_1 = factory.create( new File( x2 ), xml_parser );
2665 if ( xml_parser.getErrorCount() > 0 ) {
2666 System.out.println( "errors:" );
2667 System.out.println( xml_parser.getErrorMessages().toString() );
2670 if ( phylogenies_1.length != 4 ) {
2673 final Phylogeny[] phylogenies_2 = factory.create( new File(Test.PATH_TO_TEST_DATA + "phyloxml_test_t3.xml" ),
2675 if ( xml_parser.getErrorCount() > 0 ) {
2676 System.out.println( "errors:" );
2677 System.out.println( xml_parser.getErrorMessages().toString() );
2680 if ( phylogenies_2.length != 1 ) {
2683 if ( phylogenies_2[ 0 ].getNumberOfExternalNodes() != 2 ) {
2686 final Phylogeny[] phylogenies_3 = factory.create( new File( Test.PATH_TO_TEST_DATA + "phyloxml_test_t4.xml" ),
2688 if ( xml_parser.getErrorCount() > 0 ) {
2689 System.out.println( xml_parser.getErrorMessages().toString() );
2692 if ( phylogenies_3.length != 2 ) {
2695 final Phylogeny a = phylogenies_3[ 0 ];
2696 if ( !a.getName().equals( "tree 4" ) ) {
2699 if ( a.getNumberOfExternalNodes() != 3 ) {
2702 if ( !a.getNode( "node b1" ).getNodeData().getSequence().getName().equals( "b1 gene" ) ) {
2705 if ( !a.getNode( "node b1" ).getNodeData().getTaxonomy().getCommonName().equals( "b1 species" ) ) {
2708 final Phylogeny[] phylogenies_4 = factory.create( new File( Test.PATH_TO_TEST_DATA + "special_characters.xml") ,
2710 if ( xml_parser.getErrorCount() > 0 ) {
2711 System.out.println( xml_parser.getErrorMessages().toString() );
2714 if ( phylogenies_4.length != 1 ) {
2717 final Phylogeny s = phylogenies_4[ 0 ];
2718 if ( s.getNumberOfExternalNodes() != 6 ) {
2721 s.getNode( "first" );
2723 s.getNode( "\"<a'b&c'd\">\"" );
2724 s.getNode( "'''\"" );
2725 s.getNode( "\"\"\"" );
2726 s.getNode( "dick & doof" );
2728 catch ( final Exception e ) {
2729 e.printStackTrace( System.out );
2735 private static boolean testBasicProtein() {
2737 final BasicProtein p0 = new BasicProtein( "p0", "owl", 0 );
2738 final Domain a = new BasicDomain( "a", 1, 10, ( short ) 1, ( short ) 5, 0.1, -12 );
2739 final Domain b = new BasicDomain( "b", 11, 20, ( short ) 1, ( short ) 5, 0.1, -12 );
2740 final Domain c = new BasicDomain( "c", 9, 23, ( short ) 1, ( short ) 5, 0.1, -12 );
2741 final Domain d = new BasicDomain( "d", 15, 30, ( short ) 1, ( short ) 5, 0.1, -12 );
2742 final Domain e = new BasicDomain( "e", 60, 70, ( short ) 1, ( short ) 5, 0.1, -12 );
2743 final Domain x = new BasicDomain( "x", 100, 110, ( short ) 1, ( short ) 5, 0.1, -12 );
2744 final Domain y = new BasicDomain( "y", 100, 110, ( short ) 1, ( short ) 5, 0.1, -12 );
2745 p0.addProteinDomain( y );
2746 p0.addProteinDomain( e );
2747 p0.addProteinDomain( b );
2748 p0.addProteinDomain( c );
2749 p0.addProteinDomain( d );
2750 p0.addProteinDomain( a );
2751 p0.addProteinDomain( x );
2752 if ( !p0.toDomainArchitectureString( "~" ).equals( "a~b~c~d~e~x~y" ) ) {
2755 if ( !p0.toDomainArchitectureString( "~", 3, "=" ).equals( "a~b~c~d~e~x~y" ) ) {
2759 final BasicProtein aa0 = new BasicProtein( "aa", "owl", 0 );
2760 final Domain a1 = new BasicDomain( "a", 1, 10, ( short ) 1, ( short ) 5, 0.1, -12 );
2761 aa0.addProteinDomain( a1 );
2762 if ( !aa0.toDomainArchitectureString( "~" ).equals( "a" ) ) {
2765 if ( !aa0.toDomainArchitectureString( "~", 3, "" ).equals( "a" ) ) {
2769 final BasicProtein aa1 = new BasicProtein( "aa", "owl", 0 );
2770 final Domain a11 = new BasicDomain( "a", 1, 10, ( short ) 1, ( short ) 5, 0.1, -12 );
2771 final Domain a12 = new BasicDomain( "a", 2, 20, ( short ) 1, ( short ) 5, 0.1, -12 );
2772 aa1.addProteinDomain( a11 );
2773 aa1.addProteinDomain( a12 );
2774 if ( !aa1.toDomainArchitectureString( "~" ).equals( "a~a" ) ) {
2777 if ( !aa1.toDomainArchitectureString( "~", 3, "" ).equals( "a~a" ) ) {
2780 aa1.addProteinDomain( new BasicDomain( "a", 20, 30, ( short ) 1, ( short ) 5, 0.1, -12 ) );
2781 if ( !aa1.toDomainArchitectureString( "~" ).equals( "a~a~a" ) ) {
2784 if ( !aa1.toDomainArchitectureString( "~", 3, "" ).equals( "aaa" ) ) {
2787 if ( !aa1.toDomainArchitectureString( "~", 4, "" ).equals( "a~a~a" ) ) {
2790 aa1.addProteinDomain( new BasicDomain( "a", 30, 40, ( short ) 1, ( short ) 5, 0.1, -12 ) );
2791 if ( !aa1.toDomainArchitectureString( "~" ).equals( "a~a~a~a" ) ) {
2794 if ( !aa1.toDomainArchitectureString( "~", 3, "" ).equals( "aaa" ) ) {
2797 if ( !aa1.toDomainArchitectureString( "~", 4, "" ).equals( "aaa" ) ) {
2800 if ( !aa1.toDomainArchitectureString( "~", 5, "" ).equals( "a~a~a~a" ) ) {
2803 aa1.addProteinDomain( new BasicDomain( "b", 32, 40, ( short ) 1, ( short ) 5, 0.1, -12 ) );
2804 if ( !aa1.toDomainArchitectureString( "~" ).equals( "a~a~a~a~b" ) ) {
2807 if ( !aa1.toDomainArchitectureString( "~", 3, "" ).equals( "aaa~b" ) ) {
2810 if ( !aa1.toDomainArchitectureString( "~", 4, "" ).equals( "aaa~b" ) ) {
2813 if ( !aa1.toDomainArchitectureString( "~", 5, "" ).equals( "a~a~a~a~b" ) ) {
2816 aa1.addProteinDomain( new BasicDomain( "c", 1, 2, ( short ) 1, ( short ) 5, 0.1, -12 ) );
2817 if ( !aa1.toDomainArchitectureString( "~" ).equals( "c~a~a~a~a~b" ) ) {
2820 if ( !aa1.toDomainArchitectureString( "~", 3, "" ).equals( "c~aaa~b" ) ) {
2823 if ( !aa1.toDomainArchitectureString( "~", 4, "" ).equals( "c~aaa~b" ) ) {
2826 if ( !aa1.toDomainArchitectureString( "~", 5, "" ).equals( "c~a~a~a~a~b" ) ) {
2830 final BasicProtein p00 = new BasicProtein( "p0", "owl", 0 );
2831 final Domain a0 = new BasicDomain( "a", 1, 10, ( short ) 1, ( short ) 5, 0.1, -12 );
2832 final Domain b0 = new BasicDomain( "b", 11, 20, ( short ) 1, ( short ) 5, 0.1, -12 );
2833 final Domain c0 = new BasicDomain( "c", 9, 23, ( short ) 1, ( short ) 5, 0.1, -12 );
2834 final Domain d0 = new BasicDomain( "d", 15, 30, ( short ) 1, ( short ) 5, 0.1, -12 );
2835 final Domain e0 = new BasicDomain( "e", 60, 70, ( short ) 1, ( short ) 5, 0.1, -12 );
2836 final Domain e1 = new BasicDomain( "e", 61, 71, ( short ) 1, ( short ) 5, 0.1, -12 );
2837 final Domain e2 = new BasicDomain( "e", 62, 72, ( short ) 1, ( short ) 5, 0.1, -12 );
2838 final Domain e3 = new BasicDomain( "e", 63, 73, ( short ) 1, ( short ) 5, 0.1, -12 );
2839 final Domain e4 = new BasicDomain( "e", 64, 74, ( short ) 1, ( short ) 5, 0.1, -12 );
2840 final Domain e5 = new BasicDomain( "e", 65, 75, ( short ) 1, ( short ) 5, 0.1, -12 );
2841 final Domain x0 = new BasicDomain( "x", 100, 110, ( short ) 1, ( short ) 5, 0.1, -12 );
2842 final Domain y0 = new BasicDomain( "y", 100, 110, ( short ) 1, ( short ) 5, 0.1, -12 );
2843 final Domain y1 = new BasicDomain( "y", 120, 130, ( short ) 1, ( short ) 5, 0.1, -12 );
2844 final Domain y2 = new BasicDomain( "y", 140, 150, ( short ) 1, ( short ) 5, 0.1, -12 );
2845 final Domain y3 = new BasicDomain( "y", 160, 170, ( short ) 1, ( short ) 5, 0.1, -12 );
2846 final Domain z0 = new BasicDomain( "z", 200, 210, ( short ) 1, ( short ) 5, 0.1, -12 );
2847 final Domain z1 = new BasicDomain( "z", 300, 310, ( short ) 1, ( short ) 5, 0.1, -12 );
2848 final Domain z2 = new BasicDomain( "z", 400, 410, ( short ) 1, ( short ) 5, 0.1, -12 );
2849 final Domain zz0 = new BasicDomain( "Z", 500, 510, ( short ) 1, ( short ) 5, 0.1, -12 );
2850 final Domain zz1 = new BasicDomain( "Z", 600, 610, ( short ) 1, ( short ) 5, 0.1, -12 );
2851 p00.addProteinDomain( y0 );
2852 p00.addProteinDomain( e0 );
2853 p00.addProteinDomain( b0 );
2854 p00.addProteinDomain( c0 );
2855 p00.addProteinDomain( d0 );
2856 p00.addProteinDomain( a0 );
2857 p00.addProteinDomain( x0 );
2858 p00.addProteinDomain( y1 );
2859 p00.addProteinDomain( y2 );
2860 p00.addProteinDomain( y3 );
2861 p00.addProteinDomain( e1 );
2862 p00.addProteinDomain( e2 );
2863 p00.addProteinDomain( e3 );
2864 p00.addProteinDomain( e4 );
2865 p00.addProteinDomain( e5 );
2866 p00.addProteinDomain( z0 );
2867 p00.addProteinDomain( z1 );
2868 p00.addProteinDomain( z2 );
2869 p00.addProteinDomain( zz0 );
2870 p00.addProteinDomain( zz1 );
2871 if ( !p00.toDomainArchitectureString( "~", 3, "" ).equals( "a~b~c~d~eee~x~yyy~zzz~Z~Z" ) ) {
2874 if ( !p00.toDomainArchitectureString( "~", 4, "" ).equals( "a~b~c~d~eee~x~yyy~z~z~z~Z~Z" ) ) {
2877 if ( !p00.toDomainArchitectureString( "~", 5, "" ).equals( "a~b~c~d~eee~x~y~y~y~y~z~z~z~Z~Z" ) ) {
2880 if ( !p00.toDomainArchitectureString( "~", 6, "" ).equals( "a~b~c~d~eee~x~y~y~y~y~z~z~z~Z~Z" ) ) {
2883 if ( !p00.toDomainArchitectureString( "~", 7, "" ).equals( "a~b~c~d~e~e~e~e~e~e~x~y~y~y~y~z~z~z~Z~Z" ) ) {
2886 // A0 A10 B15 A20 B25 A30 B35 B40 C50 A60 C70 D80
2887 final Domain A0 = new BasicDomain( "A", 0, 25, ( short ) 1, ( short ) 4, 0.1, -12 );
2888 final Domain A10 = new BasicDomain( "A", 10, 11, ( short ) 1, ( short ) 4, 0.1, -12 );
2889 final Domain B15 = new BasicDomain( "B", 11, 16, ( short ) 1, ( short ) 4, 0.1, -12 );
2890 final Domain A20 = new BasicDomain( "A", 20, 100, ( short ) 1, ( short ) 4, 0.1, -12 );
2891 final Domain B25 = new BasicDomain( "B", 25, 26, ( short ) 1, ( short ) 4, 0.1, -12 );
2892 final Domain A30 = new BasicDomain( "A", 30, 31, ( short ) 1, ( short ) 4, 0.1, -12 );
2893 final Domain B35 = new BasicDomain( "B", 31, 40, ( short ) 1, ( short ) 4, 0.1, -12 );
2894 final Domain B40 = new BasicDomain( "B", 40, 600, ( short ) 1, ( short ) 4, 0.1, -12 );
2895 final Domain C50 = new BasicDomain( "C", 50, 59, ( short ) 1, ( short ) 4, 0.1, -12 );
2896 final Domain A60 = new BasicDomain( "A", 60, 395, ( short ) 1, ( short ) 4, 0.1, -12 );
2897 final Domain C70 = new BasicDomain( "C", 70, 71, ( short ) 1, ( short ) 4, 0.1, -12 );
2898 final Domain D80 = new BasicDomain( "D", 80, 81, ( short ) 1, ( short ) 4, 0.1, -12 );
2899 final BasicProtein p = new BasicProtein( "p", "owl", 0 );
2900 p.addProteinDomain( B15 );
2901 p.addProteinDomain( C50 );
2902 p.addProteinDomain( A60 );
2903 p.addProteinDomain( A30 );
2904 p.addProteinDomain( C70 );
2905 p.addProteinDomain( B35 );
2906 p.addProteinDomain( B40 );
2907 p.addProteinDomain( A0 );
2908 p.addProteinDomain( A10 );
2909 p.addProteinDomain( A20 );
2910 p.addProteinDomain( B25 );
2911 p.addProteinDomain( D80 );
2912 List<String> domains_ids = new ArrayList<String>();
2913 domains_ids.add( "A" );
2914 domains_ids.add( "B" );
2915 domains_ids.add( "C" );
2916 if ( !p.contains( domains_ids, false ) ) {
2919 if ( !p.contains( domains_ids, true ) ) {
2922 domains_ids.add( "X" );
2923 if ( p.contains( domains_ids, false ) ) {
2926 if ( p.contains( domains_ids, true ) ) {
2929 domains_ids = new ArrayList<String>();
2930 domains_ids.add( "A" );
2931 domains_ids.add( "C" );
2932 domains_ids.add( "D" );
2933 if ( !p.contains( domains_ids, false ) ) {
2936 if ( !p.contains( domains_ids, true ) ) {
2939 domains_ids = new ArrayList<String>();
2940 domains_ids.add( "A" );
2941 domains_ids.add( "D" );
2942 domains_ids.add( "C" );
2943 if ( !p.contains( domains_ids, false ) ) {
2946 if ( p.contains( domains_ids, true ) ) {
2949 domains_ids = new ArrayList<String>();
2950 domains_ids.add( "A" );
2951 domains_ids.add( "A" );
2952 domains_ids.add( "B" );
2953 if ( !p.contains( domains_ids, false ) ) {
2956 if ( !p.contains( domains_ids, true ) ) {
2959 domains_ids = new ArrayList<String>();
2960 domains_ids.add( "A" );
2961 domains_ids.add( "A" );
2962 domains_ids.add( "A" );
2963 domains_ids.add( "B" );
2964 domains_ids.add( "B" );
2965 if ( !p.contains( domains_ids, false ) ) {
2968 if ( !p.contains( domains_ids, true ) ) {
2971 domains_ids = new ArrayList<String>();
2972 domains_ids.add( "A" );
2973 domains_ids.add( "A" );
2974 domains_ids.add( "B" );
2975 domains_ids.add( "A" );
2976 domains_ids.add( "B" );
2977 domains_ids.add( "B" );
2978 domains_ids.add( "A" );
2979 domains_ids.add( "B" );
2980 domains_ids.add( "C" );
2981 domains_ids.add( "A" );
2982 domains_ids.add( "C" );
2983 domains_ids.add( "D" );
2984 if ( !p.contains( domains_ids, false ) ) {
2987 if ( p.contains( domains_ids, true ) ) {
2991 catch ( final Exception e ) {
2992 e.printStackTrace( System.out );
2998 private static boolean testBasicTable() {
3000 final BasicTable<String> t0 = new BasicTable<String>();
3001 if ( t0.getNumberOfColumns() != 0 ) {
3004 if ( t0.getNumberOfRows() != 0 ) {
3007 t0.setValue( 3, 2, "23" );
3008 t0.setValue( 10, 1, "error" );
3009 t0.setValue( 10, 1, "110" );
3010 t0.setValue( 9, 1, "19" );
3011 t0.setValue( 1, 10, "101" );
3012 t0.setValue( 10, 10, "1010" );
3013 t0.setValue( 100, 10, "10100" );
3014 t0.setValue( 0, 0, "00" );
3015 if ( !t0.getValue( 3, 2 ).equals( "23" ) ) {
3018 if ( !t0.getValue( 10, 1 ).equals( "110" ) ) {
3021 if ( !t0.getValueAsString( 1, 10 ).equals( "101" ) ) {
3024 if ( !t0.getValueAsString( 10, 10 ).equals( "1010" ) ) {
3027 if ( !t0.getValueAsString( 100, 10 ).equals( "10100" ) ) {
3030 if ( !t0.getValueAsString( 9, 1 ).equals( "19" ) ) {
3033 if ( !t0.getValueAsString( 0, 0 ).equals( "00" ) ) {
3036 if ( t0.getNumberOfColumns() != 101 ) {
3039 if ( t0.getNumberOfRows() != 11 ) {
3042 if ( t0.getValueAsString( 49, 4 ) != null ) {
3045 final String l = ForesterUtil.getLineSeparator();
3046 final StringBuffer source = new StringBuffer();
3047 source.append( "" + l );
3048 source.append( "# 1 1 1 1 1 1 1 1" + l );
3049 source.append( " 00 01 02 03" + l );
3050 source.append( " 10 11 12 13 " + l );
3051 source.append( "20 21 22 23 " + l );
3052 source.append( " 30 31 32 33" + l );
3053 source.append( "40 41 42 43" + l );
3054 source.append( " # 1 1 1 1 1 " + l );
3055 source.append( "50 51 52 53 54" + l );
3056 final BasicTable<String> t1 = BasicTableParser.parse( source.toString(), ' ' );
3057 if ( t1.getNumberOfColumns() != 5 ) {
3060 if ( t1.getNumberOfRows() != 6 ) {
3063 if ( !t1.getValueAsString( 0, 0 ).equals( "00" ) ) {
3066 if ( !t1.getValueAsString( 1, 0 ).equals( "01" ) ) {
3069 if ( !t1.getValueAsString( 3, 0 ).equals( "03" ) ) {
3072 if ( !t1.getValueAsString( 4, 5 ).equals( "54" ) ) {
3075 final StringBuffer source1 = new StringBuffer();
3076 source1.append( "" + l );
3077 source1.append( "# 1; 1; 1; 1 ;1 ;1; 1 ;1;" + l );
3078 source1.append( " 00; 01 ;02;03" + l );
3079 source1.append( " 10; 11; 12; 13 " + l );
3080 source1.append( "20; 21; 22; 23 " + l );
3081 source1.append( " 30; 31; 32; 33" + l );
3082 source1.append( "40;41;42;43" + l );
3083 source1.append( " # 1 1 1 1 1 " + l );
3084 source1.append( ";;;50 ; ;52; 53;;54 " + l );
3085 final BasicTable<String> t2 = BasicTableParser.parse( source1.toString(), ';' );
3086 if ( t2.getNumberOfColumns() != 5 ) {
3089 if ( t2.getNumberOfRows() != 6 ) {
3092 if ( !t2.getValueAsString( 0, 0 ).equals( "00" ) ) {
3095 if ( !t2.getValueAsString( 1, 0 ).equals( "01" ) ) {
3098 if ( !t2.getValueAsString( 3, 0 ).equals( "03" ) ) {
3101 if ( !t2.getValueAsString( 3, 3 ).equals( "33" ) ) {
3104 if ( !t2.getValueAsString( 3, 5 ).equals( "53" ) ) {
3107 if ( !t2.getValueAsString( 1, 5 ).equals( "" ) ) {
3110 final StringBuffer source2 = new StringBuffer();
3111 source2.append( "" + l );
3112 source2.append( "comment: 1; 1; 1; 1 ;1 ;1; 1 ;1;" + l );
3113 source2.append( " 00; 01 ;02;03" + l );
3114 source2.append( " 10; 11; 12; 13 " + l );
3115 source2.append( "20; 21; 22; 23 " + l );
3116 source2.append( " " + l );
3117 source2.append( " 30; 31; 32; 33" + l );
3118 source2.append( "40;41;42;43" + l );
3119 source2.append( " comment: 1 1 1 1 1 " + l );
3120 source2.append( ";;;50 ; 52; 53;;54 " + l );
3121 final List<BasicTable<String>> tl = BasicTableParser.parse( source2.toString(),
3127 if ( tl.size() != 2 ) {
3130 final BasicTable<String> t3 = tl.get( 0 );
3131 final BasicTable<String> t4 = tl.get( 1 );
3132 if ( t3.getNumberOfColumns() != 4 ) {
3135 if ( t3.getNumberOfRows() != 3 ) {
3138 if ( t4.getNumberOfColumns() != 4 ) {
3141 if ( t4.getNumberOfRows() != 3 ) {
3144 if ( !t3.getValueAsString( 0, 0 ).equals( "00" ) ) {
3147 if ( !t4.getValueAsString( 0, 0 ).equals( "30" ) ) {
3151 catch ( final Exception e ) {
3152 e.printStackTrace( System.out );
3158 private static boolean testBasicTolXMLparsing() {
3160 final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
3161 final TolParser parser = new TolParser();
3162 final Phylogeny[] phylogenies_0 = factory.create( Test.PATH_TO_TEST_DATA + "tol_2484.tol", parser );
3163 if ( parser.getErrorCount() > 0 ) {
3164 System.out.println( parser.getErrorMessages().toString() );
3167 if ( phylogenies_0.length != 1 ) {
3170 final Phylogeny t1 = phylogenies_0[ 0 ];
3171 if ( t1.getNumberOfExternalNodes() != 5 ) {
3174 if ( !t1.isRooted() ) {
3177 if ( !t1.getRoot().getNodeData().getTaxonomy().getScientificName().equals( "Mesozoa" ) ) {
3180 if ( !t1.getRoot().getNodeData().getTaxonomy().getIdentifier().getValue().equals( "2484" ) ) {
3183 if ( !t1.getRoot().getChildNode( 0 ).getNodeData().getTaxonomy().getScientificName().equals( "Rhombozoa" ) ) {
3186 if ( t1.getRoot().getChildNode( 0 ).getNumberOfDescendants() != 3 ) {
3189 final Phylogeny[] phylogenies_1 = factory.create( Test.PATH_TO_TEST_DATA + "tol_2.tol", parser );
3190 if ( parser.getErrorCount() > 0 ) {
3191 System.out.println( parser.getErrorMessages().toString() );
3194 if ( phylogenies_1.length != 1 ) {
3197 final Phylogeny t2 = phylogenies_1[ 0 ];
3198 if ( t2.getNumberOfExternalNodes() != 664 ) {
3201 if ( !t2.isRooted() ) {
3204 if ( !t2.getRoot().getNodeData().getTaxonomy().getScientificName().equals( "Eubacteria" ) ) {
3207 if ( !t2.getRoot().getNodeData().getTaxonomy().getIdentifier().getValue().equals( "2" ) ) {
3210 if ( t2.getRoot().getNumberOfDescendants() != 24 ) {
3213 if ( t2.getRoot().getNumberOfDescendants() != 24 ) {
3216 if ( !t2.getRoot().getChildNode( 0 ).getNodeData().getTaxonomy().getScientificName().equals( "Aquificae" ) ) {
3219 if ( !t2.getRoot().getChildNode( 0 ).getChildNode( 0 ).getNodeData().getTaxonomy().getScientificName()
3220 .equals( "Aquifex" ) ) {
3223 final Phylogeny[] phylogenies_2 = factory.create( Test.PATH_TO_TEST_DATA + "tol_5.tol", parser );
3224 if ( parser.getErrorCount() > 0 ) {
3225 System.out.println( parser.getErrorMessages().toString() );
3228 if ( phylogenies_2.length != 1 ) {
3231 final Phylogeny t3 = phylogenies_2[ 0 ];
3232 if ( t3.getNumberOfExternalNodes() != 184 ) {
3235 if ( !t3.getRoot().getNodeData().getTaxonomy().getScientificName().equals( "Viruses" ) ) {
3238 if ( !t3.getRoot().getNodeData().getTaxonomy().getIdentifier().getValue().equals( "5" ) ) {
3241 if ( t3.getRoot().getNumberOfDescendants() != 6 ) {
3244 final Phylogeny[] phylogenies_3 = factory.create( Test.PATH_TO_TEST_DATA + "tol_4567.tol", parser );
3245 if ( parser.getErrorCount() > 0 ) {
3246 System.out.println( parser.getErrorMessages().toString() );
3249 if ( phylogenies_3.length != 1 ) {
3252 final Phylogeny t4 = phylogenies_3[ 0 ];
3253 if ( t4.getNumberOfExternalNodes() != 1 ) {
3256 if ( !t4.getRoot().getNodeData().getTaxonomy().getScientificName().equals( "Marpissa decorata" ) ) {
3259 if ( !t4.getRoot().getNodeData().getTaxonomy().getIdentifier().getValue().equals( "4567" ) ) {
3262 if ( t4.getRoot().getNumberOfDescendants() != 0 ) {
3265 final Phylogeny[] phylogenies_4 = factory.create( Test.PATH_TO_TEST_DATA + "tol_16299.tol", parser );
3266 if ( parser.getErrorCount() > 0 ) {
3267 System.out.println( parser.getErrorMessages().toString() );
3270 if ( phylogenies_4.length != 1 ) {
3273 final Phylogeny t5 = phylogenies_4[ 0 ];
3274 if ( t5.getNumberOfExternalNodes() != 13 ) {
3277 if ( !t5.getRoot().getNodeData().getTaxonomy().getScientificName().equals( "Hominidae" ) ) {
3280 if ( !t5.getRoot().getNodeData().getTaxonomy().getIdentifier().getValue().equals( "16299" ) ) {
3283 if ( t5.getRoot().getNumberOfDescendants() != 2 ) {
3287 catch ( final Exception e ) {
3288 e.printStackTrace( System.out );
3294 private static boolean testBasicTreeMethods() {
3296 final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
3297 final Phylogeny t2 = factory.create( "((A:1,B:2)AB:1,(C:3,D:5)CD:3)ABCD:0.5", new NHXParser() )[ 0 ];
3298 if ( t2.getNumberOfExternalNodes() != 4 ) {
3301 if ( t2.getHeight() != 8.5 ) {
3304 if ( !t2.isCompletelyBinary() ) {
3307 if ( t2.isEmpty() ) {
3310 final Phylogeny t3 = factory.create( "((A:1,B:2,C:10)ABC:1,(D:3,E:5)DE:3)", new NHXParser() )[ 0 ];
3311 if ( t3.getNumberOfExternalNodes() != 5 ) {
3314 if ( t3.getHeight() != 11 ) {
3317 if ( t3.isCompletelyBinary() ) {
3320 final PhylogenyNode n = t3.getNode( "ABC" );
3321 final Phylogeny t4 = factory.create( "((A:1,B:2,C:10)ABC:1,(D:3,E:5)DE:3,(F,G,H,I))", new NHXParser() )[ 0 ];
3322 if ( t4.getNumberOfExternalNodes() != 9 ) {
3325 if ( t4.getHeight() != 11 ) {
3328 if ( t4.isCompletelyBinary() ) {
3331 final StringBuffer sb5 = new StringBuffer( "(((A11:2)A1:2,(A21:1,A22:2,A23)A2:11,A3:2)A:2,B:10,C:3,D:8)" );
3332 final Phylogeny t5 = factory.create( sb5.toString(), new NHXParser() )[ 0 ];
3333 if ( t5.getNumberOfExternalNodes() != 8 ) {
3336 if ( t5.getHeight() != 15 ) {
3339 final StringBuffer sb6 = new StringBuffer( "(X,Y,Z,(((A111)A11:2)A1:2,(X,Y,Z,A21:1,A22:2,A23)A2:11,A3:2)A:2,B:10,C:3,D:8)" );
3340 final Phylogeny t6 = factory.create( sb6.toString(), new NHXParser() )[ 0 ];
3341 if ( t6.getHeight() != 15 ) {
3344 final StringBuffer sb7 = new StringBuffer( "(((A11:2)A1:2,(A21:1,A22:2,A23)A2:11,A3:2)A:2,B:10,C:15,D:8)" );
3345 final Phylogeny t7 = factory.create( sb7.toString(), new NHXParser() )[ 0 ];
3346 if ( t7.getHeight() != 15 ) {
3349 final StringBuffer sb8 = new StringBuffer( "(((A11:11)A1:2,(A21:2,A22:2,A23,A24,AA:)A2:11,A3:2)A:2,B:15,C:15,D:15)" );
3350 final Phylogeny t8 = factory.create( sb8.toString(), new NHXParser() )[ 0 ];
3351 if ( t8.getNumberOfExternalNodes() != 10 ) {
3354 if ( t8.getHeight() != 15 ) {
3357 final char[] a9 = new char[] { 'a' };
3358 final Phylogeny t9 = factory.create( a9, new NHXParser() )[ 0 ];
3359 if ( t9.getHeight() != 0 ) {
3362 final char[] a10 = new char[] { 'a', ':', '6' };
3363 final Phylogeny t10 = factory.create( a10, new NHXParser() )[ 0 ];
3364 if ( t10.getHeight() != 6 ) {
3368 catch ( final Exception e ) {
3369 e.printStackTrace( System.out );
3375 private static boolean testConfidenceAssessor() {
3377 final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
3378 final Phylogeny t0 = factory.create( "((((A,B)ab,C)abc,D)abcd,E)abcde", new NHXParser() )[ 0 ];
3379 final Phylogeny[] ev0 = factory
3380 .create( "((((A,B),C),D),E);((((A,B),C),D),E);((((A,B),C),D),E);((((A,B),C),D),E);",
3382 ConfidenceAssessor.evaluate( "bootstrap", ev0, t0, false, 1, 0, 2 );
3383 if ( !isEqual( t0.getNode( "ab" ).getBranchData().getConfidence( 0 ).getValue(), 3 ) ) {
3386 if ( !isEqual( t0.getNode( "abc" ).getBranchData().getConfidence( 0 ).getValue(), 3 ) ) {
3389 final Phylogeny t1 = factory.create( "((((A,B)ab[&&NHX:B=50],C)abc,D)abcd,E)abcde", new NHXParser() )[ 0 ];
3390 final Phylogeny[] ev1 = factory
3391 .create( "((((A,B),C),D),E);((A,B),((E,D),C));(((A,B),C),(E,D));(A,(((E,D),C),B));(B,(A,((E,D),C)));(C,((E,D),(A,B)));(D,(E,((A,B),C)));",
3393 ConfidenceAssessor.evaluate( "bootstrap", ev1, t1, false, 1 );
3394 if ( !isEqual( t1.getNode( "ab" ).getBranchData().getConfidence( 1 ).getValue(), 7 ) ) {
3397 if ( !isEqual( t1.getNode( "abc" ).getBranchData().getConfidence( 0 ).getValue(), 7 ) ) {
3400 final Phylogeny t_b = factory.create( "((((A,C)ac,D)acd,E)acde,B)abcde", new NHXParser() )[ 0 ];
3401 final Phylogeny[] ev_b = factory
3402 .create( "((A,C),X);((A,X),C);(A,C);((((A,B),C),D),E);((A,B),((E,D),C));(((A,B),C),(E,D));(A,(((E,D),C),B));(B,(A,((E,D),C)));(C,((E,D),(A,B)));(D,(E,((A,B),C)));((((A,C)ac,D)acd,E)acde,B)abcd",
3404 ConfidenceAssessor.evaluate( "bootstrap", ev_b, t_b, false, 1 );
3405 if ( !isEqual( t_b.getNode( "ac" ).getBranchData().getConfidence( 0 ).getValue(), 4 ) ) {
3408 if ( !isEqual( t_b.getNode( "acd" ).getBranchData().getConfidence( 0 ).getValue(), 1 ) ) {
3412 final Phylogeny t1x = factory.create( "((((A,B)ab,C)abc,D)abcd,E)abcde", new NHXParser() )[ 0 ];
3413 final Phylogeny[] ev1x = factory
3414 .create( "((((A,B),C),D),E);((A,B),((E,D),C));(((A,B),C),(E,D));(A,(((E,D),C),B));(B,(A,((E,D),C)));(C,((E,D),(A,B)));(D,(E,((A,B),C)));",
3416 ConfidenceAssessor.evaluate( "bootstrap", ev1x, t1x, true, 1 );
3417 if ( !isEqual( t1x.getNode( "ab" ).getBranchData().getConfidence( 0 ).getValue(), 7 ) ) {
3420 if ( !isEqual( t1x.getNode( "abc" ).getBranchData().getConfidence( 0 ).getValue(), 7 ) ) {
3423 final Phylogeny t_bx = factory.create( "((((A,C)ac,D)acd,E)acde,B)abcde", new NHXParser() )[ 0 ];
3424 final Phylogeny[] ev_bx = factory
3425 .create( "((((A,B),C),D),E);((A,B),((E,D),C));(((A,B),C),(E,D));(A,(((E,D),C),B));(B,(A,((E,D),C)));(C,((E,D),(A,B)));(D,(E,((A,B),C)));((((A,C)ac,D)acd,E)acde,B)abcd",
3427 ConfidenceAssessor.evaluate( "bootstrap", ev_bx, t_bx, true, 1 );
3428 if ( !isEqual( t_bx.getNode( "ac" ).getBranchData().getConfidence( 0 ).getValue(), 1 ) ) {
3431 if ( !isEqual( t_bx.getNode( "acd" ).getBranchData().getConfidence( 0 ).getValue(), 1 ) ) {
3434 final Phylogeny[] t2 = factory
3435 .create( "((((a,b),c),d),e);(((a,b),c),(d,e));(((((a,b),c),d),e),f);((((a,b),c),(d,e)),f);(((a,b),c),d,e);((a,b,c),d,e);",
3437 final Phylogeny[] ev2 = factory
3438 .create( "((((a,b),c),d),e);((((a,b),c),d),e);((((a,b),e),d),c);((((a,b),e),d),c);(((a,b),(c,d)),e);((a,b),x);((a,b),(x,y));(a,b);(a,e);(a,b,c);",
3440 for( final Phylogeny target : t2 ) {
3441 ConfidenceAssessor.evaluate( "bootstrap", ev2, target, false, 1 );
3443 final Phylogeny t4 = factory.create( "((((((A,B)ab,C)abc,D)abcd,E)abcde,F)abcdef,G)abcdefg",
3444 new NHXParser() )[ 0 ];
3445 final Phylogeny[] ev4 = factory.create( "(((A,B),C),(X,Y));((F,G),((A,B,C),(D,E)))", new NHXParser() );
3446 ConfidenceAssessor.evaluate( "bootstrap", ev4, t4, false, 1 );
3447 if ( !isEqual( t4.getNode( "ab" ).getBranchData().getConfidence( 0 ).getValue(), 1 ) ) {
3450 if ( !isEqual( t4.getNode( "abc" ).getBranchData().getConfidence( 0 ).getValue(), 2 ) ) {
3453 if ( !isEqual( t4.getNode( "abcde" ).getBranchData().getConfidence( 0 ).getValue(), 1 ) ) {
3457 catch ( final Exception e ) {
3458 e.printStackTrace();
3464 private static boolean testCopyOfNodeData() {
3466 final PhylogenyNode n1 = PhylogenyNode
3467 .createInstanceFromNhxString( "n5:0.1[&&NHX:S=Ecoli:E=1.1.1.1:D=Y:Co=Y:B=56:T=1:O=22:SO=33:SN=44:W=2:C=10.20.30:XN=S=tag1=value1=unit1]" );
3468 final PhylogenyNode n2 = n1.copyNodeData();
3469 if ( !n1.toNewHampshireX().equals( n2.toNewHampshireX() ) ) {
3473 catch ( final Exception e ) {
3474 e.printStackTrace();
3480 private static boolean testCreateBalancedPhylogeny() {
3482 final Phylogeny p0 = DevelopmentTools.createBalancedPhylogeny( 6, 5 );
3483 if ( p0.getRoot().getNumberOfDescendants() != 5 ) {
3486 if ( p0.getNumberOfExternalNodes() != 15625 ) {
3489 final Phylogeny p1 = DevelopmentTools.createBalancedPhylogeny( 2, 10 );
3490 if ( p1.getRoot().getNumberOfDescendants() != 10 ) {
3493 if ( p1.getNumberOfExternalNodes() != 100 ) {
3497 catch ( final Exception e ) {
3498 e.printStackTrace();
3504 private static boolean testCreateUriForSeqWeb() {
3506 final PhylogenyNode n = new PhylogenyNode();
3507 n.setName( "tr|B3RJ64" );
3508 if ( !TreePanelUtil.createUriForSeqWeb( n, null, null ).equals( ForesterUtil.UNIPROT_KB + "B3RJ64" ) ) {
3511 n.setName( "B0LM41_HUMAN" );
3512 if ( !TreePanelUtil.createUriForSeqWeb( n, null, null ).equals( ForesterUtil.UNIPROT_KB + "B0LM41_HUMAN" ) ) {
3515 n.setName( "NP_001025424" );
3516 if ( !TreePanelUtil.createUriForSeqWeb( n, null, null ).equals( ForesterUtil.NCBI_PROTEIN + "NP_001025424" ) ) {
3519 n.setName( "_NM_001030253-" );
3520 if ( !TreePanelUtil.createUriForSeqWeb( n, null, null ).equals( ForesterUtil.NCBI_NUCCORE + "NM_001030253" ) ) {
3523 n.setName( "XM_002122186" );
3524 if ( !TreePanelUtil.createUriForSeqWeb( n, null, null ).equals( ForesterUtil.NCBI_NUCCORE + "XM_002122186" ) ) {
3527 n.setName( "dgh_AAA34956_gdg" );
3528 if ( !TreePanelUtil.createUriForSeqWeb( n, null, null ).equals( ForesterUtil.NCBI_PROTEIN + "AAA34956" ) ) {
3531 n.setName( "AAA34956" );
3532 if ( !TreePanelUtil.createUriForSeqWeb( n, null, null ).equals( ForesterUtil.NCBI_PROTEIN + "AAA34956" ) ) {
3535 n.setName( "GI:394892" );
3536 if ( !TreePanelUtil.createUriForSeqWeb( n, null, null ).equals( ForesterUtil.NCBI_GI + "394892" ) ) {
3537 System.out.println( TreePanelUtil.createUriForSeqWeb( n, null, null ) );
3540 n.setName( "gi_394892" );
3541 if ( !TreePanelUtil.createUriForSeqWeb( n, null, null ).equals( ForesterUtil.NCBI_GI + "394892" ) ) {
3542 System.out.println( TreePanelUtil.createUriForSeqWeb( n, null, null ) );
3545 n.setName( "gi6335_gi_394892_56635_Gi_43" );
3546 if ( !TreePanelUtil.createUriForSeqWeb( n, null, null ).equals( ForesterUtil.NCBI_GI + "394892" ) ) {
3547 System.out.println( TreePanelUtil.createUriForSeqWeb( n, null, null ) );
3550 n.setName( "P12345" );
3551 if ( !TreePanelUtil.createUriForSeqWeb( n, null, null ).equals( ForesterUtil.UNIPROT_KB + "P12345" ) ) {
3552 System.out.println( TreePanelUtil.createUriForSeqWeb( n, null, null ) );
3555 n.setName( "gi_fdgjmn-3jk5-243 mnefmn fg023-0 P12345 4395jtmnsrg02345m1ggi92450jrg890j4t0j240" );
3556 if ( !TreePanelUtil.createUriForSeqWeb( n, null, null ).equals( ForesterUtil.UNIPROT_KB + "P12345" ) ) {
3557 System.out.println( TreePanelUtil.createUriForSeqWeb( n, null, null ) );
3561 catch ( final Exception e ) {
3562 e.printStackTrace( System.out );
3568 private static boolean testDataObjects() {
3570 final Confidence s0 = new Confidence();
3571 final Confidence s1 = new Confidence();
3572 if ( !s0.isEqual( s1 ) ) {
3575 final Confidence s2 = new Confidence( 0.23, "bootstrap" );
3576 final Confidence s3 = new Confidence( 0.23, "bootstrap" );
3577 if ( s2.isEqual( s1 ) ) {
3580 if ( !s2.isEqual( s3 ) ) {
3583 final Confidence s4 = ( Confidence ) s3.copy();
3584 if ( !s4.isEqual( s3 ) ) {
3591 final Taxonomy t1 = new Taxonomy();
3592 final Taxonomy t2 = new Taxonomy();
3593 final Taxonomy t3 = new Taxonomy();
3594 final Taxonomy t4 = new Taxonomy();
3595 final Taxonomy t5 = new Taxonomy();
3596 t1.setIdentifier( new Identifier( "ecoli" ) );
3597 t1.setTaxonomyCode( "ECOLI" );
3598 t1.setScientificName( "E. coli" );
3599 t1.setCommonName( "coli" );
3600 final Taxonomy t0 = ( Taxonomy ) t1.copy();
3601 if ( !t1.isEqual( t0 ) ) {
3604 t2.setIdentifier( new Identifier( "ecoli" ) );
3605 t2.setTaxonomyCode( "OTHER" );
3606 t2.setScientificName( "what" );
3607 t2.setCommonName( "something" );
3608 if ( !t1.isEqual( t2 ) ) {
3611 t2.setIdentifier( new Identifier( "nemve" ) );
3612 if ( t1.isEqual( t2 ) ) {
3615 t1.setIdentifier( null );
3616 t3.setTaxonomyCode( "ECOLI" );
3617 t3.setScientificName( "what" );
3618 t3.setCommonName( "something" );
3619 if ( !t1.isEqual( t3 ) ) {
3622 t1.setIdentifier( null );
3623 t1.setTaxonomyCode( "" );
3624 t4.setScientificName( "E. ColI" );
3625 t4.setCommonName( "something" );
3626 if ( !t1.isEqual( t4 ) ) {
3629 t4.setScientificName( "B. subtilis" );
3630 t4.setCommonName( "something" );
3631 if ( t1.isEqual( t4 ) ) {
3634 t1.setIdentifier( null );
3635 t1.setTaxonomyCode( "" );
3636 t1.setScientificName( "" );
3637 t5.setCommonName( "COLI" );
3638 if ( !t1.isEqual( t5 ) ) {
3641 t5.setCommonName( "vibrio" );
3642 if ( t1.isEqual( t5 ) ) {
3647 final Identifier id0 = new Identifier( "123", "pfam" );
3648 final Identifier id1 = ( Identifier ) id0.copy();
3649 if ( !id1.isEqual( id1 ) ) {
3652 if ( !id1.isEqual( id0 ) ) {
3655 if ( !id0.isEqual( id1 ) ) {
3662 final ProteinDomain pd0 = new ProteinDomain( "abc", 100, 200 );
3663 final ProteinDomain pd1 = ( ProteinDomain ) pd0.copy();
3664 if ( !pd1.isEqual( pd1 ) ) {
3667 if ( !pd1.isEqual( pd0 ) ) {
3672 final ProteinDomain pd2 = new ProteinDomain( pd0.getName(), pd0.getFrom(), pd0.getTo(), "id" );
3673 final ProteinDomain pd3 = ( ProteinDomain ) pd2.copy();
3674 if ( !pd3.isEqual( pd3 ) ) {
3677 if ( !pd2.isEqual( pd3 ) ) {
3680 if ( !pd0.isEqual( pd3 ) ) {
3685 // DomainArchitecture
3686 // ------------------
3687 final ProteinDomain d0 = new ProteinDomain( "domain0", 10, 20 );
3688 final ProteinDomain d1 = new ProteinDomain( "domain1", 30, 40 );
3689 final ProteinDomain d2 = new ProteinDomain( "domain2", 50, 60 );
3690 final ProteinDomain d3 = new ProteinDomain( "domain3", 70, 80 );
3691 final ProteinDomain d4 = new ProteinDomain( "domain4", 90, 100 );
3692 final ArrayList<PhylogenyData> domains0 = new ArrayList<PhylogenyData>();
3697 final DomainArchitecture ds0 = new DomainArchitecture( domains0, 110 );
3698 if ( ds0.getNumberOfDomains() != 4 ) {
3701 final DomainArchitecture ds1 = ( DomainArchitecture ) ds0.copy();
3702 if ( !ds0.isEqual( ds0 ) ) {
3705 if ( !ds0.isEqual( ds1 ) ) {
3708 if ( ds1.getNumberOfDomains() != 4 ) {
3711 final ArrayList<PhylogenyData> domains1 = new ArrayList<PhylogenyData>();
3716 final DomainArchitecture ds2 = new DomainArchitecture( domains1, 200 );
3717 if ( ds0.isEqual( ds2 ) ) {
3723 final DomainArchitecture ds3 = new DomainArchitecture( "120>30>40>0.9>b>50>60>0.4>c>10>20>0.1>a" );
3724 if ( !ds3.toNHX().toString().equals( ":DS=120>10>20>0.1>a>30>40>0.9>b>50>60>0.4>c" ) ) {
3725 System.out.println( ds3.toNHX() );
3728 if ( ds3.getNumberOfDomains() != 3 ) {
3733 final Event e1 = new Event( Event.EventType.fusion );
3734 if ( e1.isDuplication() ) {
3737 if ( !e1.isFusion() ) {
3740 if ( !e1.asText().toString().equals( "fusion" ) ) {
3743 if ( !e1.asSimpleText().toString().equals( "fusion" ) ) {
3746 final Event e11 = new Event( Event.EventType.fusion );
3747 if ( !e11.isEqual( e1 ) ) {
3750 if ( !e11.toNHX().toString().equals( "" ) ) {
3753 final Event e2 = new Event( Event.EventType.speciation_or_duplication );
3754 if ( e2.isDuplication() ) {
3757 if ( !e2.isSpeciationOrDuplication() ) {
3760 if ( !e2.asText().toString().equals( "speciation_or_duplication" ) ) {
3763 if ( !e2.asSimpleText().toString().equals( "?" ) ) {
3766 if ( !e2.toNHX().toString().equals( ":D=?" ) ) {
3769 if ( e11.isEqual( e2 ) ) {
3772 final Event e2c = ( Event ) e2.copy();
3773 if ( !e2c.isEqual( e2 ) ) {
3776 Event e3 = new Event( 1, 2, 3 );
3777 if ( e3.isDuplication() ) {
3780 if ( e3.isSpeciation() ) {
3783 if ( e3.isGeneLoss() ) {
3786 if ( !e3.asText().toString().equals( "duplications [1] speciations [2] gene-losses [3]" ) ) {
3789 final Event e3c = ( Event ) e3.copy();
3790 final Event e3cc = ( Event ) e3c.copy();
3791 if ( !e3c.asSimpleText().toString().equals( "D2S3L" ) ) {
3795 if ( !e3c.isEqual( e3cc ) ) {
3798 Event e4 = new Event( 1, 2, 3 );
3799 if ( !e4.asText().toString().equals( "duplications [1] speciations [2] gene-losses [3]" ) ) {
3802 if ( !e4.asSimpleText().toString().equals( "D2S3L" ) ) {
3805 final Event e4c = ( Event ) e4.copy();
3807 final Event e4cc = ( Event ) e4c.copy();
3808 if ( !e4cc.asText().toString().equals( "duplications [1] speciations [2] gene-losses [3]" ) ) {
3811 if ( !e4c.isEqual( e4cc ) ) {
3814 final Event e5 = new Event();
3815 if ( !e5.isUnassigned() ) {
3818 if ( !e5.asText().toString().equals( "unassigned" ) ) {
3821 if ( !e5.asSimpleText().toString().equals( "" ) ) {
3824 final Event e6 = new Event( 1, 0, 0 );
3825 if ( !e6.asText().toString().equals( "duplication" ) ) {
3828 if ( !e6.asSimpleText().toString().equals( "D" ) ) {
3831 final Event e7 = new Event( 0, 1, 0 );
3832 if ( !e7.asText().toString().equals( "speciation" ) ) {
3835 if ( !e7.asSimpleText().toString().equals( "S" ) ) {
3838 final Event e8 = new Event( 0, 0, 1 );
3839 if ( !e8.asText().toString().equals( "gene-loss" ) ) {
3842 if ( !e8.asSimpleText().toString().equals( "L" ) ) {
3846 catch ( final Exception e ) {
3847 e.printStackTrace( System.out );
3853 private static boolean testDeletionOfExternalNodes() {
3855 final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
3856 final Phylogeny t0 = factory.create( "A", new NHXParser() )[ 0 ];
3857 final PhylogenyWriter w = new PhylogenyWriter();
3858 if ( t0.isEmpty() ) {
3861 if ( t0.getNumberOfExternalNodes() != 1 ) {
3864 t0.deleteSubtree( t0.getNode( "A" ), false );
3865 if ( t0.getNumberOfExternalNodes() != 0 ) {
3868 if ( !t0.isEmpty() ) {
3871 final Phylogeny t1 = factory.create( "(A,B)r", new NHXParser() )[ 0 ];
3872 if ( t1.getNumberOfExternalNodes() != 2 ) {
3875 t1.deleteSubtree( t1.getNode( "A" ), false );
3876 if ( t1.getNumberOfExternalNodes() != 1 ) {
3879 if ( !t1.getNode( "B" ).getName().equals( "B" ) ) {
3882 t1.deleteSubtree( t1.getNode( "B" ), false );
3883 if ( t1.getNumberOfExternalNodes() != 1 ) {
3886 t1.deleteSubtree( t1.getNode( "r" ), false );
3887 if ( !t1.isEmpty() ) {
3890 final Phylogeny t2 = factory.create( "((A,B),C)", new NHXParser() )[ 0 ];
3891 if ( t2.getNumberOfExternalNodes() != 3 ) {
3894 t2.deleteSubtree( t2.getNode( "B" ), false );
3895 if ( t2.getNumberOfExternalNodes() != 2 ) {
3898 t2.toNewHampshireX();
3899 PhylogenyNode n = t2.getNode( "A" );
3900 if ( !n.getNextExternalNode().getName().equals( "C" ) ) {
3903 t2.deleteSubtree( t2.getNode( "A" ), false );
3904 if ( t2.getNumberOfExternalNodes() != 2 ) {
3907 t2.deleteSubtree( t2.getNode( "C" ), true );
3908 if ( t2.getNumberOfExternalNodes() != 1 ) {
3911 final Phylogeny t3 = factory.create( "((A,B),(C,D))", new NHXParser() )[ 0 ];
3912 if ( t3.getNumberOfExternalNodes() != 4 ) {
3915 t3.deleteSubtree( t3.getNode( "B" ), true );
3916 if ( t3.getNumberOfExternalNodes() != 3 ) {
3919 n = t3.getNode( "A" );
3920 if ( !n.getNextExternalNode().getName().equals( "C" ) ) {
3923 n = n.getNextExternalNode();
3924 if ( !n.getNextExternalNode().getName().equals( "D" ) ) {
3927 t3.deleteSubtree( t3.getNode( "A" ), true );
3928 if ( t3.getNumberOfExternalNodes() != 2 ) {
3931 n = t3.getNode( "C" );
3932 if ( !n.getNextExternalNode().getName().equals( "D" ) ) {
3935 t3.deleteSubtree( t3.getNode( "C" ), true );
3936 if ( t3.getNumberOfExternalNodes() != 1 ) {
3939 t3.deleteSubtree( t3.getNode( "D" ), true );
3940 if ( t3.getNumberOfExternalNodes() != 0 ) {
3943 final Phylogeny t4 = factory.create( "((A,((B11,B12),B2)),(C,D))", new NHXParser() )[ 0 ];
3944 if ( t4.getNumberOfExternalNodes() != 6 ) {
3947 t4.deleteSubtree( t4.getNode( "B2" ), true );
3948 if ( t4.getNumberOfExternalNodes() != 5 ) {
3951 String s = w.toNewHampshire( t4, true ).toString();
3952 if ( !s.equals( "((A,(B11,B12)),(C,D));" ) ) {
3955 t4.deleteSubtree( t4.getNode( "B11" ), true );
3956 if ( t4.getNumberOfExternalNodes() != 4 ) {
3959 t4.deleteSubtree( t4.getNode( "C" ), true );
3960 if ( t4.getNumberOfExternalNodes() != 3 ) {
3963 n = t4.getNode( "A" );
3964 n = n.getNextExternalNode();
3965 if ( !n.getName().equals( "B12" ) ) {
3968 n = n.getNextExternalNode();
3969 if ( !n.getName().equals( "D" ) ) {
3972 s = w.toNewHampshire( t4, true ).toString();
3973 if ( !s.equals( "((A,B12),D);" ) ) {
3976 final Phylogeny t5 = factory.create( "((A,((B11,B12),B2)),(C,D))", new NHXParser() )[ 0 ];
3977 t5.deleteSubtree( t5.getNode( "A" ), true );
3978 if ( t5.getNumberOfExternalNodes() != 5 ) {
3981 s = w.toNewHampshire( t5, true ).toString();
3982 if ( !s.equals( "(((B11,B12),B2),(C,D));" ) ) {
3985 final Phylogeny t6 = factory.create( "((A,((B11,B12),B2)),(C,D))", new NHXParser() )[ 0 ];
3986 t6.deleteSubtree( t6.getNode( "B11" ), true );
3987 if ( t6.getNumberOfExternalNodes() != 5 ) {
3990 s = w.toNewHampshire( t6, false ).toString();
3991 if ( !s.equals( "((A,(B12,B2)),(C,D));" ) ) {
3994 final Phylogeny t7 = factory.create( "((A,((B11,B12),B2)),(C,D))", new NHXParser() )[ 0 ];
3995 t7.deleteSubtree( t7.getNode( "B12" ), true );
3996 if ( t7.getNumberOfExternalNodes() != 5 ) {
3999 s = w.toNewHampshire( t7, true ).toString();
4000 if ( !s.equals( "((A,(B11,B2)),(C,D));" ) ) {
4003 final Phylogeny t8 = factory.create( "((A,((B11,B12),B2)),(C,D))", new NHXParser() )[ 0 ];
4004 t8.deleteSubtree( t8.getNode( "B2" ), true );
4005 if ( t8.getNumberOfExternalNodes() != 5 ) {
4008 s = w.toNewHampshire( t8, false ).toString();
4009 if ( !s.equals( "((A,(B11,B12)),(C,D));" ) ) {
4012 final Phylogeny t9 = factory.create( "((A,((B11,B12),B2)),(C,D))", new NHXParser() )[ 0 ];
4013 t9.deleteSubtree( t9.getNode( "C" ), true );
4014 if ( t9.getNumberOfExternalNodes() != 5 ) {
4017 s = w.toNewHampshire( t9, true ).toString();
4018 if ( !s.equals( "((A,((B11,B12),B2)),D);" ) ) {
4021 final Phylogeny t10 = factory.create( "((A,((B11,B12),B2)),(C,D))", new NHXParser() )[ 0 ];
4022 t10.deleteSubtree( t10.getNode( "D" ), true );
4023 if ( t10.getNumberOfExternalNodes() != 5 ) {
4026 s = w.toNewHampshire( t10, true ).toString();
4027 if ( !s.equals( "((A,((B11,B12),B2)),C);" ) ) {
4030 final Phylogeny t11 = factory.create( "(A,B,C)", new NHXParser() )[ 0 ];
4031 t11.deleteSubtree( t11.getNode( "A" ), true );
4032 if ( t11.getNumberOfExternalNodes() != 2 ) {
4035 s = w.toNewHampshire( t11, true ).toString();
4036 if ( !s.equals( "(B,C);" ) ) {
4039 t11.deleteSubtree( t11.getNode( "C" ), true );
4040 if ( t11.getNumberOfExternalNodes() != 1 ) {
4043 s = w.toNewHampshire( t11, false ).toString();
4044 if ( !s.equals( "B;" ) ) {
4047 final Phylogeny t12 = factory.create( "((A1,A2,A3),(B1,B2,B3),(C1,C2,C3))", new NHXParser() )[ 0 ];
4048 t12.deleteSubtree( t12.getNode( "B2" ), true );
4049 if ( t12.getNumberOfExternalNodes() != 8 ) {
4052 s = w.toNewHampshire( t12, true ).toString();
4053 if ( !s.equals( "((A1,A2,A3),(B1,B3),(C1,C2,C3));" ) ) {
4056 t12.deleteSubtree( t12.getNode( "B3" ), true );
4057 if ( t12.getNumberOfExternalNodes() != 7 ) {
4060 s = w.toNewHampshire( t12, true ).toString();
4061 if ( !s.equals( "((A1,A2,A3),B1,(C1,C2,C3));" ) ) {
4064 t12.deleteSubtree( t12.getNode( "C3" ), true );
4065 if ( t12.getNumberOfExternalNodes() != 6 ) {
4068 s = w.toNewHampshire( t12, true ).toString();
4069 if ( !s.equals( "((A1,A2,A3),B1,(C1,C2));" ) ) {
4072 t12.deleteSubtree( t12.getNode( "A1" ), true );
4073 if ( t12.getNumberOfExternalNodes() != 5 ) {
4076 s = w.toNewHampshire( t12, true ).toString();
4077 if ( !s.equals( "((A2,A3),B1,(C1,C2));" ) ) {
4080 t12.deleteSubtree( t12.getNode( "B1" ), true );
4081 if ( t12.getNumberOfExternalNodes() != 4 ) {
4084 s = w.toNewHampshire( t12, true ).toString();
4085 if ( !s.equals( "((A2,A3),(C1,C2));" ) ) {
4088 t12.deleteSubtree( t12.getNode( "A3" ), true );
4089 if ( t12.getNumberOfExternalNodes() != 3 ) {
4092 s = w.toNewHampshire( t12, true ).toString();
4093 if ( !s.equals( "(A2,(C1,C2));" ) ) {
4096 t12.deleteSubtree( t12.getNode( "A2" ), true );
4097 if ( t12.getNumberOfExternalNodes() != 2 ) {
4100 s = w.toNewHampshire( t12, true ).toString();
4101 if ( !s.equals( "(C1,C2);" ) ) {
4104 final Phylogeny t13 = factory.create( "(A,B,C,(D:1.0,E:2.0):3.0)", new NHXParser() )[ 0 ];
4105 t13.deleteSubtree( t13.getNode( "D" ), true );
4106 if ( t13.getNumberOfExternalNodes() != 4 ) {
4109 s = w.toNewHampshire( t13, true ).toString();
4110 if ( !s.equals( "(A,B,C,E:5.0);" ) ) {
4113 final Phylogeny t14 = factory.create( "((A,B,C,(D:0.1,E:0.4):1.0),F)", new NHXParser() )[ 0 ];
4114 t14.deleteSubtree( t14.getNode( "E" ), true );
4115 if ( t14.getNumberOfExternalNodes() != 5 ) {
4118 s = w.toNewHampshire( t14, true ).toString();
4119 if ( !s.equals( "((A,B,C,D:1.1),F);" ) ) {
4122 final Phylogeny t15 = factory.create( "((A1,A2,A3,A4),(B1,B2,B3,B4),(C1,C2,C3,C4))", new NHXParser() )[ 0 ];
4123 t15.deleteSubtree( t15.getNode( "B2" ), true );
4124 if ( t15.getNumberOfExternalNodes() != 11 ) {
4127 t15.deleteSubtree( t15.getNode( "B1" ), true );
4128 if ( t15.getNumberOfExternalNodes() != 10 ) {
4131 t15.deleteSubtree( t15.getNode( "B3" ), true );
4132 if ( t15.getNumberOfExternalNodes() != 9 ) {
4135 t15.deleteSubtree( t15.getNode( "B4" ), true );
4136 if ( t15.getNumberOfExternalNodes() != 8 ) {
4139 t15.deleteSubtree( t15.getNode( "A1" ), true );
4140 if ( t15.getNumberOfExternalNodes() != 7 ) {
4143 t15.deleteSubtree( t15.getNode( "C4" ), true );
4144 if ( t15.getNumberOfExternalNodes() != 6 ) {
4148 catch ( final Exception e ) {
4149 e.printStackTrace( System.out );
4155 private static boolean testDescriptiveStatistics() {
4157 final DescriptiveStatistics dss1 = new BasicDescriptiveStatistics();
4158 dss1.addValue( 82 );
4159 dss1.addValue( 78 );
4160 dss1.addValue( 70 );
4161 dss1.addValue( 58 );
4162 dss1.addValue( 42 );
4163 if ( dss1.getN() != 5 ) {
4166 if ( !Test.isEqual( dss1.getMin(), 42 ) ) {
4169 if ( !Test.isEqual( dss1.getMax(), 82 ) ) {
4172 if ( !Test.isEqual( dss1.arithmeticMean(), 66 ) ) {
4175 if ( !Test.isEqual( dss1.sampleStandardDeviation(), 16.24807680927192 ) ) {
4178 if ( !Test.isEqual( dss1.median(), 70 ) ) {
4181 if ( !Test.isEqual( dss1.midrange(), 62 ) ) {
4184 if ( !Test.isEqual( dss1.sampleVariance(), 264 ) ) {
4187 if ( !Test.isEqual( dss1.pearsonianSkewness(), -0.7385489458759964 ) ) {
4190 if ( !Test.isEqual( dss1.coefficientOfVariation(), 0.24618298195866547 ) ) {
4193 if ( !Test.isEqual( dss1.sampleStandardUnit( 66 - 16.24807680927192 ), -1.0 ) ) {
4196 if ( !Test.isEqual( dss1.getValue( 1 ), 78 ) ) {
4199 dss1.addValue( 123 );
4200 if ( !Test.isEqual( dss1.arithmeticMean(), 75.5 ) ) {
4203 if ( !Test.isEqual( dss1.getMax(), 123 ) ) {
4206 if ( !Test.isEqual( dss1.standardErrorOfMean(), 11.200446419674531 ) ) {
4209 final DescriptiveStatistics dss2 = new BasicDescriptiveStatistics();
4210 dss2.addValue( -1.85 );
4211 dss2.addValue( 57.5 );
4212 dss2.addValue( 92.78 );
4213 dss2.addValue( 57.78 );
4214 if ( !Test.isEqual( dss2.median(), 57.64 ) ) {
4217 if ( !Test.isEqual( dss2.sampleStandardDeviation(), 39.266984753946495 ) ) {
4220 final double[] a = dss2.getDataAsDoubleArray();
4221 if ( !Test.isEqual( a[ 3 ], 57.78 ) ) {
4224 dss2.addValue( -100 );
4225 if ( !Test.isEqual( dss2.sampleStandardDeviation(), 75.829111296388 ) ) {
4228 if ( !Test.isEqual( dss2.sampleVariance(), 5750.05412 ) ) {
4231 final double[] ds = new double[ 14 ];
4246 final int[] bins = BasicDescriptiveStatistics.performBinning( ds, 0, 40, 4 );
4247 if ( bins.length != 4 ) {
4250 if ( bins[ 0 ] != 2 ) {
4253 if ( bins[ 1 ] != 3 ) {
4256 if ( bins[ 2 ] != 4 ) {
4259 if ( bins[ 3 ] != 5 ) {
4262 final double[] ds1 = new double[ 9 ];
4272 final int[] bins1 = BasicDescriptiveStatistics.performBinning( ds1, 0, 40, 4 );
4273 if ( bins1.length != 4 ) {
4276 if ( bins1[ 0 ] != 2 ) {
4279 if ( bins1[ 1 ] != 3 ) {
4282 if ( bins1[ 2 ] != 0 ) {
4285 if ( bins1[ 3 ] != 4 ) {
4288 final int[] bins1_1 = BasicDescriptiveStatistics.performBinning( ds1, 0, 40, 3 );
4289 if ( bins1_1.length != 3 ) {
4292 if ( bins1_1[ 0 ] != 3 ) {
4295 if ( bins1_1[ 1 ] != 2 ) {
4298 if ( bins1_1[ 2 ] != 4 ) {
4301 final int[] bins1_2 = BasicDescriptiveStatistics.performBinning( ds1, 1, 39, 3 );
4302 if ( bins1_2.length != 3 ) {
4305 if ( bins1_2[ 0 ] != 2 ) {
4308 if ( bins1_2[ 1 ] != 2 ) {
4311 if ( bins1_2[ 2 ] != 2 ) {
4314 final DescriptiveStatistics dss3 = new BasicDescriptiveStatistics();
4328 dss3.addValue( 10 );
4329 dss3.addValue( 10 );
4330 dss3.addValue( 10 );
4331 final AsciiHistogram histo = new AsciiHistogram( dss3 );
4332 histo.toStringBuffer( 10, '=', 40, 5 );
4333 histo.toStringBuffer( 3, 8, 10, '=', 40, 5, null );
4335 catch ( final Exception e ) {
4336 e.printStackTrace( System.out );
4342 private static boolean testDir( final String file ) {
4344 final File f = new File( file );
4345 if ( !f.exists() ) {
4348 if ( !f.isDirectory() ) {
4351 if ( !f.canRead() ) {
4355 catch ( final Exception e ) {
4361 private static boolean testEbiEntryRetrieval() {
4363 final SequenceDatabaseEntry entry = SequenceDbWsTools.obtainEntry( "AAK41263" );
4364 if ( !entry.getAccession().equals( "AAK41263" ) ) {
4365 System.out.println( entry.getAccession() );
4368 if ( !entry.getTaxonomyScientificName().equals( "Sulfolobus solfataricus P2" ) ) {
4369 System.out.println( entry.getTaxonomyScientificName() );
4372 if ( !entry.getSequenceName()
4373 .equals( "Sulfolobus solfataricus P2 Glycogen debranching enzyme, hypothetical (treX-like)" ) ) {
4374 System.out.println( entry.getSequenceName() );
4377 if ( !entry.getGeneName().equals( "treX-like" ) ) {
4378 System.out.println( entry.getGeneName() );
4381 if ( !entry.getTaxonomyIdentifier().equals( "273057" ) ) {
4382 System.out.println( entry.getTaxonomyIdentifier() );
4385 if ( !entry.getAnnotations().first().getRefValue().equals( "3.2.1.33" ) ) {
4386 System.out.println( entry.getAnnotations().first().getRefValue() );
4389 if ( !entry.getAnnotations().first().getRefSource().equals( "EC" ) ) {
4390 System.out.println( entry.getAnnotations().first().getRefSource() );
4393 if ( entry.getCrossReferences().size() < 1 ) {
4396 final SequenceDatabaseEntry entry1 = SequenceDbWsTools.obtainEntry( "ABJ16409" );
4397 if ( !entry1.getAccession().equals( "ABJ16409" ) ) {
4400 if ( !entry1.getTaxonomyScientificName().equals( "Felis catus" ) ) {
4401 System.out.println( entry1.getTaxonomyScientificName() );
4404 if ( !entry1.getSequenceName().equals( "Felis catus (domestic cat) partial BCL2" ) ) {
4405 System.out.println( entry1.getSequenceName() );
4408 if ( !entry1.getTaxonomyIdentifier().equals( "9685" ) ) {
4409 System.out.println( entry1.getTaxonomyIdentifier() );
4412 if ( !entry1.getGeneName().equals( "BCL2" ) ) {
4413 System.out.println( entry1.getGeneName() );
4416 if ( entry1.getCrossReferences().size() < 1 ) {
4419 final SequenceDatabaseEntry entry2 = SequenceDbWsTools.obtainEntry( "NM_184234" );
4420 if ( !entry2.getAccession().equals( "NM_184234" ) ) {
4423 if ( !entry2.getTaxonomyScientificName().equals( "Homo sapiens" ) ) {
4424 System.out.println( entry2.getTaxonomyScientificName() );
4427 if ( !entry2.getSequenceName()
4428 .equals( "Homo sapiens RNA binding motif protein 39 (RBM39), transcript variant 1, mRNA" ) ) {
4429 System.out.println( entry2.getSequenceName() );
4432 if ( !entry2.getTaxonomyIdentifier().equals( "9606" ) ) {
4433 System.out.println( entry2.getTaxonomyIdentifier() );
4436 if ( !entry2.getGeneName().equals( "RBM39" ) ) {
4437 System.out.println( entry2.getGeneName() );
4440 if ( entry2.getCrossReferences().size() < 1 ) {
4443 if ( !entry2.getChromosome().equals( "20" ) ) {
4446 if ( !entry2.getMap().equals( "20q11.22" ) ) {
4449 final SequenceDatabaseEntry entry3 = SequenceDbWsTools.obtainEntry( "HM043801" );
4450 if ( !entry3.getAccession().equals( "HM043801" ) ) {
4453 if ( !entry3.getTaxonomyScientificName().equals( "Bursaphelenchus xylophilus" ) ) {
4454 System.out.println( entry3.getTaxonomyScientificName() );
4457 if ( !entry3.getSequenceName().equals( "Bursaphelenchus xylophilus RAF gene, complete cds" ) ) {
4458 System.out.println( entry3.getSequenceName() );
4461 if ( !entry3.getTaxonomyIdentifier().equals( "6326" ) ) {
4462 System.out.println( entry3.getTaxonomyIdentifier() );
4465 if ( !entry3.getSequenceSymbol().equals( "RAF" ) ) {
4466 System.out.println( entry3.getSequenceSymbol() );
4469 if ( !ForesterUtil.isEmpty( entry3.getGeneName() ) ) {
4472 if ( entry3.getCrossReferences().size() < 1 ) {
4475 final SequenceDatabaseEntry entry4 = SequenceDbWsTools.obtainEntry( "AAA36557.1" );
4476 if ( !entry4.getAccession().equals( "AAA36557" ) ) {
4479 if ( !entry4.getTaxonomyScientificName().equals( "Homo sapiens" ) ) {
4480 System.out.println( entry4.getTaxonomyScientificName() );
4483 if ( !entry4.getSequenceName().equals( "Homo sapiens (human) ras protein" ) ) {
4484 System.out.println( entry4.getSequenceName() );
4487 if ( !entry4.getTaxonomyIdentifier().equals( "9606" ) ) {
4488 System.out.println( entry4.getTaxonomyIdentifier() );
4491 if ( !entry4.getGeneName().equals( "ras" ) ) {
4492 System.out.println( entry4.getGeneName() );
4495 final SequenceDatabaseEntry entry5 = SequenceDbWsTools.obtainEntry( "AAZ45343.1" );
4496 if ( !entry5.getAccession().equals( "AAZ45343" ) ) {
4499 if ( !entry5.getTaxonomyScientificName().equals( "Dechloromonas aromatica RCB" ) ) {
4500 System.out.println( entry5.getTaxonomyScientificName() );
4503 if ( !entry5.getSequenceName().equals( "Dechloromonas aromatica RCB 1,4-alpha-glucan branching enzyme" ) ) {
4504 System.out.println( entry5.getSequenceName() );
4507 if ( !entry5.getTaxonomyIdentifier().equals( "159087" ) ) {
4508 System.out.println( entry5.getTaxonomyIdentifier() );
4511 final SequenceDatabaseEntry entry6 = SequenceDbWsTools.obtainEntry( "M30539" );
4512 if ( !entry6.getAccession().equals( "M30539" ) ) {
4515 if ( !entry6.getGeneName().equals( "ras" ) ) {
4518 if ( !entry6.getSequenceName().equals( "Human SK2 c-Ha-ras-1 oncogene-encoded protein gene, exon 1" ) ) {
4521 if ( !entry6.getTaxonomyIdentifier().equals( "9606" ) ) {
4524 if ( !entry6.getTaxonomyScientificName().equals( "Homo sapiens" ) ) {
4527 if ( entry6.getCrossReferences().size() < 1 ) {
4531 catch ( final IOException e ) {
4532 System.out.println();
4533 System.out.println( "the following might be due to absence internet connection:" );
4534 e.printStackTrace( System.out );
4537 catch ( final Exception e ) {
4538 e.printStackTrace();
4544 private static boolean testExternalNodeRelatedMethods() {
4546 final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
4547 final Phylogeny t1 = factory.create( "((A,B),(C,D))", new NHXParser() )[ 0 ];
4548 PhylogenyNode n = t1.getNode( "A" );
4549 n = n.getNextExternalNode();
4550 if ( !n.getName().equals( "B" ) ) {
4553 n = n.getNextExternalNode();
4554 if ( !n.getName().equals( "C" ) ) {
4557 n = n.getNextExternalNode();
4558 if ( !n.getName().equals( "D" ) ) {
4561 n = t1.getNode( "B" );
4562 while ( !n.isLastExternalNode() ) {
4563 n = n.getNextExternalNode();
4565 final Phylogeny t2 = factory.create( "(((A,B),C),D)", new NHXParser() )[ 0 ];
4566 n = t2.getNode( "A" );
4567 n = n.getNextExternalNode();
4568 if ( !n.getName().equals( "B" ) ) {
4571 n = n.getNextExternalNode();
4572 if ( !n.getName().equals( "C" ) ) {
4575 n = n.getNextExternalNode();
4576 if ( !n.getName().equals( "D" ) ) {
4579 n = t2.getNode( "B" );
4580 while ( !n.isLastExternalNode() ) {
4581 n = n.getNextExternalNode();
4583 final Phylogeny t3 = factory.create( "(((A,B),(C,D)),((E,F),(G,H)))", new NHXParser() )[ 0 ];
4584 n = t3.getNode( "A" );
4585 n = n.getNextExternalNode();
4586 if ( !n.getName().equals( "B" ) ) {
4589 n = n.getNextExternalNode();
4590 if ( !n.getName().equals( "C" ) ) {
4593 n = n.getNextExternalNode();
4594 if ( !n.getName().equals( "D" ) ) {
4597 n = n.getNextExternalNode();
4598 if ( !n.getName().equals( "E" ) ) {
4601 n = n.getNextExternalNode();
4602 if ( !n.getName().equals( "F" ) ) {
4605 n = n.getNextExternalNode();
4606 if ( !n.getName().equals( "G" ) ) {
4609 n = n.getNextExternalNode();
4610 if ( !n.getName().equals( "H" ) ) {
4613 n = t3.getNode( "B" );
4614 while ( !n.isLastExternalNode() ) {
4615 n = n.getNextExternalNode();
4617 final Phylogeny t4 = factory.create( "((A,B),(C,D))", new NHXParser() )[ 0 ];
4618 for( final PhylogenyNodeIterator iter = t4.iteratorExternalForward(); iter.hasNext(); ) {
4619 final PhylogenyNode node = iter.next();
4621 final Phylogeny t5 = factory.create( "(((A,B),(C,D)),((E,F),(G,H)))", new NHXParser() )[ 0 ];
4622 for( final PhylogenyNodeIterator iter = t5.iteratorExternalForward(); iter.hasNext(); ) {
4623 final PhylogenyNode node = iter.next();
4625 final Phylogeny t6 = factory.create( "((((((A))),(((B))),((C)),((((D)))),E)),((F)))", new NHXParser() )[ 0 ];
4626 final PhylogenyNodeIterator iter = t6.iteratorExternalForward();
4627 if ( !iter.next().getName().equals( "A" ) ) {
4630 if ( !iter.next().getName().equals( "B" ) ) {
4633 if ( !iter.next().getName().equals( "C" ) ) {
4636 if ( !iter.next().getName().equals( "D" ) ) {
4639 if ( !iter.next().getName().equals( "E" ) ) {
4642 if ( !iter.next().getName().equals( "F" ) ) {
4645 if ( iter.hasNext() ) {
4649 catch ( final Exception e ) {
4650 e.printStackTrace( System.out );
4656 private static boolean testExtractSNFromNodeName() {
4658 if ( !ParserUtils.extractScientificNameFromNodeName( "BCDO2_Mus_musculus" ).equals( "Mus musculus" ) ) {
4661 if ( !ParserUtils.extractScientificNameFromNodeName( "BCDO2 Mus musculus" ).equals( "Mus musculus" ) ) {
4664 if ( !ParserUtils.extractScientificNameFromNodeName( "Mus_musculus_BCDO2" ).equals( "Mus musculus" ) ) {
4667 if ( !ParserUtils.extractScientificNameFromNodeName( "Mus musculus musculus BCDO2" )
4668 .equals( "Mus musculus musculus" ) ) {
4671 if ( !ParserUtils.extractScientificNameFromNodeName( "Mus_musculus_musculus_BCDO2" )
4672 .equals( "Mus musculus musculus" ) ) {
4675 if ( !ParserUtils.extractScientificNameFromNodeName( "BCDO2 Mus musculus musculus" )
4676 .equals( "Mus musculus musculus" ) ) {
4679 if ( !ParserUtils.extractScientificNameFromNodeName( "Bcl Mus musculus musculus" )
4680 .equals( "Mus musculus musculus" ) ) {
4683 if ( ParserUtils.extractScientificNameFromNodeName( "vcl Mus musculus musculus" ) != null ) {
4686 if ( !ParserUtils.extractScientificNameFromNodeName( "could_be_anything_Mus_musculus_musculus_BCDO2" )
4687 .equals( "Mus musculus musculus" ) ) {
4690 if ( !ParserUtils.extractScientificNameFromNodeName( "could_be_anything_Mus_musculus_musculus_Musculus" )
4691 .equals( "Mus musculus musculus" ) ) {
4694 if ( ParserUtils.extractScientificNameFromNodeName( "could_be_anything_Mus_musculus_musculus_musculus" ) != null ) {
4697 if ( ParserUtils.extractScientificNameFromNodeName( "musculus" ) != null ) {
4700 if ( ParserUtils.extractScientificNameFromNodeName( "mus_musculus" ) != null ) {
4703 if ( ParserUtils.extractScientificNameFromNodeName( "mus_musculus_musculus" ) != null ) {
4706 if ( !ParserUtils.extractScientificNameFromNodeName( "Mus_musculus_musculus_1" )
4707 .equals( "Mus musculus musculus" ) ) {
4710 if ( !ParserUtils.extractScientificNameFromNodeName( "Mus_musculus_1" ).equals( "Mus musculus" ) ) {
4713 if ( ParserUtils.extractScientificNameFromNodeName( "Mus_musculus_bcl" ) != null ) {
4716 if ( !ParserUtils.extractScientificNameFromNodeName( "Mus_musculus_BCL" ).equals( "Mus musculus" ) ) {
4719 if ( ParserUtils.extractScientificNameFromNodeName( "Mus musculus bcl" ) != null ) {
4722 if ( !ParserUtils.extractScientificNameFromNodeName( "Mus musculus BCL" ).equals( "Mus musculus" ) ) {
4725 if ( !ParserUtils.extractScientificNameFromNodeName( "Mus musculus xBCL" ).equals( "Mus musculus" ) ) {
4728 if ( !ParserUtils.extractScientificNameFromNodeName( "Mus musculus x1" ).equals( "Mus musculus" ) ) {
4731 if ( !ParserUtils.extractScientificNameFromNodeName( " -XS12_Mus_musculus_12" ).equals( "Mus musculus" ) ) {
4734 if ( !ParserUtils.extractScientificNameFromNodeName( " -1234_Mus_musculus_12 affrre e" )
4735 .equals( "Mus musculus" ) ) {
4738 if ( !ParserUtils.extractScientificNameFromNodeName( " -1234_Mus_musculus_12_affrre_e" )
4739 .equals( "Mus musculus" ) ) {
4742 if ( !ParserUtils.extractScientificNameFromNodeName( "Mus_musculus" ).equals( "Mus musculus" ) ) {
4745 if ( !ParserUtils.extractScientificNameFromNodeName( "Mus_musculus_musculus_2bcl2" )
4746 .equals( "Mus musculus musculus" ) ) {
4749 if ( !ParserUtils.extractScientificNameFromNodeName( "Mus_musculus_musculus_2bcl2" )
4750 .equals( "Mus musculus musculus" ) ) {
4753 if ( !ParserUtils.extractScientificNameFromNodeName( "Mus_musculus_musculus_bcl2" )
4754 .equals( "Mus musculus musculus" ) ) {
4757 if ( !ParserUtils.extractScientificNameFromNodeName( "Mus_musculus_123" ).equals( "Mus musculus" ) ) {
4760 if ( !ParserUtils.extractScientificNameFromNodeName( "Pilostyles mexicana Mexico Breedlove 27233" )
4761 .equals( "Pilostyles mexicana" ) ) {
4764 if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia_coli_strain_K12/DH10B" )
4765 .equals( "Escherichia coli strain K12/DH10B" ) ) {
4768 if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia_coli_str_K12/DH10B" )
4769 .equals( "Escherichia coli str. K12/DH10B" ) ) {
4772 if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia coli str. K12/DH10B" )
4773 .equals( "Escherichia coli str. K12/DH10B" ) ) {
4776 if ( !ParserUtils.extractScientificNameFromNodeName( "Arabidopsis_lyrata_subsp_lyrata" )
4777 .equals( "Arabidopsis lyrata subsp. lyrata" ) ) {
4780 if ( !ParserUtils.extractScientificNameFromNodeName( "Arabidopsis lyrata subsp. lyrata" )
4781 .equals( "Arabidopsis lyrata subsp. lyrata" ) ) {
4784 if ( !ParserUtils.extractScientificNameFromNodeName( "Arabidopsis lyrata subsp. lyrata 395" )
4785 .equals( "Arabidopsis lyrata subsp. lyrata" ) ) {
4788 if ( !ParserUtils.extractScientificNameFromNodeName( "Arabidopsis lyrata subsp. lyrata bcl2" )
4789 .equals( "Arabidopsis lyrata subsp. lyrata" ) ) {
4792 if ( !ParserUtils.extractScientificNameFromNodeName( "Arabidopsis lyrata subsp lyrata bcl2" )
4793 .equals( "Arabidopsis lyrata subsp. lyrata" ) ) {
4796 if ( !ParserUtils.extractScientificNameFromNodeName( "Arabidopsis lyrata subspecies lyrata bcl2" )
4797 .equals( "Arabidopsis lyrata subspecies lyrata" ) ) {
4800 if ( !ParserUtils.extractScientificNameFromNodeName( "Verbascum sinuatum var. adenosepalum bcl2" )
4801 .equals( "Verbascum sinuatum var. adenosepalum" ) ) {
4804 if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia coli (strain K12)" )
4805 .equals( "Escherichia coli (strain K12)" ) ) {
4808 if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia coli (strain K12) bcl2" )
4809 .equals( "Escherichia coli (strain K12)" ) ) {
4812 if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia coli (str. K12)" )
4813 .equals( "Escherichia coli (str. K12)" ) ) {
4816 if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia coli (str K12)" )
4817 .equals( "Escherichia coli (str. K12)" ) ) {
4820 if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia coli (str. K12) bcl2" )
4821 .equals( "Escherichia coli (str. K12)" ) ) {
4824 if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia coli (var K12) bcl2" )
4825 .equals( "Escherichia coli (var. K12)" ) ) {
4828 if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia coli str. K-12 substr. MG1655star" )
4829 .equals( "Escherichia coli str. K-12 substr. MG1655star" ) ) {
4832 if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia coli str K-12 substr MG1655star" )
4833 .equals( "Escherichia coli str. K-12 substr. MG1655star" ) ) {
4837 .extractScientificNameFromNodeName( "could be anything Escherichia coli str K-12 substr MG1655star" )
4838 .equals( "Escherichia coli str. K-12 substr. MG1655star" ) ) {
4841 if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia coli str K-12 substr MG1655star gene1" )
4842 .equals( "Escherichia coli str. K-12 substr. MG1655star" ) ) {
4846 .extractScientificNameFromNodeName( "could be anything Escherichia coli str K-12 substr MG1655star GENE1" )
4847 .equals( "Escherichia coli str. K-12 substr. MG1655star" ) ) {
4850 if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia_coli_str_K-12_substr_MG1655star" )
4851 .equals( "Escherichia coli str. K-12 substr. MG1655star" ) ) {
4854 if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia_coli_str_K-12_substr_MG1655star" )
4855 .equals( "Escherichia coli str. K-12 substr. MG1655star" ) ) {
4858 if ( !ParserUtils.extractScientificNameFromNodeName( "Macrocera sp." ).equals( "Macrocera sp." ) ) {
4861 if ( !ParserUtils.extractScientificNameFromNodeName( "Macrocera sp. 123" ).equals( "Macrocera sp." ) ) {
4864 if ( !ParserUtils.extractScientificNameFromNodeName( "Macrocera sp. K12" ).equals( "Macrocera sp." ) ) {
4867 if ( !ParserUtils.extractScientificNameFromNodeName( "something Macrocera sp. K12" )
4868 .equals( "Macrocera sp." ) ) {
4871 if ( !ParserUtils.extractScientificNameFromNodeName( "Macrocera sp" ).equals( "Macrocera sp." ) ) {
4874 if ( !ParserUtils.extractScientificNameFromNodeName( "Sesamum rigidum ssp merenskyanum 07 48" )
4875 .equals( "Sesamum rigidum subsp. merenskyanum" ) ) {
4878 if ( !ParserUtils.extractScientificNameFromNodeName( "Sesamum rigidum ssp. merenskyanum" )
4879 .equals( "Sesamum rigidum subsp. merenskyanum" ) ) {
4882 if ( !ParserUtils.extractScientificNameFromNodeName( "Sesamum rigidum (ssp. merenskyanum)" )
4883 .equals( "Sesamum rigidum (subsp. merenskyanum)" ) ) {
4886 if ( !ParserUtils.extractScientificNameFromNodeName( "Sesamum rigidum (ssp merenskyanum)" )
4887 .equals( "Sesamum rigidum (subsp. merenskyanum)" ) ) {
4891 catch ( final Exception e ) {
4892 e.printStackTrace( System.out );
4898 private static boolean testExtractTaxonomyDataFromNodeName() {
4900 PhylogenyNode n = new PhylogenyNode( "tr|B1AM49|B1AM49_HUMAN" );
4901 if ( !ParserUtils.extractTaxonomyDataFromNodeName( n, TAXONOMY_EXTRACTION.AGGRESSIVE ).equals( "HUMAN" ) ) {
4904 n = new PhylogenyNode( "tr|B1AM49|B1AM49_HUMAN~1-2" );
4905 if ( !ParserUtils.extractTaxonomyDataFromNodeName( n, TAXONOMY_EXTRACTION.AGGRESSIVE ).equals( "HUMAN" ) ) {
4908 n = new PhylogenyNode( "tr|B1AM49|HNRPR_HUMAN" );
4909 if ( !ParserUtils.extractTaxonomyDataFromNodeName( n, TAXONOMY_EXTRACTION.AGGRESSIVE ).equals( "HUMAN" ) ) {
4912 n = new PhylogenyNode( "tr|B1AM49|HNRPR_HUMAN|" );
4913 if ( !ParserUtils.extractTaxonomyDataFromNodeName( n, TAXONOMY_EXTRACTION.AGGRESSIVE ).equals( "HUMAN" ) ) {
4916 n = new PhylogenyNode( "tr|B1AM49|HNRPR_HUMAN~12" );
4917 if ( !ParserUtils.extractTaxonomyDataFromNodeName( n, TAXONOMY_EXTRACTION.AGGRESSIVE ).equals( "HUMAN" ) ) {
4920 n = new PhylogenyNode( "HNRPR_HUMAN" );
4921 if ( !ParserUtils.extractTaxonomyDataFromNodeName( n, TAXONOMY_EXTRACTION.AGGRESSIVE ).equals( "HUMAN" ) ) {
4924 n = new PhylogenyNode( "HNRPR_HUMAN_X" );
4925 if ( !ParserUtils.extractTaxonomyDataFromNodeName( n, TAXONOMY_EXTRACTION.AGGRESSIVE ).equals( "HUMAN" ) ) {
4929 catch ( final Exception e ) {
4930 e.printStackTrace( System.out );
4936 private static boolean testExtractTaxonomyCodeFromNodeName() {
4938 if ( ParserUtils.extractTaxonomyCodeFromNodeName( "MOUSE", TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ) != null ) {
4941 if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "SOYBN", TAXONOMY_EXTRACTION.AGGRESSIVE )
4942 .equals( "SOYBN" ) ) {
4945 if ( !ParserUtils.extractTaxonomyCodeFromNodeName( " ARATH ", TAXONOMY_EXTRACTION.AGGRESSIVE )
4946 .equals( "ARATH" ) ) {
4949 if ( !ParserUtils.extractTaxonomyCodeFromNodeName( " ARATH ", TAXONOMY_EXTRACTION.AGGRESSIVE )
4950 .equals( "ARATH" ) ) {
4953 if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "RAT", TAXONOMY_EXTRACTION.AGGRESSIVE ).equals( "RAT" ) ) {
4956 if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "RAT", TAXONOMY_EXTRACTION.AGGRESSIVE ).equals( "RAT" ) ) {
4959 if ( ParserUtils.extractTaxonomyCodeFromNodeName( "RAT1", TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ) != null ) {
4962 if ( !ParserUtils.extractTaxonomyCodeFromNodeName( " _SOYBN", TAXONOMY_EXTRACTION.AGGRESSIVE )
4963 .equals( "SOYBN" ) ) {
4966 if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "SOYBN", TAXONOMY_EXTRACTION.AGGRESSIVE )
4967 .equals( "SOYBN" ) ) {
4970 if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "qwerty SOYBN", TAXONOMY_EXTRACTION.AGGRESSIVE )
4971 .equals( "SOYBN" ) ) {
4974 if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "qwerty_SOYBN", TAXONOMY_EXTRACTION.AGGRESSIVE )
4975 .equals( "SOYBN" ) ) {
4978 if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "ABCD_SOYBN ", TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED )
4979 .equals( "SOYBN" ) ) {
4982 if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "SOYBN", TAXONOMY_EXTRACTION.AGGRESSIVE )
4983 .equals( "SOYBN" ) ) {
4986 if ( !ParserUtils.extractTaxonomyCodeFromNodeName( ",SOYBN,", TAXONOMY_EXTRACTION.AGGRESSIVE )
4987 .equals( "SOYBN" ) ) {
4990 if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "xxx,SOYBN,xxx", TAXONOMY_EXTRACTION.AGGRESSIVE )
4991 .equals( "SOYBN" ) ) {
4994 if ( ParserUtils.extractTaxonomyCodeFromNodeName( "xxxSOYBNxxx", TAXONOMY_EXTRACTION.AGGRESSIVE ) != null ) {
4997 if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "-SOYBN~", TAXONOMY_EXTRACTION.AGGRESSIVE )
4998 .equals( "SOYBN" ) ) {
5001 if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "NNN8_ECOLI/1-2:0.01",
5002 TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT ).equals( "ECOLI" ) ) {
5005 if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "blag_9YX45-blag", TAXONOMY_EXTRACTION.AGGRESSIVE )
5006 .equals( "9YX45" ) ) {
5009 if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "BCL2_MOUSE function = 23445",
5010 TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED )
5011 .equals( "MOUSE" ) ) {
5014 if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "BCL2_MOUSE+function = 23445",
5015 TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED )
5016 .equals( "MOUSE" ) ) {
5019 if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "BCL2_MOUSE|function = 23445",
5020 TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED )
5021 .equals( "MOUSE" ) ) {
5024 if ( ParserUtils.extractTaxonomyCodeFromNodeName( "BCL2_MOUSEfunction = 23445",
5025 TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ) != null ) {
5028 if ( ParserUtils.extractTaxonomyCodeFromNodeName( "BCL2_MOUSEFunction = 23445",
5029 TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ) != null ) {
5032 if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "BCL2_RAT function = 23445",
5033 TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ).equals( "RAT" ) ) {
5036 if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "BCL2_RAT function = 23445",
5037 TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ).equals( "RAT" ) ) {
5040 if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "BCL2_RAT|function = 23445",
5041 TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ).equals( "RAT" ) ) {
5044 if ( ParserUtils.extractTaxonomyCodeFromNodeName( "BCL2_RATfunction = 23445",
5045 TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ) != null ) {
5048 if ( ParserUtils.extractTaxonomyCodeFromNodeName( "BCL2_RATFunction = 23445",
5049 TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ) != null ) {
5052 if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "BCL2_RAT/1-3", TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED )
5053 .equals( "RAT" ) ) {
5056 if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "BCL2_PIG/1-3", TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT )
5057 .equals( "PIG" ) ) {
5061 .extractTaxonomyCodeFromNodeName( "BCL2_MOUSE/1-3", TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED )
5062 .equals( "MOUSE" ) ) {
5065 if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "BCL2_MOUSE/1-3", TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT )
5066 .equals( "MOUSE" ) ) {
5069 if ( ParserUtils.extractTaxonomyCodeFromNodeName( "_MOUSE ", TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ) != null ) {
5073 catch ( final Exception e ) {
5074 e.printStackTrace( System.out );
5080 private static boolean testExtractUniProtKbProteinSeqIdentifier() {
5082 PhylogenyNode n = new PhylogenyNode();
5083 n.setName( "tr|B3RJ64" );
5084 if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "B3RJ64" ) ) {
5087 n.setName( "tr.B3RJ64" );
5088 if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "B3RJ64" ) ) {
5091 n.setName( "tr=B3RJ64" );
5092 if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "B3RJ64" ) ) {
5095 n.setName( "tr-B3RJ64" );
5096 if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "B3RJ64" ) ) {
5099 n.setName( "tr/B3RJ64" );
5100 if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "B3RJ64" ) ) {
5103 n.setName( "tr\\B3RJ64" );
5104 if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "B3RJ64" ) ) {
5107 n.setName( "tr_B3RJ64" );
5108 if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "B3RJ64" ) ) {
5111 n.setName( " tr|B3RJ64 " );
5112 if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "B3RJ64" ) ) {
5115 n.setName( "-tr|B3RJ64-" );
5116 if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "B3RJ64" ) ) {
5119 n.setName( "-tr=B3RJ64-" );
5120 if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "B3RJ64" ) ) {
5123 n.setName( "_tr=B3RJ64_" );
5124 if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "B3RJ64" ) ) {
5127 n.setName( " tr_tr|B3RJ64_sp|123 " );
5128 if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "B3RJ64" ) ) {
5131 n.setName( "B3RJ64" );
5132 if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "B3RJ64" ) ) {
5135 n.setName( "sp|B3RJ64" );
5136 if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "B3RJ64" ) ) {
5139 n.setName( "sp|B3RJ64C" );
5140 if ( SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ) != null ) {
5143 n.setName( "sp B3RJ64" );
5144 if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "B3RJ64" ) ) {
5147 n.setName( "sp|B3RJ6X" );
5148 if ( SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ) != null ) {
5151 n.setName( "sp|B3RJ6" );
5152 if ( SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ) != null ) {
5155 n.setName( "K1PYK7_CRAGI" );
5156 if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "K1PYK7_CRAGI" ) ) {
5159 n.setName( "K1PYK7_PEA" );
5160 if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "K1PYK7_PEA" ) ) {
5163 n.setName( "K1PYK7_RAT" );
5164 if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "K1PYK7_RAT" ) ) {
5167 n.setName( "K1PYK7_PIG" );
5168 if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "K1PYK7_PIG" ) ) {
5171 n.setName( "~K1PYK7_PIG~" );
5172 if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "K1PYK7_PIG" ) ) {
5175 n.setName( "123456_ECOLI-K1PYK7_CRAGI-sp" );
5176 if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "K1PYK7_CRAGI" ) ) {
5179 n.setName( "K1PYKX_CRAGI" );
5180 if ( SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ) != null ) {
5183 n.setName( "XXXXX_CRAGI" );
5184 if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "XXXXX_CRAGI" ) ) {
5187 n.setName( "tr|H3IB65|H3IB65_STRPU~2-2" );
5188 if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "H3IB65" ) ) {
5191 n.setName( "jgi|Lacbi2|181470|Lacbi1.estExt_GeneWisePlus_human.C_10729~2-3" );
5192 if ( SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ) != null ) {
5195 n.setName( "sp|Q86U06|RBM23_HUMAN~2-2" );
5196 if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "Q86U06" ) ) {
5199 n = new PhylogenyNode();
5200 org.forester.phylogeny.data.Sequence seq = new org.forester.phylogeny.data.Sequence();
5201 seq.setSymbol( "K1PYK7_CRAGI" );
5202 n.getNodeData().addSequence( seq );
5203 if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "K1PYK7_CRAGI" ) ) {
5206 seq.setSymbol( "tr|B3RJ64" );
5207 if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "B3RJ64" ) ) {
5210 n = new PhylogenyNode();
5211 seq = new org.forester.phylogeny.data.Sequence();
5212 seq.setName( "K1PYK7_CRAGI" );
5213 n.getNodeData().addSequence( seq );
5214 if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "K1PYK7_CRAGI" ) ) {
5217 seq.setName( "tr|B3RJ64" );
5218 if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "B3RJ64" ) ) {
5221 n = new PhylogenyNode();
5222 seq = new org.forester.phylogeny.data.Sequence();
5223 seq.setAccession( new Accession( "K1PYK8_CRAGI", "?" ) );
5224 n.getNodeData().addSequence( seq );
5225 if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "K1PYK8_CRAGI" ) ) {
5228 n = new PhylogenyNode();
5229 seq = new org.forester.phylogeny.data.Sequence();
5230 seq.setAccession( new Accession( "tr|B3RJ64", "?" ) );
5231 n.getNodeData().addSequence( seq );
5232 if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "B3RJ64" ) ) {
5236 n = new PhylogenyNode();
5237 n.setName( "ACP19736" );
5238 if ( !SequenceAccessionTools.obtainGenbankAccessorFromDataFields( n ).equals( "ACP19736" ) ) {
5241 n = new PhylogenyNode();
5242 n.setName( "|ACP19736|" );
5243 if ( !SequenceAccessionTools.obtainGenbankAccessorFromDataFields( n ).equals( "ACP19736" ) ) {
5247 catch ( final Exception e ) {
5248 e.printStackTrace( System.out );
5254 private static boolean testFastaParser() {
5256 FileInputStream fis1 = new FileInputStream( PATH_TO_TEST_DATA + "fasta_0.fasta" );
5257 if ( !FastaParser.isLikelyFasta( fis1 ) ) {
5264 FileInputStream fis2 = new FileInputStream( PATH_TO_TEST_DATA + "msa_3.txt" );
5265 if ( FastaParser.isLikelyFasta( fis2 ) ) {
5272 final Msa msa_0 = FastaParser.parseMsa( new FileInputStream( PATH_TO_TEST_DATA + "fasta_0.fasta" ) );
5273 if ( !msa_0.getSequenceAsString( 0 ).toString().equalsIgnoreCase( "ACGTGKXFMFDMXEXXXSFMFMF" ) ) {
5276 if ( !msa_0.getIdentifier( 0 ).equals( "one dumb" ) ) {
5279 if ( !msa_0.getSequenceAsString( 1 ).toString().equalsIgnoreCase( "DKXASDFXSFXFKFKSXDFKSLX" ) ) {
5282 if ( !msa_0.getSequenceAsString( 2 ).toString().equalsIgnoreCase( "SXDFKSXLFSFPWEXPROWXERR" ) ) {
5285 if ( !msa_0.getSequenceAsString( 3 ).toString().equalsIgnoreCase( "AAAAAAAAAAAAAAAAAAAAAAA" ) ) {
5288 if ( !msa_0.getSequenceAsString( 4 ).toString().equalsIgnoreCase( "DDDDDDDDDDDDDDDDDDDDAXF" ) ) {
5292 catch ( final Exception e ) {
5293 e.printStackTrace();
5299 private static boolean testGenbankAccessorParsing() {
5300 //The format for GenBank Accession numbers are:
5301 //Nucleotide: 1 letter + 5 numerals OR 2 letters + 6 numerals
5302 //Protein: 3 letters + 5 numerals
5303 //http://www.ncbi.nlm.nih.gov/Sequin/acc.html
5304 if ( !SequenceAccessionTools.parseGenbankAccessorFromString( "AY423861" ).equals( "AY423861" ) ) {
5307 if ( !SequenceAccessionTools.parseGenbankAccessorFromString( ".AY423861.2" ).equals( "AY423861.2" ) ) {
5310 if ( !SequenceAccessionTools.parseGenbankAccessorFromString( "345_.AY423861.24_345" ).equals( "AY423861.24" ) ) {
5313 if ( SequenceAccessionTools.parseGenbankAccessorFromString( "AAY423861" ) != null ) {
5316 if ( SequenceAccessionTools.parseGenbankAccessorFromString( "AY4238612" ) != null ) {
5319 if ( SequenceAccessionTools.parseGenbankAccessorFromString( "AAY4238612" ) != null ) {
5322 if ( SequenceAccessionTools.parseGenbankAccessorFromString( "Y423861" ) != null ) {
5325 if ( !SequenceAccessionTools.parseGenbankAccessorFromString( "S12345" ).equals( "S12345" ) ) {
5328 if ( !SequenceAccessionTools.parseGenbankAccessorFromString( "|S12345|" ).equals( "S12345" ) ) {
5331 if ( SequenceAccessionTools.parseGenbankAccessorFromString( "|S123456" ) != null ) {
5334 if ( SequenceAccessionTools.parseGenbankAccessorFromString( "ABC123456" ) != null ) {
5337 if ( !SequenceAccessionTools.parseGenbankAccessorFromString( "ABC12345" ).equals( "ABC12345" ) ) {
5340 if ( !SequenceAccessionTools.parseGenbankAccessorFromString( "&ABC12345&" ).equals( "ABC12345" ) ) {
5343 if ( SequenceAccessionTools.parseGenbankAccessorFromString( "ABCD12345" ) != null ) {
5349 private static boolean testGeneralMsaParser() {
5351 final String msa_str_0 = "seq1 abcd\n\nseq2 efgh\n";
5352 final Msa msa_0 = GeneralMsaParser.parse( new ByteArrayInputStream( msa_str_0.getBytes() ) );
5353 final String msa_str_1 = "seq1 abc\nseq2 ghi\nseq1 def\nseq2 jkm\n";
5354 final Msa msa_1 = GeneralMsaParser.parse( new ByteArrayInputStream( msa_str_1.getBytes() ) );
5355 final String msa_str_2 = "seq1 abc\nseq2 ghi\n\ndef\njkm\n";
5356 final Msa msa_2 = GeneralMsaParser.parse( new ByteArrayInputStream( msa_str_2.getBytes() ) );
5357 final String msa_str_3 = "seq1 abc\n def\nseq2 ghi\n jkm\n";
5358 final Msa msa_3 = GeneralMsaParser.parse( new ByteArrayInputStream( msa_str_3.getBytes() ) );
5359 if ( !msa_1.getSequenceAsString( 0 ).toString().equalsIgnoreCase( "abcdef" ) ) {
5362 if ( !msa_1.getSequenceAsString( 1 ).toString().equalsIgnoreCase( "ghixkm" ) ) {
5365 if ( !msa_1.getIdentifier( 0 ).toString().equals( "seq1" ) ) {
5368 if ( !msa_1.getIdentifier( 1 ).toString().equals( "seq2" ) ) {
5371 if ( !msa_2.getSequenceAsString( 0 ).toString().equalsIgnoreCase( "abcdef" ) ) {
5374 if ( !msa_2.getSequenceAsString( 1 ).toString().equalsIgnoreCase( "ghixkm" ) ) {
5377 if ( !msa_2.getIdentifier( 0 ).toString().equals( "seq1" ) ) {
5380 if ( !msa_2.getIdentifier( 1 ).toString().equals( "seq2" ) ) {
5383 if ( !msa_3.getSequenceAsString( 0 ).toString().equalsIgnoreCase( "abcdef" ) ) {
5386 if ( !msa_3.getSequenceAsString( 1 ).toString().equalsIgnoreCase( "ghixkm" ) ) {
5389 if ( !msa_3.getIdentifier( 0 ).toString().equals( "seq1" ) ) {
5392 if ( !msa_3.getIdentifier( 1 ).toString().equals( "seq2" ) ) {
5395 final Msa msa_4 = GeneralMsaParser.parse( new FileInputStream( PATH_TO_TEST_DATA + "msa_1.txt" ) );
5396 if ( !msa_4.getSequenceAsString( 0 ).toString().equalsIgnoreCase( "abcdefeeeeeeeexx" ) ) {
5399 if ( !msa_4.getSequenceAsString( 1 ).toString().equalsIgnoreCase( "efghixffffffffyy" ) ) {
5402 if ( !msa_4.getSequenceAsString( 2 ).toString().equalsIgnoreCase( "klmnxphhhhhhhhzz" ) ) {
5405 final Msa msa_5 = GeneralMsaParser.parse( new FileInputStream( PATH_TO_TEST_DATA + "msa_2.txt" ) );
5406 if ( !msa_5.getSequenceAsString( 0 ).toString().equalsIgnoreCase( "abcdefxx" ) ) {
5409 if ( !msa_5.getSequenceAsString( 1 ).toString().equalsIgnoreCase( "efghixyy" ) ) {
5412 if ( !msa_5.getSequenceAsString( 2 ).toString().equalsIgnoreCase( "klmnxpzz" ) ) {
5415 final Msa msa_6 = GeneralMsaParser.parse( new FileInputStream( PATH_TO_TEST_DATA + "msa_3.txt" ) );
5416 if ( !msa_6.getSequenceAsString( 0 ).toString().equalsIgnoreCase( "abcdefeeeeeeeexx" ) ) {
5419 if ( !msa_6.getSequenceAsString( 1 ).toString().equalsIgnoreCase( "efghixffffffffyy" ) ) {
5422 if ( !msa_6.getSequenceAsString( 2 ).toString().equalsIgnoreCase( "klmnxphhhhhhhhzz" ) ) {
5426 catch ( final Exception e ) {
5427 e.printStackTrace();
5433 private static boolean testGeneralTable() {
5435 final GeneralTable<Integer, String> t0 = new GeneralTable<Integer, String>();
5436 t0.setValue( 3, 2, "23" );
5437 t0.setValue( 10, 1, "error" );
5438 t0.setValue( 10, 1, "110" );
5439 t0.setValue( 9, 1, "19" );
5440 t0.setValue( 1, 10, "101" );
5441 t0.setValue( 10, 10, "1010" );
5442 t0.setValue( 100, 10, "10100" );
5443 t0.setValue( 0, 0, "00" );
5444 if ( !t0.getValue( 3, 2 ).equals( "23" ) ) {
5447 if ( !t0.getValue( 10, 1 ).equals( "110" ) ) {
5450 if ( !t0.getValueAsString( 1, 10 ).equals( "101" ) ) {
5453 if ( !t0.getValueAsString( 10, 10 ).equals( "1010" ) ) {
5456 if ( !t0.getValueAsString( 100, 10 ).equals( "10100" ) ) {
5459 if ( !t0.getValueAsString( 9, 1 ).equals( "19" ) ) {
5462 if ( !t0.getValueAsString( 0, 0 ).equals( "00" ) ) {
5465 if ( !t0.getValueAsString( 49, 4 ).equals( "" ) ) {
5468 if ( !t0.getValueAsString( 22349, 3434344 ).equals( "" ) ) {
5471 final GeneralTable<String, String> t1 = new GeneralTable<String, String>();
5472 t1.setValue( "3", "2", "23" );
5473 t1.setValue( "10", "1", "error" );
5474 t1.setValue( "10", "1", "110" );
5475 t1.setValue( "9", "1", "19" );
5476 t1.setValue( "1", "10", "101" );
5477 t1.setValue( "10", "10", "1010" );
5478 t1.setValue( "100", "10", "10100" );
5479 t1.setValue( "0", "0", "00" );
5480 t1.setValue( "qwerty", "zxcvbnm", "asdef" );
5481 if ( !t1.getValue( "3", "2" ).equals( "23" ) ) {
5484 if ( !t1.getValue( "10", "1" ).equals( "110" ) ) {
5487 if ( !t1.getValueAsString( "1", "10" ).equals( "101" ) ) {
5490 if ( !t1.getValueAsString( "10", "10" ).equals( "1010" ) ) {
5493 if ( !t1.getValueAsString( "100", "10" ).equals( "10100" ) ) {
5496 if ( !t1.getValueAsString( "9", "1" ).equals( "19" ) ) {
5499 if ( !t1.getValueAsString( "0", "0" ).equals( "00" ) ) {
5502 if ( !t1.getValueAsString( "qwerty", "zxcvbnm" ).equals( "asdef" ) ) {
5505 if ( !t1.getValueAsString( "49", "4" ).equals( "" ) ) {
5508 if ( !t1.getValueAsString( "22349", "3434344" ).equals( "" ) ) {
5512 catch ( final Exception e ) {
5513 e.printStackTrace( System.out );
5519 private static boolean testGetDistance() {
5521 final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
5522 final Phylogeny p1 = factory.create( "(((A:1,B:2,X:100)ab:3,C:4)abc:5,(D:7,(E:9,F:10)ef:8)def:6)r",
5523 new NHXParser() )[ 0 ];
5524 if ( PhylogenyMethods.calculateDistance( p1.getNode( "C" ), p1.getNode( "C" ) ) != 0 ) {
5527 if ( PhylogenyMethods.calculateDistance( p1.getNode( "def" ), p1.getNode( "def" ) ) != 0 ) {
5530 if ( PhylogenyMethods.calculateDistance( p1.getNode( "ef" ), p1.getNode( "ef" ) ) != 0 ) {
5533 if ( PhylogenyMethods.calculateDistance( p1.getNode( "r" ), p1.getNode( "r" ) ) != 0 ) {
5536 if ( PhylogenyMethods.calculateDistance( p1.getNode( "A" ), p1.getNode( "A" ) ) != 0 ) {
5539 if ( PhylogenyMethods.calculateDistance( p1.getNode( "A" ), p1.getNode( "B" ) ) != 3 ) {
5542 if ( PhylogenyMethods.calculateDistance( p1.getNode( "B" ), p1.getNode( "A" ) ) != 3 ) {
5545 if ( PhylogenyMethods.calculateDistance( p1.getNode( "A" ), p1.getNode( "C" ) ) != 8 ) {
5548 if ( PhylogenyMethods.calculateDistance( p1.getNode( "C" ), p1.getNode( "A" ) ) != 8 ) {
5551 if ( PhylogenyMethods.calculateDistance( p1.getNode( "A" ), p1.getNode( "D" ) ) != 22 ) {
5554 if ( PhylogenyMethods.calculateDistance( p1.getNode( "A" ), p1.getNode( "E" ) ) != 32 ) {
5557 if ( PhylogenyMethods.calculateDistance( p1.getNode( "E" ), p1.getNode( "A" ) ) != 32 ) {
5560 if ( PhylogenyMethods.calculateDistance( p1.getNode( "A" ), p1.getNode( "F" ) ) != 33 ) {
5563 if ( PhylogenyMethods.calculateDistance( p1.getNode( "F" ), p1.getNode( "A" ) ) != 33 ) {
5566 if ( PhylogenyMethods.calculateDistance( p1.getNode( "A" ), p1.getNode( "ab" ) ) != 1 ) {
5569 if ( PhylogenyMethods.calculateDistance( p1.getNode( "ab" ), p1.getNode( "A" ) ) != 1 ) {
5572 if ( PhylogenyMethods.calculateDistance( p1.getNode( "A" ), p1.getNode( "abc" ) ) != 4 ) {
5575 if ( PhylogenyMethods.calculateDistance( p1.getNode( "abc" ), p1.getNode( "A" ) ) != 4 ) {
5578 if ( PhylogenyMethods.calculateDistance( p1.getNode( "A" ), p1.getNode( "r" ) ) != 9 ) {
5581 if ( PhylogenyMethods.calculateDistance( p1.getNode( "r" ), p1.getNode( "A" ) ) != 9 ) {
5584 if ( PhylogenyMethods.calculateDistance( p1.getNode( "A" ), p1.getNode( "def" ) ) != 15 ) {
5587 if ( PhylogenyMethods.calculateDistance( p1.getNode( "def" ), p1.getNode( "A" ) ) != 15 ) {
5590 if ( PhylogenyMethods.calculateDistance( p1.getNode( "A" ), p1.getNode( "ef" ) ) != 23 ) {
5593 if ( PhylogenyMethods.calculateDistance( p1.getNode( "ef" ), p1.getNode( "A" ) ) != 23 ) {
5596 if ( PhylogenyMethods.calculateDistance( p1.getNode( "ef" ), p1.getNode( "def" ) ) != 8 ) {
5599 if ( PhylogenyMethods.calculateDistance( p1.getNode( "def" ), p1.getNode( "ef" ) ) != 8 ) {
5602 if ( PhylogenyMethods.calculateDistance( p1.getNode( "ef" ), p1.getNode( "r" ) ) != 14 ) {
5605 if ( PhylogenyMethods.calculateDistance( p1.getNode( "ef" ), p1.getNode( "abc" ) ) != 19 ) {
5608 if ( PhylogenyMethods.calculateDistance( p1.getNode( "ef" ), p1.getNode( "ab" ) ) != 22 ) {
5611 if ( PhylogenyMethods.calculateDistance( p1.getNode( "ab" ), p1.getNode( "ef" ) ) != 22 ) {
5614 if ( PhylogenyMethods.calculateDistance( p1.getNode( "def" ), p1.getNode( "abc" ) ) != 11 ) {
5617 final Phylogeny p2 = factory.create( "((A:4,B:5,C:6)abc:1,(D:7,E:8,F:9)def:2,(G:10,H:11,I:12)ghi:3)r",
5618 new NHXParser() )[ 0 ];
5619 if ( PhylogenyMethods.calculateDistance( p2.getNode( "A" ), p2.getNode( "B" ) ) != 9 ) {
5622 if ( PhylogenyMethods.calculateDistance( p2.getNode( "A" ), p2.getNode( "C" ) ) != 10 ) {
5625 if ( PhylogenyMethods.calculateDistance( p2.getNode( "A" ), p2.getNode( "D" ) ) != 14 ) {
5628 if ( PhylogenyMethods.calculateDistance( p2.getNode( "A" ), p2.getNode( "ghi" ) ) != 8 ) {
5631 if ( PhylogenyMethods.calculateDistance( p2.getNode( "A" ), p2.getNode( "I" ) ) != 20 ) {
5634 if ( PhylogenyMethods.calculateDistance( p2.getNode( "G" ), p2.getNode( "ghi" ) ) != 10 ) {
5637 if ( PhylogenyMethods.calculateDistance( p2.getNode( "r" ), p2.getNode( "r" ) ) != 0 ) {
5640 if ( PhylogenyMethods.calculateDistance( p2.getNode( "r" ), p2.getNode( "G" ) ) != 13 ) {
5643 if ( PhylogenyMethods.calculateDistance( p2.getNode( "G" ), p2.getNode( "r" ) ) != 13 ) {
5646 if ( PhylogenyMethods.calculateDistance( p2.getNode( "G" ), p2.getNode( "H" ) ) != 21 ) {
5649 if ( PhylogenyMethods.calculateDistance( p2.getNode( "G" ), p2.getNode( "I" ) ) != 22 ) {
5653 catch ( final Exception e ) {
5654 e.printStackTrace( System.out );
5660 private static boolean testGetLCA() {
5662 final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
5663 final Phylogeny p1 = factory.create( "((((((A,B)ab,C)abc,D)abcd,E)abcde,F)abcdef,(G,H)gh)abcdefgh",
5664 new NHXParser() )[ 0 ];
5665 final PhylogenyNode A = PhylogenyMethods.calculateLCA( p1.getNode( "A" ), p1.getNode( "A" ) );
5666 if ( !A.getName().equals( "A" ) ) {
5669 final PhylogenyNode gh = PhylogenyMethods.calculateLCA( p1.getNode( "gh" ), p1.getNode( "gh" ) );
5670 if ( !gh.getName().equals( "gh" ) ) {
5673 final PhylogenyNode ab = PhylogenyMethods.calculateLCA( p1.getNode( "A" ), p1.getNode( "B" ) );
5674 if ( !ab.getName().equals( "ab" ) ) {
5677 final PhylogenyNode ab2 = PhylogenyMethods.calculateLCA( p1.getNode( "B" ), p1.getNode( "A" ) );
5678 if ( !ab2.getName().equals( "ab" ) ) {
5681 final PhylogenyNode gh2 = PhylogenyMethods.calculateLCA( p1.getNode( "H" ), p1.getNode( "G" ) );
5682 if ( !gh2.getName().equals( "gh" ) ) {
5685 final PhylogenyNode gh3 = PhylogenyMethods.calculateLCA( p1.getNode( "G" ), p1.getNode( "H" ) );
5686 if ( !gh3.getName().equals( "gh" ) ) {
5689 final PhylogenyNode abc = PhylogenyMethods.calculateLCA( p1.getNode( "C" ), p1.getNode( "A" ) );
5690 if ( !abc.getName().equals( "abc" ) ) {
5693 final PhylogenyNode abc2 = PhylogenyMethods.calculateLCA( p1.getNode( "A" ), p1.getNode( "C" ) );
5694 if ( !abc2.getName().equals( "abc" ) ) {
5697 final PhylogenyNode abcd = PhylogenyMethods.calculateLCA( p1.getNode( "A" ), p1.getNode( "D" ) );
5698 if ( !abcd.getName().equals( "abcd" ) ) {
5701 final PhylogenyNode abcd2 = PhylogenyMethods.calculateLCA( p1.getNode( "D" ), p1.getNode( "A" ) );
5702 if ( !abcd2.getName().equals( "abcd" ) ) {
5705 final PhylogenyNode abcdef = PhylogenyMethods.calculateLCA( p1.getNode( "A" ), p1.getNode( "F" ) );
5706 if ( !abcdef.getName().equals( "abcdef" ) ) {
5709 final PhylogenyNode abcdef2 = PhylogenyMethods.calculateLCA( p1.getNode( "F" ), p1.getNode( "A" ) );
5710 if ( !abcdef2.getName().equals( "abcdef" ) ) {
5713 final PhylogenyNode abcdef3 = PhylogenyMethods.calculateLCA( p1.getNode( "ab" ), p1.getNode( "F" ) );
5714 if ( !abcdef3.getName().equals( "abcdef" ) ) {
5717 final PhylogenyNode abcdef4 = PhylogenyMethods.calculateLCA( p1.getNode( "F" ), p1.getNode( "ab" ) );
5718 if ( !abcdef4.getName().equals( "abcdef" ) ) {
5721 final PhylogenyNode abcde = PhylogenyMethods.calculateLCA( p1.getNode( "A" ), p1.getNode( "E" ) );
5722 if ( !abcde.getName().equals( "abcde" ) ) {
5725 final PhylogenyNode abcde2 = PhylogenyMethods.calculateLCA( p1.getNode( "E" ), p1.getNode( "A" ) );
5726 if ( !abcde2.getName().equals( "abcde" ) ) {
5729 final PhylogenyNode r = PhylogenyMethods.calculateLCA( p1.getNode( "abcdefgh" ), p1.getNode( "abcdefgh" ) );
5730 if ( !r.getName().equals( "abcdefgh" ) ) {
5733 final PhylogenyNode r2 = PhylogenyMethods.calculateLCA( p1.getNode( "A" ), p1.getNode( "H" ) );
5734 if ( !r2.getName().equals( "abcdefgh" ) ) {
5737 final PhylogenyNode r3 = PhylogenyMethods.calculateLCA( p1.getNode( "H" ), p1.getNode( "A" ) );
5738 if ( !r3.getName().equals( "abcdefgh" ) ) {
5741 final PhylogenyNode abcde3 = PhylogenyMethods.calculateLCA( p1.getNode( "E" ), p1.getNode( "abcde" ) );
5742 if ( !abcde3.getName().equals( "abcde" ) ) {
5745 final PhylogenyNode abcde4 = PhylogenyMethods.calculateLCA( p1.getNode( "abcde" ), p1.getNode( "E" ) );
5746 if ( !abcde4.getName().equals( "abcde" ) ) {
5749 final PhylogenyNode ab3 = PhylogenyMethods.calculateLCA( p1.getNode( "ab" ), p1.getNode( "B" ) );
5750 if ( !ab3.getName().equals( "ab" ) ) {
5753 final PhylogenyNode ab4 = PhylogenyMethods.calculateLCA( p1.getNode( "B" ), p1.getNode( "ab" ) );
5754 if ( !ab4.getName().equals( "ab" ) ) {
5757 final Phylogeny p2 = factory.create( "(a,b,(((c,d)cd,e)cde,f)cdef)r", new NHXParser() )[ 0 ];
5758 final PhylogenyNode cd = PhylogenyMethods.calculateLCA( p2.getNode( "c" ), p2.getNode( "d" ) );
5759 if ( !cd.getName().equals( "cd" ) ) {
5762 final PhylogenyNode cd2 = PhylogenyMethods.calculateLCA( p2.getNode( "d" ), p2.getNode( "c" ) );
5763 if ( !cd2.getName().equals( "cd" ) ) {
5766 final PhylogenyNode cde = PhylogenyMethods.calculateLCA( p2.getNode( "c" ), p2.getNode( "e" ) );
5767 if ( !cde.getName().equals( "cde" ) ) {
5770 final PhylogenyNode cde2 = PhylogenyMethods.calculateLCA( p2.getNode( "e" ), p2.getNode( "c" ) );
5771 if ( !cde2.getName().equals( "cde" ) ) {
5774 final PhylogenyNode cdef = PhylogenyMethods.calculateLCA( p2.getNode( "c" ), p2.getNode( "f" ) );
5775 if ( !cdef.getName().equals( "cdef" ) ) {
5778 final PhylogenyNode cdef2 = PhylogenyMethods.calculateLCA( p2.getNode( "d" ), p2.getNode( "f" ) );
5779 if ( !cdef2.getName().equals( "cdef" ) ) {
5782 final PhylogenyNode cdef3 = PhylogenyMethods.calculateLCA( p2.getNode( "f" ), p2.getNode( "d" ) );
5783 if ( !cdef3.getName().equals( "cdef" ) ) {
5786 final PhylogenyNode rt = PhylogenyMethods.calculateLCA( p2.getNode( "c" ), p2.getNode( "a" ) );
5787 if ( !rt.getName().equals( "r" ) ) {
5790 final Phylogeny p3 = factory
5791 .create( "((((a,(b,c)bc)abc,(d,e)de)abcde,f)abcdef,(((g,h)gh,(i,j)ij)ghij,k)ghijk,l)",
5792 new NHXParser() )[ 0 ];
5793 final PhylogenyNode bc_3 = PhylogenyMethods.calculateLCA( p3.getNode( "b" ), p3.getNode( "c" ) );
5794 if ( !bc_3.getName().equals( "bc" ) ) {
5797 final PhylogenyNode ac_3 = PhylogenyMethods.calculateLCA( p3.getNode( "a" ), p3.getNode( "c" ) );
5798 if ( !ac_3.getName().equals( "abc" ) ) {
5801 final PhylogenyNode ad_3 = PhylogenyMethods.calculateLCA( p3.getNode( "a" ), p3.getNode( "d" ) );
5802 if ( !ad_3.getName().equals( "abcde" ) ) {
5805 final PhylogenyNode af_3 = PhylogenyMethods.calculateLCA( p3.getNode( "a" ), p3.getNode( "f" ) );
5806 if ( !af_3.getName().equals( "abcdef" ) ) {
5809 final PhylogenyNode ag_3 = PhylogenyMethods.calculateLCA( p3.getNode( "a" ), p3.getNode( "g" ) );
5810 if ( !ag_3.getName().equals( "" ) ) {
5813 if ( !ag_3.isRoot() ) {
5816 final PhylogenyNode al_3 = PhylogenyMethods.calculateLCA( p3.getNode( "a" ), p3.getNode( "l" ) );
5817 if ( !al_3.getName().equals( "" ) ) {
5820 if ( !al_3.isRoot() ) {
5823 final PhylogenyNode kl_3 = PhylogenyMethods.calculateLCA( p3.getNode( "k" ), p3.getNode( "l" ) );
5824 if ( !kl_3.getName().equals( "" ) ) {
5827 if ( !kl_3.isRoot() ) {
5830 final PhylogenyNode fl_3 = PhylogenyMethods.calculateLCA( p3.getNode( "f" ), p3.getNode( "l" ) );
5831 if ( !fl_3.getName().equals( "" ) ) {
5834 if ( !fl_3.isRoot() ) {
5837 final PhylogenyNode gk_3 = PhylogenyMethods.calculateLCA( p3.getNode( "g" ), p3.getNode( "k" ) );
5838 if ( !gk_3.getName().equals( "ghijk" ) ) {
5841 final Phylogeny p4 = factory.create( "(a,b,c)r", new NHXParser() )[ 0 ];
5842 final PhylogenyNode r_4 = PhylogenyMethods.calculateLCA( p4.getNode( "b" ), p4.getNode( "c" ) );
5843 if ( !r_4.getName().equals( "r" ) ) {
5846 final Phylogeny p5 = factory.create( "((a,b),c,d)root", new NHXParser() )[ 0 ];
5847 final PhylogenyNode r_5 = PhylogenyMethods.calculateLCA( p5.getNode( "a" ), p5.getNode( "c" ) );
5848 if ( !r_5.getName().equals( "root" ) ) {
5851 final Phylogeny p6 = factory.create( "((a,b),c,d)rot", new NHXParser() )[ 0 ];
5852 final PhylogenyNode r_6 = PhylogenyMethods.calculateLCA( p6.getNode( "c" ), p6.getNode( "a" ) );
5853 if ( !r_6.getName().equals( "rot" ) ) {
5856 final Phylogeny p7 = factory.create( "(((a,b)x,c)x,d,e)rott", new NHXParser() )[ 0 ];
5857 final PhylogenyNode r_7 = PhylogenyMethods.calculateLCA( p7.getNode( "a" ), p7.getNode( "e" ) );
5858 if ( !r_7.getName().equals( "rott" ) ) {
5862 catch ( final Exception e ) {
5863 e.printStackTrace( System.out );
5869 private static boolean testGetLCA2() {
5871 final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
5872 // final Phylogeny p_a = factory.create( "(a)", new NHXParser() )[ 0 ];
5873 final Phylogeny p_a = NHXParser.parse( "(a)" )[ 0 ];
5874 PhylogenyMethods.preOrderReId( p_a );
5875 final PhylogenyNode p_a_1 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p_a.getNode( "a" ),
5876 p_a.getNode( "a" ) );
5877 if ( !p_a_1.getName().equals( "a" ) ) {
5880 final Phylogeny p_b = NHXParser.parse( "((a)b)" )[ 0 ];
5881 PhylogenyMethods.preOrderReId( p_b );
5882 final PhylogenyNode p_b_1 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p_b.getNode( "b" ),
5883 p_b.getNode( "a" ) );
5884 if ( !p_b_1.getName().equals( "b" ) ) {
5887 final PhylogenyNode p_b_2 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p_b.getNode( "a" ),
5888 p_b.getNode( "b" ) );
5889 if ( !p_b_2.getName().equals( "b" ) ) {
5892 final Phylogeny p_c = factory.create( "(((a)b)c)", new NHXParser() )[ 0 ];
5893 PhylogenyMethods.preOrderReId( p_c );
5894 final PhylogenyNode p_c_1 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p_c.getNode( "b" ),
5895 p_c.getNode( "a" ) );
5896 if ( !p_c_1.getName().equals( "b" ) ) {
5899 final PhylogenyNode p_c_2 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p_c.getNode( "a" ),
5900 p_c.getNode( "c" ) );
5901 if ( !p_c_2.getName().equals( "c" ) ) {
5902 System.out.println( p_c_2.getName() );
5906 final PhylogenyNode p_c_3 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p_c.getNode( "a" ),
5907 p_c.getNode( "b" ) );
5908 if ( !p_c_3.getName().equals( "b" ) ) {
5911 final PhylogenyNode p_c_4 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p_c.getNode( "c" ),
5912 p_c.getNode( "a" ) );
5913 if ( !p_c_4.getName().equals( "c" ) ) {
5916 final Phylogeny p1 = factory.create( "((((((A,B)ab,C)abc,D)abcd,E)abcde,F)abcdef,(G,H)gh)abcdefgh",
5917 new NHXParser() )[ 0 ];
5918 PhylogenyMethods.preOrderReId( p1 );
5919 final PhylogenyNode A = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "A" ),
5920 p1.getNode( "A" ) );
5921 if ( !A.getName().equals( "A" ) ) {
5924 final PhylogenyNode gh = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "gh" ),
5925 p1.getNode( "gh" ) );
5926 if ( !gh.getName().equals( "gh" ) ) {
5929 final PhylogenyNode ab = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "A" ),
5930 p1.getNode( "B" ) );
5931 if ( !ab.getName().equals( "ab" ) ) {
5934 final PhylogenyNode ab2 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "B" ),
5935 p1.getNode( "A" ) );
5936 if ( !ab2.getName().equals( "ab" ) ) {
5939 final PhylogenyNode gh2 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "H" ),
5940 p1.getNode( "G" ) );
5941 if ( !gh2.getName().equals( "gh" ) ) {
5944 final PhylogenyNode gh3 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "G" ),
5945 p1.getNode( "H" ) );
5946 if ( !gh3.getName().equals( "gh" ) ) {
5949 final PhylogenyNode abc = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "C" ),
5950 p1.getNode( "A" ) );
5951 if ( !abc.getName().equals( "abc" ) ) {
5954 final PhylogenyNode abc2 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "A" ),
5955 p1.getNode( "C" ) );
5956 if ( !abc2.getName().equals( "abc" ) ) {
5959 final PhylogenyNode abcd = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "A" ),
5960 p1.getNode( "D" ) );
5961 if ( !abcd.getName().equals( "abcd" ) ) {
5964 final PhylogenyNode abcd2 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "D" ),
5965 p1.getNode( "A" ) );
5966 if ( !abcd2.getName().equals( "abcd" ) ) {
5969 final PhylogenyNode abcdef = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "A" ),
5970 p1.getNode( "F" ) );
5971 if ( !abcdef.getName().equals( "abcdef" ) ) {
5974 final PhylogenyNode abcdef2 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "F" ),
5975 p1.getNode( "A" ) );
5976 if ( !abcdef2.getName().equals( "abcdef" ) ) {
5979 final PhylogenyNode abcdef3 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "ab" ),
5980 p1.getNode( "F" ) );
5981 if ( !abcdef3.getName().equals( "abcdef" ) ) {
5984 final PhylogenyNode abcdef4 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "F" ),
5985 p1.getNode( "ab" ) );
5986 if ( !abcdef4.getName().equals( "abcdef" ) ) {
5989 final PhylogenyNode abcde = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "A" ),
5990 p1.getNode( "E" ) );
5991 if ( !abcde.getName().equals( "abcde" ) ) {
5994 final PhylogenyNode abcde2 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "E" ),
5995 p1.getNode( "A" ) );
5996 if ( !abcde2.getName().equals( "abcde" ) ) {
5999 final PhylogenyNode r = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "abcdefgh" ),
6000 p1.getNode( "abcdefgh" ) );
6001 if ( !r.getName().equals( "abcdefgh" ) ) {
6004 final PhylogenyNode r2 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "A" ),
6005 p1.getNode( "H" ) );
6006 if ( !r2.getName().equals( "abcdefgh" ) ) {
6009 final PhylogenyNode r3 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "H" ),
6010 p1.getNode( "A" ) );
6011 if ( !r3.getName().equals( "abcdefgh" ) ) {
6014 final PhylogenyNode abcde3 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "E" ),
6015 p1.getNode( "abcde" ) );
6016 if ( !abcde3.getName().equals( "abcde" ) ) {
6019 final PhylogenyNode abcde4 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "abcde" ),
6020 p1.getNode( "E" ) );
6021 if ( !abcde4.getName().equals( "abcde" ) ) {
6024 final PhylogenyNode ab3 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "ab" ),
6025 p1.getNode( "B" ) );
6026 if ( !ab3.getName().equals( "ab" ) ) {
6029 final PhylogenyNode ab4 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "B" ),
6030 p1.getNode( "ab" ) );
6031 if ( !ab4.getName().equals( "ab" ) ) {
6034 final Phylogeny p2 = factory.create( "(a,b,(((c,d)cd,e)cde,f)cdef)r", new NHXParser() )[ 0 ];
6035 PhylogenyMethods.preOrderReId( p2 );
6036 final PhylogenyNode cd = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p2.getNode( "c" ),
6037 p2.getNode( "d" ) );
6038 if ( !cd.getName().equals( "cd" ) ) {
6041 final PhylogenyNode cd2 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p2.getNode( "d" ),
6042 p2.getNode( "c" ) );
6043 if ( !cd2.getName().equals( "cd" ) ) {
6046 final PhylogenyNode cde = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p2.getNode( "c" ),
6047 p2.getNode( "e" ) );
6048 if ( !cde.getName().equals( "cde" ) ) {
6051 final PhylogenyNode cde2 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p2.getNode( "e" ),
6052 p2.getNode( "c" ) );
6053 if ( !cde2.getName().equals( "cde" ) ) {
6056 final PhylogenyNode cdef = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p2.getNode( "c" ),
6057 p2.getNode( "f" ) );
6058 if ( !cdef.getName().equals( "cdef" ) ) {
6061 final PhylogenyNode cdef2 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p2.getNode( "d" ),
6062 p2.getNode( "f" ) );
6063 if ( !cdef2.getName().equals( "cdef" ) ) {
6066 final PhylogenyNode cdef3 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p2.getNode( "f" ),
6067 p2.getNode( "d" ) );
6068 if ( !cdef3.getName().equals( "cdef" ) ) {
6071 final PhylogenyNode rt = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p2.getNode( "c" ),
6072 p2.getNode( "a" ) );
6073 if ( !rt.getName().equals( "r" ) ) {
6076 final Phylogeny p3 = factory
6077 .create( "((((a,(b,c)bc)abc,(d,e)de)abcde,f)abcdef,(((g,h)gh,(i,j)ij)ghij,k)ghijk,l)",
6078 new NHXParser() )[ 0 ];
6079 PhylogenyMethods.preOrderReId( p3 );
6080 final PhylogenyNode bc_3 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p3.getNode( "b" ),
6081 p3.getNode( "c" ) );
6082 if ( !bc_3.getName().equals( "bc" ) ) {
6085 final PhylogenyNode ac_3 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p3.getNode( "a" ),
6086 p3.getNode( "c" ) );
6087 if ( !ac_3.getName().equals( "abc" ) ) {
6090 final PhylogenyNode ad_3 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p3.getNode( "a" ),
6091 p3.getNode( "d" ) );
6092 if ( !ad_3.getName().equals( "abcde" ) ) {
6095 final PhylogenyNode af_3 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p3.getNode( "a" ),
6096 p3.getNode( "f" ) );
6097 if ( !af_3.getName().equals( "abcdef" ) ) {
6100 final PhylogenyNode ag_3 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p3.getNode( "a" ),
6101 p3.getNode( "g" ) );
6102 if ( !ag_3.getName().equals( "" ) ) {
6105 if ( !ag_3.isRoot() ) {
6108 final PhylogenyNode al_3 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p3.getNode( "a" ),
6109 p3.getNode( "l" ) );
6110 if ( !al_3.getName().equals( "" ) ) {
6113 if ( !al_3.isRoot() ) {
6116 final PhylogenyNode kl_3 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p3.getNode( "k" ),
6117 p3.getNode( "l" ) );
6118 if ( !kl_3.getName().equals( "" ) ) {
6121 if ( !kl_3.isRoot() ) {
6124 final PhylogenyNode fl_3 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p3.getNode( "f" ),
6125 p3.getNode( "l" ) );
6126 if ( !fl_3.getName().equals( "" ) ) {
6129 if ( !fl_3.isRoot() ) {
6132 final PhylogenyNode gk_3 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p3.getNode( "g" ),
6133 p3.getNode( "k" ) );
6134 if ( !gk_3.getName().equals( "ghijk" ) ) {
6137 final Phylogeny p4 = factory.create( "(a,b,c)r", new NHXParser() )[ 0 ];
6138 PhylogenyMethods.preOrderReId( p4 );
6139 final PhylogenyNode r_4 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p4.getNode( "b" ),
6140 p4.getNode( "c" ) );
6141 if ( !r_4.getName().equals( "r" ) ) {
6144 final Phylogeny p5 = factory.create( "((a,b),c,d)root", new NHXParser() )[ 0 ];
6145 PhylogenyMethods.preOrderReId( p5 );
6146 final PhylogenyNode r_5 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p5.getNode( "a" ),
6147 p5.getNode( "c" ) );
6148 if ( !r_5.getName().equals( "root" ) ) {
6151 final Phylogeny p6 = factory.create( "((a,b),c,d)rot", new NHXParser() )[ 0 ];
6152 PhylogenyMethods.preOrderReId( p6 );
6153 final PhylogenyNode r_6 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p6.getNode( "c" ),
6154 p6.getNode( "a" ) );
6155 if ( !r_6.getName().equals( "rot" ) ) {
6158 final Phylogeny p7 = factory.create( "(((a,b)x,c)x,d,e)rott", new NHXParser() )[ 0 ];
6159 PhylogenyMethods.preOrderReId( p7 );
6160 final PhylogenyNode r_7 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p7.getNode( "a" ),
6161 p7.getNode( "e" ) );
6162 if ( !r_7.getName().equals( "rott" ) ) {
6165 final PhylogenyNode r_71 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p7.getNode( "e" ),
6166 p7.getNode( "a" ) );
6167 if ( !r_71.getName().equals( "rott" ) ) {
6170 final PhylogenyNode r_72 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p7.getNode( "e" ),
6171 p7.getNode( "rott" ) );
6172 if ( !r_72.getName().equals( "rott" ) ) {
6175 final PhylogenyNode r_73 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p7.getNode( "rott" ),
6176 p7.getNode( "a" ) );
6177 if ( !r_73.getName().equals( "rott" ) ) {
6180 final PhylogenyNode r_74 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p7.getNode( "rott" ),
6181 p7.getNode( "rott" ) );
6182 if ( !r_74.getName().equals( "rott" ) ) {
6185 final PhylogenyNode r_75 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p7.getNode( "e" ),
6186 p7.getNode( "e" ) );
6187 if ( !r_75.getName().equals( "e" ) ) {
6191 catch ( final Exception e ) {
6192 e.printStackTrace( System.out );
6198 private static boolean testHmmscanOutputParser() {
6199 final String test_dir = Test.PATH_TO_TEST_DATA;
6201 final HmmscanPerDomainTableParser parser1 = new HmmscanPerDomainTableParser( new File( test_dir
6202 + ForesterUtil.getFileSeparator() + "hmmscan30b3_output_1" ), "MONBR", INDIVIDUAL_SCORE_CUTOFF.NONE );
6204 final HmmscanPerDomainTableParser parser2 = new HmmscanPerDomainTableParser( new File( test_dir
6205 + ForesterUtil.getFileSeparator() + "hmmscan30b3_output_2" ), "MONBR", INDIVIDUAL_SCORE_CUTOFF.NONE );
6206 final List<Protein> proteins = parser2.parse();
6207 if ( parser2.getProteinsEncountered() != 4 ) {
6210 if ( proteins.size() != 4 ) {
6213 if ( parser2.getDomainsEncountered() != 69 ) {
6216 if ( parser2.getDomainsIgnoredDueToDuf() != 0 ) {
6219 if ( parser2.getDomainsIgnoredDueToFsEval() != 0 ) {
6222 if ( parser2.getDomainsIgnoredDueToIEval() != 0 ) {
6225 final Protein p1 = proteins.get( 0 );
6226 if ( p1.getNumberOfProteinDomains() != 15 ) {
6229 if ( p1.getLength() != 850 ) {
6232 final Protein p2 = proteins.get( 1 );
6233 if ( p2.getNumberOfProteinDomains() != 51 ) {
6236 if ( p2.getLength() != 1291 ) {
6239 final Protein p3 = proteins.get( 2 );
6240 if ( p3.getNumberOfProteinDomains() != 2 ) {
6243 final Protein p4 = proteins.get( 3 );
6244 if ( p4.getNumberOfProteinDomains() != 1 ) {
6247 if ( !p4.getProteinDomain( 0 ).getDomainId().toString().equals( "DNA_pol_B_new" ) ) {
6250 if ( p4.getProteinDomain( 0 ).getFrom() != 51 ) {
6253 if ( p4.getProteinDomain( 0 ).getTo() != 395 ) {
6256 if ( !Test.isEqual( p4.getProteinDomain( 0 ).getPerDomainEvalue(), 1.2e-39 ) ) {
6259 if ( !Test.isEqual( p4.getProteinDomain( 0 ).getPerDomainScore(), 135.7 ) ) {
6262 if ( !Test.isEqual( p4.getProteinDomain( 0 ).getNumber(), 1 ) ) {
6265 if ( !Test.isEqual( p4.getProteinDomain( 0 ).getTotalCount(), 1 ) ) {
6269 catch ( final Exception e ) {
6270 e.printStackTrace( System.out );
6276 private static boolean testLastExternalNodeMethods() {
6278 final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
6279 final char[] a0 = { '(', '(', 'A', ',', 'B', ')', ',', '(', 'C', ',', 'D', ')', ')', };
6280 final Phylogeny t0 = factory.create( a0, new NHXParser() )[ 0 ];
6281 final PhylogenyNode n1 = t0.getNode( "A" );
6282 if ( n1.isLastExternalNode() ) {
6285 final PhylogenyNode n2 = t0.getNode( "B" );
6286 if ( n2.isLastExternalNode() ) {
6289 final PhylogenyNode n3 = t0.getNode( "C" );
6290 if ( n3.isLastExternalNode() ) {
6293 final PhylogenyNode n4 = t0.getNode( "D" );
6294 if ( !n4.isLastExternalNode() ) {
6298 catch ( final Exception e ) {
6299 e.printStackTrace( System.out );
6305 private static boolean testLevelOrderIterator() {
6307 final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
6308 final Phylogeny t0 = factory.create( "((A,B)ab,(C,D)cd)r", new NHXParser() )[ 0 ];
6309 PhylogenyNodeIterator it0;
6310 for( it0 = t0.iteratorLevelOrder(); it0.hasNext(); ) {
6313 for( it0.reset(); it0.hasNext(); ) {
6316 final PhylogenyNodeIterator it = t0.iteratorLevelOrder();
6317 if ( !it.next().getName().equals( "r" ) ) {
6320 if ( !it.next().getName().equals( "ab" ) ) {
6323 if ( !it.next().getName().equals( "cd" ) ) {
6326 if ( !it.next().getName().equals( "A" ) ) {
6329 if ( !it.next().getName().equals( "B" ) ) {
6332 if ( !it.next().getName().equals( "C" ) ) {
6335 if ( !it.next().getName().equals( "D" ) ) {
6338 if ( it.hasNext() ) {
6341 final Phylogeny t2 = factory.create( "(((1,2,(a,(X,Y,Z)b)3,4,5,6)A,B,C)abc,(D,E,(f1,(f21)f2,f3)F,G)defg)r",
6342 new NHXParser() )[ 0 ];
6343 PhylogenyNodeIterator it2;
6344 for( it2 = t2.iteratorLevelOrder(); it2.hasNext(); ) {
6347 for( it2.reset(); it2.hasNext(); ) {
6350 final PhylogenyNodeIterator it3 = t2.iteratorLevelOrder();
6351 if ( !it3.next().getName().equals( "r" ) ) {
6354 if ( !it3.next().getName().equals( "abc" ) ) {
6357 if ( !it3.next().getName().equals( "defg" ) ) {
6360 if ( !it3.next().getName().equals( "A" ) ) {
6363 if ( !it3.next().getName().equals( "B" ) ) {
6366 if ( !it3.next().getName().equals( "C" ) ) {
6369 if ( !it3.next().getName().equals( "D" ) ) {
6372 if ( !it3.next().getName().equals( "E" ) ) {
6375 if ( !it3.next().getName().equals( "F" ) ) {
6378 if ( !it3.next().getName().equals( "G" ) ) {
6381 if ( !it3.next().getName().equals( "1" ) ) {
6384 if ( !it3.next().getName().equals( "2" ) ) {
6387 if ( !it3.next().getName().equals( "3" ) ) {
6390 if ( !it3.next().getName().equals( "4" ) ) {
6393 if ( !it3.next().getName().equals( "5" ) ) {
6396 if ( !it3.next().getName().equals( "6" ) ) {
6399 if ( !it3.next().getName().equals( "f1" ) ) {
6402 if ( !it3.next().getName().equals( "f2" ) ) {
6405 if ( !it3.next().getName().equals( "f3" ) ) {
6408 if ( !it3.next().getName().equals( "a" ) ) {
6411 if ( !it3.next().getName().equals( "b" ) ) {
6414 if ( !it3.next().getName().equals( "f21" ) ) {
6417 if ( !it3.next().getName().equals( "X" ) ) {
6420 if ( !it3.next().getName().equals( "Y" ) ) {
6423 if ( !it3.next().getName().equals( "Z" ) ) {
6426 if ( it3.hasNext() ) {
6429 final Phylogeny t4 = factory.create( "((((D)C)B)A)r", new NHXParser() )[ 0 ];
6430 PhylogenyNodeIterator it4;
6431 for( it4 = t4.iteratorLevelOrder(); it4.hasNext(); ) {
6434 for( it4.reset(); it4.hasNext(); ) {
6437 final PhylogenyNodeIterator it5 = t4.iteratorLevelOrder();
6438 if ( !it5.next().getName().equals( "r" ) ) {
6441 if ( !it5.next().getName().equals( "A" ) ) {
6444 if ( !it5.next().getName().equals( "B" ) ) {
6447 if ( !it5.next().getName().equals( "C" ) ) {
6450 if ( !it5.next().getName().equals( "D" ) ) {
6453 final Phylogeny t5 = factory.create( "A", new NHXParser() )[ 0 ];
6454 PhylogenyNodeIterator it6;
6455 for( it6 = t5.iteratorLevelOrder(); it6.hasNext(); ) {
6458 for( it6.reset(); it6.hasNext(); ) {
6461 final PhylogenyNodeIterator it7 = t5.iteratorLevelOrder();
6462 if ( !it7.next().getName().equals( "A" ) ) {
6465 if ( it.hasNext() ) {
6469 catch ( final Exception e ) {
6470 e.printStackTrace( System.out );
6476 private static boolean testMafft( final String path ) {
6478 final List<String> opts = new ArrayList<String>();
6479 opts.add( "--maxiterate" );
6481 opts.add( "--localpair" );
6482 opts.add( "--quiet" );
6484 final MsaInferrer mafft = Mafft.createInstance( path );
6485 msa = mafft.infer( new File( PATH_TO_TEST_DATA + "ncbi_sn.fasta" ), opts );
6486 if ( ( msa == null ) || ( msa.getLength() < 20 ) || ( msa.getNumberOfSequences() != 19 ) ) {
6489 if ( !msa.getIdentifier( 0 ).toString().equals( "a" ) ) {
6493 catch ( final Exception e ) {
6494 e.printStackTrace( System.out );
6500 private static boolean testMidpointrooting() {
6502 final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
6503 final Phylogeny t0 = factory.create( "(A:1,B:4,C:2,D:2,E:6,F:1,G:1,H:1)", new NHXParser() )[ 0 ];
6504 PhylogenyMethods.midpointRoot( t0 );
6505 if ( !isEqual( t0.getNode( "E" ).getDistanceToParent(), 5 ) ) {
6508 if ( !isEqual( t0.getNode( "B" ).getDistanceToParent(), 4 ) ) {
6511 if ( !isEqual( PhylogenyMethods.calculateLCA( t0.getNode( "F" ), t0.getNode( "G" ) ).getDistanceToParent(),
6515 final Phylogeny t1 = factory.create( "((A:1,B:2)AB:1[&&NHX:B=55],(C:3,D:4)CD:3[&&NHX:B=10])ABCD:0.5",
6516 new NHXParser() )[ 0 ];
6517 if ( !t1.isRooted() ) {
6520 PhylogenyMethods.midpointRoot( t1 );
6521 if ( !isEqual( t1.getNode( "A" ).getDistanceToParent(), 1 ) ) {
6524 if ( !isEqual( t1.getNode( "B" ).getDistanceToParent(), 2 ) ) {
6527 if ( !isEqual( t1.getNode( "C" ).getDistanceToParent(), 3 ) ) {
6530 if ( !isEqual( t1.getNode( "D" ).getDistanceToParent(), 4 ) ) {
6533 if ( !isEqual( t1.getNode( "CD" ).getDistanceToParent(), 1 ) ) {
6536 if ( !isEqual( t1.getNode( "AB" ).getDistanceToParent(), 3 ) ) {
6539 t1.reRoot( t1.getNode( "A" ) );
6540 PhylogenyMethods.midpointRoot( t1 );
6541 if ( !isEqual( t1.getNode( "A" ).getDistanceToParent(), 1 ) ) {
6544 if ( !isEqual( t1.getNode( "B" ).getDistanceToParent(), 2 ) ) {
6547 if ( !isEqual( t1.getNode( "C" ).getDistanceToParent(), 3 ) ) {
6550 if ( !isEqual( t1.getNode( "D" ).getDistanceToParent(), 4 ) ) {
6553 if ( !isEqual( t1.getNode( "CD" ).getDistanceToParent(), 1 ) ) {
6557 if ( !isEqual( t1.getNode( "AB" ).getDistanceToParent(), 3 ) ) {
6561 catch ( final Exception e ) {
6562 e.printStackTrace( System.out );
6568 private static boolean testMsaQualityMethod() {
6570 final MolecularSequence s0 = BasicSequence.createAaSequence( "a", "ABAXEFGHIJJE-" );
6571 final MolecularSequence s1 = BasicSequence.createAaSequence( "b", "ABBXEFGHIJJBB" );
6572 final MolecularSequence s2 = BasicSequence.createAaSequence( "c", "AXCXEFGHIJJ--" );
6573 final MolecularSequence s3 = BasicSequence.createAaSequence( "d", "AXDDEFGHIJ---" );
6574 final List<MolecularSequence> l = new ArrayList<MolecularSequence>();
6579 final Msa msa = BasicMsa.createInstance( l );
6580 if ( !isEqual( 1, MsaMethods.calculateIdentityRatio( msa, 0 ) ) ) {
6583 if ( !isEqual( 0.5, MsaMethods.calculateIdentityRatio( msa, 1 ) ) ) {
6586 if ( !isEqual( 0.25, MsaMethods.calculateIdentityRatio( msa, 2 ) ) ) {
6589 if ( !isEqual( 0.75, MsaMethods.calculateIdentityRatio( msa, 3 ) ) ) {
6592 if ( !isEqual( 0.75, MsaMethods.calculateIdentityRatio( msa, 10 ) ) ) {
6595 if ( !isEqual( 0.25, MsaMethods.calculateIdentityRatio( msa, 11 ) ) ) {
6598 if ( !isEqual( 0.25, MsaMethods.calculateIdentityRatio( msa, 12 ) ) ) {
6602 catch ( final Exception e ) {
6603 e.printStackTrace( System.out );
6609 private static boolean testMsaEntropy() {
6611 final MolecularSequence s0 = BasicSequence.createAaSequence( "a", "AAAAAAA" );
6612 final MolecularSequence s1 = BasicSequence.createAaSequence( "b", "AAAIACC" );
6613 final MolecularSequence s2 = BasicSequence.createAaSequence( "c", "AAIIIIF" );
6614 final MolecularSequence s3 = BasicSequence.createAaSequence( "d", "AIIIVVW" );
6615 final List<MolecularSequence> l = new ArrayList<MolecularSequence>();
6620 final Msa msa = BasicMsa.createInstance( l );
6621 //TODO need to DO the tests!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!
6623 // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa, 0 ) );
6624 // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa, 1 ) );
6625 // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa, 2 ) );
6626 // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa, 3 ) );
6627 // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa, 4 ) );
6628 // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa, 5 ) );
6629 // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa, 6 ) );
6630 // System.out.println();
6631 // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 6, msa, 0 ) );
6632 // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 6, msa, 1 ) );
6633 // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 6, msa, 2 ) );
6634 // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 6, msa, 3 ) );
6635 // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 6, msa, 4 ) );
6636 // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 6, msa, 5 ) );
6637 // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 6, msa, 6 ) );
6638 final List<MolecularSequence> l2 = new ArrayList<MolecularSequence>();
6639 l2.add( BasicSequence.createAaSequence( "1", "AAAAAAA" ) );
6640 l2.add( BasicSequence.createAaSequence( "2", "AAAIACC" ) );
6641 l2.add( BasicSequence.createAaSequence( "3", "AAIIIIF" ) );
6642 l2.add( BasicSequence.createAaSequence( "4", "AIIIVVW" ) );
6643 l2.add( BasicSequence.createAaSequence( "5", "AAAAAAA" ) );
6644 l2.add( BasicSequence.createAaSequence( "6", "AAAIACC" ) );
6645 l2.add( BasicSequence.createAaSequence( "7", "AAIIIIF" ) );
6646 l2.add( BasicSequence.createAaSequence( "8", "AIIIVVW" ) );
6647 l2.add( BasicSequence.createAaSequence( "9", "AAAAAAA" ) );
6648 l2.add( BasicSequence.createAaSequence( "10", "AAAIACC" ) );
6649 l2.add( BasicSequence.createAaSequence( "11", "AAIIIIF" ) );
6650 l2.add( BasicSequence.createAaSequence( "12", "AIIIVVW" ) );
6651 l2.add( BasicSequence.createAaSequence( "13", "AAIIIIF" ) );
6652 l2.add( BasicSequence.createAaSequence( "14", "AIIIVVW" ) );
6653 l2.add( BasicSequence.createAaSequence( "15", "AAAAAAA" ) );
6654 l2.add( BasicSequence.createAaSequence( "16", "AAAIACC" ) );
6655 l2.add( BasicSequence.createAaSequence( "17", "AAIIIIF" ) );
6656 l2.add( BasicSequence.createAaSequence( "18", "AIIIVVW" ) );
6657 l2.add( BasicSequence.createAaSequence( "19", "AAAAAAA" ) );
6658 l2.add( BasicSequence.createAaSequence( "20", "AAAIACC" ) );
6659 l2.add( BasicSequence.createAaSequence( "21", "AAIIIIF" ) );
6660 l2.add( BasicSequence.createAaSequence( "22", "AIIIVVW" ) );
6661 final Msa msa2 = BasicMsa.createInstance( l2 );
6662 // System.out.println();
6663 // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa2, 0 ) );
6664 // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa2, 1 ) );
6665 // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa2, 2 ) );
6667 catch ( final Exception e ) {
6668 e.printStackTrace( System.out );
6674 private static boolean testDeleteableMsa() {
6676 final MolecularSequence s0 = BasicSequence.createAaSequence( "a", "AAAA" );
6677 final MolecularSequence s1 = BasicSequence.createAaSequence( "b", "BAAA" );
6678 final MolecularSequence s2 = BasicSequence.createAaSequence( "c", "CAAA" );
6679 final MolecularSequence s3 = BasicSequence.createAaSequence( "d", "DAAA" );
6680 final MolecularSequence s4 = BasicSequence.createAaSequence( "e", "EAAA" );
6681 final MolecularSequence s5 = BasicSequence.createAaSequence( "f", "FAAA" );
6682 final List<MolecularSequence> l0 = new ArrayList<MolecularSequence>();
6689 final DeleteableMsa dmsa0 = DeleteableMsa.createInstance( l0 );
6690 dmsa0.deleteRow( "b", false );
6691 if ( !dmsa0.getIdentifier( 1 ).equals( "c" ) ) {
6694 dmsa0.deleteRow( "e", false );
6695 dmsa0.deleteRow( "a", false );
6696 dmsa0.deleteRow( "f", false );
6697 if ( dmsa0.getLength() != 4 ) {
6700 if ( dmsa0.getNumberOfSequences() != 2 ) {
6703 if ( !dmsa0.getIdentifier( 0 ).equals( "c" ) ) {
6706 if ( !dmsa0.getIdentifier( 1 ).equals( "d" ) ) {
6709 if ( dmsa0.getResidueAt( 0, 0 ) != 'C' ) {
6712 if ( !dmsa0.getSequenceAsString( 0 ).toString().equals( "CAAA" ) ) {
6715 if ( dmsa0.getColumnAt( 0 ).size() != 2 ) {
6718 dmsa0.deleteRow( "c", false );
6719 dmsa0.deleteRow( "d", false );
6720 if ( dmsa0.getNumberOfSequences() != 0 ) {
6724 final MolecularSequence s_0 = BasicSequence.createAaSequence( "a", "--A---B-C--X----" );
6725 final MolecularSequence s_1 = BasicSequence.createAaSequence( "b", "--B-----C-------" );
6726 final MolecularSequence s_2 = BasicSequence.createAaSequence( "c", "--C--AB-C------Z" );
6727 final MolecularSequence s_3 = BasicSequence.createAaSequence( "d", "--D--AA-C-------" );
6728 final MolecularSequence s_4 = BasicSequence.createAaSequence( "e", "--E--AA-C-------" );
6729 final MolecularSequence s_5 = BasicSequence.createAaSequence( "f", "--F--AB-CD--Y---" );
6730 final List<MolecularSequence> l1 = new ArrayList<MolecularSequence>();
6737 final DeleteableMsa dmsa1 = DeleteableMsa.createInstance( l1 );
6738 dmsa1.deleteGapOnlyColumns();
6739 dmsa1.deleteRow( "a", false );
6740 dmsa1.deleteRow( "f", false );
6741 dmsa1.deleteRow( "d", false );
6742 dmsa1.deleteGapOnlyColumns();
6743 if ( !dmsa1.getSequenceAsString( 0 ).toString().equals( "B--C-" ) ) {
6746 if ( !dmsa1.getSequenceAsString( 1 ).toString().equals( "CABCZ" ) ) {
6749 if ( !dmsa1.getSequenceAsString( 2 ).toString().equals( "EAAC-" ) ) {
6752 dmsa1.deleteRow( "c", false );
6753 dmsa1.deleteGapOnlyColumns();
6754 final Writer w0 = new StringWriter();
6755 dmsa1.write( w0, MSA_FORMAT.FASTA );
6756 final Writer w1 = new StringWriter();
6757 dmsa1.write( w1, MSA_FORMAT.PHYLIP );
6758 if ( !dmsa1.getSequenceAsString( 0 ).toString().equals( "B--C" ) ) {
6761 if ( !dmsa1.getSequenceAsString( 1 ).toString().equals( "EAAC" ) ) {
6764 final MolecularSequence s__0 = BasicSequence.createAaSequence( "a", "A------" );
6765 final MolecularSequence s__1 = BasicSequence.createAaSequence( "b", "BB-----" );
6766 final MolecularSequence s__2 = BasicSequence.createAaSequence( "c", "CCC----" );
6767 final MolecularSequence s__3 = BasicSequence.createAaSequence( "d", "DDDD---" );
6768 final MolecularSequence s__4 = BasicSequence.createAaSequence( "e", "EEEEE--" );
6769 final MolecularSequence s__5 = BasicSequence.createAaSequence( "f", "FFFFFF-" );
6770 final List<MolecularSequence> l2 = new ArrayList<MolecularSequence>();
6777 final DeleteableMsa dmsa2 = DeleteableMsa.createInstance( l2 );
6778 dmsa2.deleteGapColumns( 0.5 );
6779 if ( !dmsa2.getSequenceAsString( 0 ).toString().equals( "A---" ) ) {
6782 if ( !dmsa2.getSequenceAsString( 1 ).toString().equals( "BB--" ) ) {
6785 if ( !dmsa2.getSequenceAsString( 2 ).toString().equals( "CCC-" ) ) {
6788 dmsa2.deleteGapColumns( 0.2 );
6789 if ( !dmsa2.getSequenceAsString( 0 ).toString().equals( "A-" ) ) {
6792 if ( !dmsa2.getSequenceAsString( 1 ).toString().equals( "BB" ) ) {
6795 if ( !dmsa2.getSequenceAsString( 2 ).toString().equals( "CC" ) ) {
6798 dmsa2.deleteGapColumns( 0 );
6799 dmsa2.deleteRow( "a", false );
6800 dmsa2.deleteRow( "b", false );
6801 dmsa2.deleteRow( "f", false );
6802 dmsa2.deleteRow( "e", false );
6803 dmsa2.setIdentifier( 0, "new_c" );
6804 dmsa2.setIdentifier( 1, "new_d" );
6805 dmsa2.setResidueAt( 0, 0, 'x' );
6806 final MolecularSequence s = dmsa2.deleteRow( "new_d", true );
6807 if ( !s.getMolecularSequenceAsString().equals( "D" ) ) {
6810 final Writer w = new StringWriter();
6811 dmsa2.write( w, MSA_FORMAT.PHYLIP );
6812 final String phylip = w.toString();
6813 if ( !phylip.equals( "1 1" + ForesterUtil.LINE_SEPARATOR + "new_c x" + ForesterUtil.LINE_SEPARATOR ) ) {
6814 System.out.println( phylip );
6817 final Writer w2 = new StringWriter();
6818 dmsa2.write( w2, MSA_FORMAT.FASTA );
6819 final String fasta = w2.toString();
6820 if ( !fasta.equals( ">new_c" + ForesterUtil.LINE_SEPARATOR + "x" + ForesterUtil.LINE_SEPARATOR ) ) {
6821 System.out.println( fasta );
6825 catch ( final Exception e ) {
6826 e.printStackTrace( System.out );
6832 private static boolean testNextNodeWithCollapsing() {
6834 final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
6836 List<PhylogenyNode> ext = new ArrayList<PhylogenyNode>();
6837 final StringBuffer sb0 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h))fgh)cdefgh)abcdefgh" );
6838 final Phylogeny t0 = factory.create( sb0.toString(), new NHXParser() )[ 0 ];
6839 t0.getNode( "cd" ).setCollapse( true );
6840 t0.getNode( "cde" ).setCollapse( true );
6841 n = t0.getFirstExternalNode();
6842 while ( n != null ) {
6844 n = n.getNextExternalNodeWhileTakingIntoAccountCollapsedNodes();
6846 if ( !ext.get( 0 ).getName().equals( "a" ) ) {
6849 if ( !ext.get( 1 ).getName().equals( "b" ) ) {
6852 if ( !ext.get( 2 ).getName().equals( "cde" ) ) {
6855 if ( !ext.get( 3 ).getName().equals( "f" ) ) {
6858 if ( !ext.get( 4 ).getName().equals( "g" ) ) {
6861 if ( !ext.get( 5 ).getName().equals( "h" ) ) {
6865 final StringBuffer sb1 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h))fgh)cdefgh)abcdefgh" );
6866 final Phylogeny t1 = factory.create( sb1.toString(), new NHXParser() )[ 0 ];
6867 t1.getNode( "ab" ).setCollapse( true );
6868 t1.getNode( "cd" ).setCollapse( true );
6869 t1.getNode( "cde" ).setCollapse( true );
6870 n = t1.getNode( "ab" );
6871 ext = new ArrayList<PhylogenyNode>();
6872 while ( n != null ) {
6874 n = n.getNextExternalNodeWhileTakingIntoAccountCollapsedNodes();
6876 if ( !ext.get( 0 ).getName().equals( "ab" ) ) {
6879 if ( !ext.get( 1 ).getName().equals( "cde" ) ) {
6882 if ( !ext.get( 2 ).getName().equals( "f" ) ) {
6885 if ( !ext.get( 3 ).getName().equals( "g" ) ) {
6888 if ( !ext.get( 4 ).getName().equals( "h" ) ) {
6892 final StringBuffer sb2 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h)gh)fgh)cdefgh)abcdefgh" );
6893 final Phylogeny t2 = factory.create( sb2.toString(), new NHXParser() )[ 0 ];
6894 t2.getNode( "ab" ).setCollapse( true );
6895 t2.getNode( "cd" ).setCollapse( true );
6896 t2.getNode( "cde" ).setCollapse( true );
6897 t2.getNode( "c" ).setCollapse( true );
6898 t2.getNode( "d" ).setCollapse( true );
6899 t2.getNode( "e" ).setCollapse( true );
6900 t2.getNode( "gh" ).setCollapse( true );
6901 n = t2.getNode( "ab" );
6902 ext = new ArrayList<PhylogenyNode>();
6903 while ( n != null ) {
6905 n = n.getNextExternalNodeWhileTakingIntoAccountCollapsedNodes();
6907 if ( !ext.get( 0 ).getName().equals( "ab" ) ) {
6910 if ( !ext.get( 1 ).getName().equals( "cde" ) ) {
6913 if ( !ext.get( 2 ).getName().equals( "f" ) ) {
6916 if ( !ext.get( 3 ).getName().equals( "gh" ) ) {
6920 final StringBuffer sb3 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h)gh)fgh)cdefgh)abcdefgh" );
6921 final Phylogeny t3 = factory.create( sb3.toString(), new NHXParser() )[ 0 ];
6922 t3.getNode( "ab" ).setCollapse( true );
6923 t3.getNode( "cd" ).setCollapse( true );
6924 t3.getNode( "cde" ).setCollapse( true );
6925 t3.getNode( "c" ).setCollapse( true );
6926 t3.getNode( "d" ).setCollapse( true );
6927 t3.getNode( "e" ).setCollapse( true );
6928 t3.getNode( "gh" ).setCollapse( true );
6929 t3.getNode( "fgh" ).setCollapse( true );
6930 n = t3.getNode( "ab" );
6931 ext = new ArrayList<PhylogenyNode>();
6932 while ( n != null ) {
6934 n = n.getNextExternalNodeWhileTakingIntoAccountCollapsedNodes();
6936 if ( !ext.get( 0 ).getName().equals( "ab" ) ) {
6939 if ( !ext.get( 1 ).getName().equals( "cde" ) ) {
6942 if ( !ext.get( 2 ).getName().equals( "fgh" ) ) {
6946 final StringBuffer sb4 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h)gh)fgh)cdefgh)abcdefgh" );
6947 final Phylogeny t4 = factory.create( sb4.toString(), new NHXParser() )[ 0 ];
6948 t4.getNode( "ab" ).setCollapse( true );
6949 t4.getNode( "cd" ).setCollapse( true );
6950 t4.getNode( "cde" ).setCollapse( true );
6951 t4.getNode( "c" ).setCollapse( true );
6952 t4.getNode( "d" ).setCollapse( true );
6953 t4.getNode( "e" ).setCollapse( true );
6954 t4.getNode( "gh" ).setCollapse( true );
6955 t4.getNode( "fgh" ).setCollapse( true );
6956 t4.getNode( "abcdefgh" ).setCollapse( true );
6957 n = t4.getNode( "abcdefgh" );
6958 if ( n.getNextExternalNodeWhileTakingIntoAccountCollapsedNodes() != null ) {
6961 final StringBuffer sb5 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h))fgh)cdefgh)abcdefgh" );
6962 final Phylogeny t5 = factory.create( sb5.toString(), new NHXParser() )[ 0 ];
6964 n = t5.getFirstExternalNode();
6965 while ( n != null ) {
6967 n = n.getNextExternalNodeWhileTakingIntoAccountCollapsedNodes();
6969 if ( ext.size() != 8 ) {
6972 if ( !ext.get( 0 ).getName().equals( "a" ) ) {
6975 if ( !ext.get( 1 ).getName().equals( "b" ) ) {
6978 if ( !ext.get( 2 ).getName().equals( "c" ) ) {
6981 if ( !ext.get( 3 ).getName().equals( "d" ) ) {
6984 if ( !ext.get( 4 ).getName().equals( "e" ) ) {
6987 if ( !ext.get( 5 ).getName().equals( "f" ) ) {
6990 if ( !ext.get( 6 ).getName().equals( "g" ) ) {
6993 if ( !ext.get( 7 ).getName().equals( "h" ) ) {
6996 final StringBuffer sb6 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h))fgh)cdefgh)abcdefgh" );
6997 final Phylogeny t6 = factory.create( sb6.toString(), new NHXParser() )[ 0 ];
6999 t6.getNode( "ab" ).setCollapse( true );
7000 n = t6.getNode( "ab" );
7001 while ( n != null ) {
7003 n = n.getNextExternalNodeWhileTakingIntoAccountCollapsedNodes();
7005 if ( ext.size() != 7 ) {
7008 if ( !ext.get( 0 ).getName().equals( "ab" ) ) {
7011 if ( !ext.get( 1 ).getName().equals( "c" ) ) {
7014 if ( !ext.get( 2 ).getName().equals( "d" ) ) {
7017 if ( !ext.get( 3 ).getName().equals( "e" ) ) {
7020 if ( !ext.get( 4 ).getName().equals( "f" ) ) {
7023 if ( !ext.get( 5 ).getName().equals( "g" ) ) {
7026 if ( !ext.get( 6 ).getName().equals( "h" ) ) {
7029 final StringBuffer sb7 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h))fgh)cdefgh)abcdefgh" );
7030 final Phylogeny t7 = factory.create( sb7.toString(), new NHXParser() )[ 0 ];
7032 t7.getNode( "cd" ).setCollapse( true );
7033 n = t7.getNode( "a" );
7034 while ( n != null ) {
7036 n = n.getNextExternalNodeWhileTakingIntoAccountCollapsedNodes();
7038 if ( ext.size() != 7 ) {
7041 if ( !ext.get( 0 ).getName().equals( "a" ) ) {
7044 if ( !ext.get( 1 ).getName().equals( "b" ) ) {
7047 if ( !ext.get( 2 ).getName().equals( "cd" ) ) {
7050 if ( !ext.get( 3 ).getName().equals( "e" ) ) {
7053 if ( !ext.get( 4 ).getName().equals( "f" ) ) {
7056 if ( !ext.get( 5 ).getName().equals( "g" ) ) {
7059 if ( !ext.get( 6 ).getName().equals( "h" ) ) {
7062 final StringBuffer sb8 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h))fgh)cdefgh)abcdefgh" );
7063 final Phylogeny t8 = factory.create( sb8.toString(), new NHXParser() )[ 0 ];
7065 t8.getNode( "cd" ).setCollapse( true );
7066 t8.getNode( "c" ).setCollapse( true );
7067 t8.getNode( "d" ).setCollapse( true );
7068 n = t8.getNode( "a" );
7069 while ( n != null ) {
7071 n = n.getNextExternalNodeWhileTakingIntoAccountCollapsedNodes();
7073 if ( ext.size() != 7 ) {
7076 if ( !ext.get( 0 ).getName().equals( "a" ) ) {
7079 if ( !ext.get( 1 ).getName().equals( "b" ) ) {
7082 if ( !ext.get( 2 ).getName().equals( "cd" ) ) {
7083 System.out.println( "2 fail" );
7086 if ( !ext.get( 3 ).getName().equals( "e" ) ) {
7089 if ( !ext.get( 4 ).getName().equals( "f" ) ) {
7092 if ( !ext.get( 5 ).getName().equals( "g" ) ) {
7095 if ( !ext.get( 6 ).getName().equals( "h" ) ) {
7098 final StringBuffer sb9 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h)gh)fgh)cdefgh)abcdefgh" );
7099 final Phylogeny t9 = factory.create( sb9.toString(), new NHXParser() )[ 0 ];
7101 t9.getNode( "gh" ).setCollapse( true );
7102 n = t9.getNode( "a" );
7103 while ( n != null ) {
7105 n = n.getNextExternalNodeWhileTakingIntoAccountCollapsedNodes();
7107 if ( ext.size() != 7 ) {
7110 if ( !ext.get( 0 ).getName().equals( "a" ) ) {
7113 if ( !ext.get( 1 ).getName().equals( "b" ) ) {
7116 if ( !ext.get( 2 ).getName().equals( "c" ) ) {
7119 if ( !ext.get( 3 ).getName().equals( "d" ) ) {
7122 if ( !ext.get( 4 ).getName().equals( "e" ) ) {
7125 if ( !ext.get( 5 ).getName().equals( "f" ) ) {
7128 if ( !ext.get( 6 ).getName().equals( "gh" ) ) {
7131 final StringBuffer sb10 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h)gh)fgh)cdefgh)abcdefgh" );
7132 final Phylogeny t10 = factory.create( sb10.toString(), new NHXParser() )[ 0 ];
7134 t10.getNode( "gh" ).setCollapse( true );
7135 t10.getNode( "g" ).setCollapse( true );
7136 t10.getNode( "h" ).setCollapse( true );
7137 n = t10.getNode( "a" );
7138 while ( n != null ) {
7140 n = n.getNextExternalNodeWhileTakingIntoAccountCollapsedNodes();
7142 if ( ext.size() != 7 ) {
7145 if ( !ext.get( 0 ).getName().equals( "a" ) ) {
7148 if ( !ext.get( 1 ).getName().equals( "b" ) ) {
7151 if ( !ext.get( 2 ).getName().equals( "c" ) ) {
7154 if ( !ext.get( 3 ).getName().equals( "d" ) ) {
7157 if ( !ext.get( 4 ).getName().equals( "e" ) ) {
7160 if ( !ext.get( 5 ).getName().equals( "f" ) ) {
7163 if ( !ext.get( 6 ).getName().equals( "gh" ) ) {
7166 final StringBuffer sb11 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h)gh)fgh)cdefgh)abcdefgh" );
7167 final Phylogeny t11 = factory.create( sb11.toString(), new NHXParser() )[ 0 ];
7169 t11.getNode( "gh" ).setCollapse( true );
7170 t11.getNode( "fgh" ).setCollapse( true );
7171 n = t11.getNode( "a" );
7172 while ( n != null ) {
7174 n = n.getNextExternalNodeWhileTakingIntoAccountCollapsedNodes();
7176 if ( ext.size() != 6 ) {
7179 if ( !ext.get( 0 ).getName().equals( "a" ) ) {
7182 if ( !ext.get( 1 ).getName().equals( "b" ) ) {
7185 if ( !ext.get( 2 ).getName().equals( "c" ) ) {
7188 if ( !ext.get( 3 ).getName().equals( "d" ) ) {
7191 if ( !ext.get( 4 ).getName().equals( "e" ) ) {
7194 if ( !ext.get( 5 ).getName().equals( "fgh" ) ) {
7197 final StringBuffer sb12 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h)gh)fgh)cdefgh)abcdefgh" );
7198 final Phylogeny t12 = factory.create( sb12.toString(), new NHXParser() )[ 0 ];
7200 t12.getNode( "gh" ).setCollapse( true );
7201 t12.getNode( "fgh" ).setCollapse( true );
7202 t12.getNode( "g" ).setCollapse( true );
7203 t12.getNode( "h" ).setCollapse( true );
7204 t12.getNode( "f" ).setCollapse( true );
7205 n = t12.getNode( "a" );
7206 while ( n != null ) {
7208 n = n.getNextExternalNodeWhileTakingIntoAccountCollapsedNodes();
7210 if ( ext.size() != 6 ) {
7213 if ( !ext.get( 0 ).getName().equals( "a" ) ) {
7216 if ( !ext.get( 1 ).getName().equals( "b" ) ) {
7219 if ( !ext.get( 2 ).getName().equals( "c" ) ) {
7222 if ( !ext.get( 3 ).getName().equals( "d" ) ) {
7225 if ( !ext.get( 4 ).getName().equals( "e" ) ) {
7228 if ( !ext.get( 5 ).getName().equals( "fgh" ) ) {
7231 final StringBuffer sb13 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h)gh)fgh)cdefgh)abcdefgh" );
7232 final Phylogeny t13 = factory.create( sb13.toString(), new NHXParser() )[ 0 ];
7234 t13.getNode( "ab" ).setCollapse( true );
7235 t13.getNode( "b" ).setCollapse( true );
7236 t13.getNode( "fgh" ).setCollapse( true );
7237 t13.getNode( "gh" ).setCollapse( true );
7238 n = t13.getNode( "ab" );
7239 while ( n != null ) {
7241 n = n.getNextExternalNodeWhileTakingIntoAccountCollapsedNodes();
7243 if ( ext.size() != 5 ) {
7246 if ( !ext.get( 0 ).getName().equals( "ab" ) ) {
7249 if ( !ext.get( 1 ).getName().equals( "c" ) ) {
7252 if ( !ext.get( 2 ).getName().equals( "d" ) ) {
7255 if ( !ext.get( 3 ).getName().equals( "e" ) ) {
7258 if ( !ext.get( 4 ).getName().equals( "fgh" ) ) {
7261 final StringBuffer sb14 = new StringBuffer( "((a,b,0)ab,(((c,d)cd,e)cde,(f,(g,h,1,2)gh,0)fgh)cdefgh)abcdefgh" );
7262 final Phylogeny t14 = factory.create( sb14.toString(), new NHXParser() )[ 0 ];
7264 t14.getNode( "ab" ).setCollapse( true );
7265 t14.getNode( "a" ).setCollapse( true );
7266 t14.getNode( "fgh" ).setCollapse( true );
7267 t14.getNode( "gh" ).setCollapse( true );
7268 n = t14.getNode( "ab" );
7269 while ( n != null ) {
7271 n = n.getNextExternalNodeWhileTakingIntoAccountCollapsedNodes();
7273 if ( ext.size() != 5 ) {
7276 if ( !ext.get( 0 ).getName().equals( "ab" ) ) {
7279 if ( !ext.get( 1 ).getName().equals( "c" ) ) {
7282 if ( !ext.get( 2 ).getName().equals( "d" ) ) {
7285 if ( !ext.get( 3 ).getName().equals( "e" ) ) {
7288 if ( !ext.get( 4 ).getName().equals( "fgh" ) ) {
7291 final StringBuffer sb15 = new StringBuffer( "((a,b,0)ab,(((c,d)cd,e)cde,x,(f,(g,h,1,2)gh,0)fgh)cdefgh)abcdefgh" );
7292 final Phylogeny t15 = factory.create( sb15.toString(), new NHXParser() )[ 0 ];
7294 t15.getNode( "ab" ).setCollapse( true );
7295 t15.getNode( "a" ).setCollapse( true );
7296 t15.getNode( "fgh" ).setCollapse( true );
7297 t15.getNode( "gh" ).setCollapse( true );
7298 n = t15.getNode( "ab" );
7299 while ( n != null ) {
7301 n = n.getNextExternalNodeWhileTakingIntoAccountCollapsedNodes();
7303 if ( ext.size() != 6 ) {
7306 if ( !ext.get( 0 ).getName().equals( "ab" ) ) {
7309 if ( !ext.get( 1 ).getName().equals( "c" ) ) {
7312 if ( !ext.get( 2 ).getName().equals( "d" ) ) {
7315 if ( !ext.get( 3 ).getName().equals( "e" ) ) {
7318 if ( !ext.get( 4 ).getName().equals( "x" ) ) {
7321 if ( !ext.get( 5 ).getName().equals( "fgh" ) ) {
7326 final StringBuffer sb16 = new StringBuffer( "((a,b,0)ab,(((c,d)cd,e)cde,x,(f,(g,h,1,2)gh,0)fgh)cdefgh)abcdefgh" );
7327 final Phylogeny t16 = factory.create( sb16.toString(), new NHXParser() )[ 0 ];
7329 t16.getNode( "ab" ).setCollapse( true );
7330 t16.getNode( "a" ).setCollapse( true );
7331 t16.getNode( "fgh" ).setCollapse( true );
7332 t16.getNode( "gh" ).setCollapse( true );
7333 t16.getNode( "cd" ).setCollapse( true );
7334 t16.getNode( "cde" ).setCollapse( true );
7335 t16.getNode( "d" ).setCollapse( true );
7336 t16.getNode( "x" ).setCollapse( true );
7337 n = t16.getNode( "ab" );
7338 while ( n != null ) {
7340 n = n.getNextExternalNodeWhileTakingIntoAccountCollapsedNodes();
7342 if ( ext.size() != 4 ) {
7345 if ( !ext.get( 0 ).getName().equals( "ab" ) ) {
7348 if ( !ext.get( 1 ).getName().equals( "cde" ) ) {
7351 if ( !ext.get( 2 ).getName().equals( "x" ) ) {
7354 if ( !ext.get( 3 ).getName().equals( "fgh" ) ) {
7358 catch ( final Exception e ) {
7359 e.printStackTrace( System.out );
7365 private static boolean testNexusCharactersParsing() {
7367 final NexusCharactersParser parser = new NexusCharactersParser();
7368 parser.setSource( new File( Test.PATH_TO_TEST_DATA + "nexus_test_7.nex" ) );
7370 String[] labels = parser.getCharStateLabels();
7371 if ( labels.length != 7 ) {
7374 if ( !labels[ 0 ].equals( "14-3-3" ) ) {
7377 if ( !labels[ 1 ].equals( "2-Hacid_dh" ) ) {
7380 if ( !labels[ 2 ].equals( "2-Hacid_dh_C" ) ) {
7383 if ( !labels[ 3 ].equals( "2-oxoacid_dh" ) ) {
7386 if ( !labels[ 4 ].equals( "2OG-FeII_Oxy" ) ) {
7389 if ( !labels[ 5 ].equals( "3-HAO" ) ) {
7392 if ( !labels[ 6 ].equals( "3_5_exonuc" ) ) {
7395 parser.setSource( new File( Test.PATH_TO_TEST_DATA + "nexus_test_8.nex" ) );
7397 labels = parser.getCharStateLabels();
7398 if ( labels.length != 7 ) {
7401 if ( !labels[ 0 ].equals( "14-3-3" ) ) {
7404 if ( !labels[ 1 ].equals( "2-Hacid_dh" ) ) {
7407 if ( !labels[ 2 ].equals( "2-Hacid_dh_C" ) ) {
7410 if ( !labels[ 3 ].equals( "2-oxoacid_dh" ) ) {
7413 if ( !labels[ 4 ].equals( "2OG-FeII_Oxy" ) ) {
7416 if ( !labels[ 5 ].equals( "3-HAO" ) ) {
7419 if ( !labels[ 6 ].equals( "3_5_exonuc" ) ) {
7423 catch ( final Exception e ) {
7424 e.printStackTrace( System.out );
7430 private static boolean testNexusMatrixParsing() {
7432 final NexusBinaryStatesMatrixParser parser = new NexusBinaryStatesMatrixParser();
7433 parser.setSource( new File( Test.PATH_TO_TEST_DATA + "nexus_test_9.nex" ) );
7435 final CharacterStateMatrix<BinaryStates> m = parser.getMatrix();
7436 if ( m.getNumberOfCharacters() != 9 ) {
7439 if ( m.getNumberOfIdentifiers() != 5 ) {
7442 if ( m.getState( 0, 0 ) != BinaryStates.PRESENT ) {
7445 if ( m.getState( 0, 1 ) != BinaryStates.ABSENT ) {
7448 if ( m.getState( 1, 0 ) != BinaryStates.PRESENT ) {
7451 if ( m.getState( 2, 0 ) != BinaryStates.ABSENT ) {
7454 if ( m.getState( 4, 8 ) != BinaryStates.PRESENT ) {
7457 if ( !m.getIdentifier( 0 ).equals( "MOUSE" ) ) {
7460 if ( !m.getIdentifier( 4 ).equals( "ARATH" ) ) {
7463 // if ( labels.length != 7 ) {
7466 // if ( !labels[ 0 ].equals( "14-3-3" ) ) {
7469 // if ( !labels[ 1 ].equals( "2-Hacid_dh" ) ) {
7472 // if ( !labels[ 2 ].equals( "2-Hacid_dh_C" ) ) {
7475 // if ( !labels[ 3 ].equals( "2-oxoacid_dh" ) ) {
7478 // if ( !labels[ 4 ].equals( "2OG-FeII_Oxy" ) ) {
7481 // if ( !labels[ 5 ].equals( "3-HAO" ) ) {
7484 // if ( !labels[ 6 ].equals( "3_5_exonuc" ) ) {
7487 // parser.setSource( new File( Test.PATH_TO_TEST_DATA + "nexus_test_8.nex" ) );
7489 // labels = parser.getCharStateLabels();
7490 // if ( labels.length != 7 ) {
7493 // if ( !labels[ 0 ].equals( "14-3-3" ) ) {
7496 // if ( !labels[ 1 ].equals( "2-Hacid_dh" ) ) {
7499 // if ( !labels[ 2 ].equals( "2-Hacid_dh_C" ) ) {
7502 // if ( !labels[ 3 ].equals( "2-oxoacid_dh" ) ) {
7505 // if ( !labels[ 4 ].equals( "2OG-FeII_Oxy" ) ) {
7508 // if ( !labels[ 5 ].equals( "3-HAO" ) ) {
7511 // if ( !labels[ 6 ].equals( "3_5_exonuc" ) ) {
7515 catch ( final Exception e ) {
7516 e.printStackTrace( System.out );
7522 private static boolean testNexusTreeParsing() {
7524 final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
7525 final NexusPhylogeniesParser parser = new NexusPhylogeniesParser();
7526 Phylogeny[] phylogenies = factory.create( Test.PATH_TO_TEST_DATA + "nexus_test_1.nex", parser );
7527 if ( phylogenies.length != 1 ) {
7530 if ( phylogenies[ 0 ].getNumberOfExternalNodes() != 25 ) {
7533 if ( !phylogenies[ 0 ].getName().equals( "" ) ) {
7537 phylogenies = factory.create( Test.PATH_TO_TEST_DATA + "nexus_test_2.nex", parser );
7538 if ( phylogenies.length != 1 ) {
7541 if ( phylogenies[ 0 ].getNumberOfExternalNodes() != 10 ) {
7544 if ( !phylogenies[ 0 ].getName().equals( "name" ) ) {
7548 phylogenies = factory.create( Test.PATH_TO_TEST_DATA + "nexus_test_3.nex", parser );
7549 if ( phylogenies.length != 1 ) {
7552 if ( phylogenies[ 0 ].getNumberOfExternalNodes() != 3 ) {
7555 if ( !phylogenies[ 0 ].getName().equals( "" ) ) {
7558 if ( phylogenies[ 0 ].isRooted() ) {
7562 phylogenies = factory.create( Test.PATH_TO_TEST_DATA + "nexus_test_4.nex", parser );
7563 if ( phylogenies.length != 18 ) {
7566 if ( phylogenies[ 0 ].getNumberOfExternalNodes() != 10 ) {
7569 if ( !phylogenies[ 0 ].getName().equals( "tree 0" ) ) {
7572 if ( !phylogenies[ 1 ].getName().equals( "tree 1" ) ) {
7575 if ( phylogenies[ 1 ].getNumberOfExternalNodes() != 10 ) {
7578 if ( phylogenies[ 2 ].getNumberOfExternalNodes() != 3 ) {
7581 if ( phylogenies[ 3 ].getNumberOfExternalNodes() != 3 ) {
7584 if ( phylogenies[ 4 ].getNumberOfExternalNodes() != 3 ) {
7587 if ( phylogenies[ 5 ].getNumberOfExternalNodes() != 3 ) {
7590 if ( phylogenies[ 6 ].getNumberOfExternalNodes() != 3 ) {
7593 if ( phylogenies[ 7 ].getNumberOfExternalNodes() != 3 ) {
7596 if ( !phylogenies[ 8 ].getName().equals( "tree 8" ) ) {
7599 if ( phylogenies[ 8 ].isRooted() ) {
7602 if ( phylogenies[ 8 ].getNumberOfExternalNodes() != 3 ) {
7605 if ( !phylogenies[ 9 ].getName().equals( "tree 9" ) ) {
7608 if ( !phylogenies[ 9 ].isRooted() ) {
7611 if ( phylogenies[ 9 ].getNumberOfExternalNodes() != 3 ) {
7614 if ( !phylogenies[ 10 ].getName().equals( "tree 10" ) ) {
7617 if ( !phylogenies[ 10 ].isRooted() ) {
7620 if ( phylogenies[ 10 ].getNumberOfExternalNodes() != 3 ) {
7623 if ( !phylogenies[ 11 ].getName().equals( "tree 11" ) ) {
7626 if ( phylogenies[ 11 ].isRooted() ) {
7629 if ( phylogenies[ 11 ].getNumberOfExternalNodes() != 3 ) {
7632 if ( !phylogenies[ 12 ].getName().equals( "tree 12" ) ) {
7635 if ( !phylogenies[ 12 ].isRooted() ) {
7638 if ( phylogenies[ 12 ].getNumberOfExternalNodes() != 3 ) {
7641 if ( !phylogenies[ 13 ].getName().equals( "tree 13" ) ) {
7644 if ( !phylogenies[ 13 ].isRooted() ) {
7647 if ( phylogenies[ 13 ].getNumberOfExternalNodes() != 3 ) {
7650 if ( !phylogenies[ 14 ].getName().equals( "tree 14" ) ) {
7653 if ( !phylogenies[ 14 ].isRooted() ) {
7656 if ( phylogenies[ 14 ].getNumberOfExternalNodes() != 10 ) {
7659 if ( !phylogenies[ 15 ].getName().equals( "tree 15" ) ) {
7662 if ( phylogenies[ 15 ].isRooted() ) {
7665 if ( phylogenies[ 15 ].getNumberOfExternalNodes() != 10 ) {
7668 if ( !phylogenies[ 16 ].getName().equals( "tree 16" ) ) {
7671 if ( !phylogenies[ 16 ].isRooted() ) {
7674 if ( phylogenies[ 16 ].getNumberOfExternalNodes() != 10 ) {
7677 if ( !phylogenies[ 17 ].getName().equals( "tree 17" ) ) {
7680 if ( phylogenies[ 17 ].isRooted() ) {
7683 if ( phylogenies[ 17 ].getNumberOfExternalNodes() != 10 ) {
7686 final NexusPhylogeniesParser p2 = new NexusPhylogeniesParser();
7688 phylogenies = factory.create( Test.PATH_TO_TEST_DATA + "S15613.nex", p2 );
7689 if ( phylogenies.length != 9 ) {
7692 if ( !isEqual( 0.48039661496919533, phylogenies[ 0 ].getNode( "Diadocidia_spinosula" )
7693 .getDistanceToParent() ) ) {
7696 if ( !isEqual( 0.3959796191512233, phylogenies[ 0 ].getNode( "Diadocidia_stanfordensis" )
7697 .getDistanceToParent() ) ) {
7700 if ( !phylogenies[ 0 ].getName().equals( "Family Diadocidiidae MLT (Imported_tree_0)" ) ) {
7703 if ( !phylogenies[ 1 ].getName().equals( "Family Diadocidiidae BAT (con_50_majrule)" ) ) {
7706 if ( !phylogenies[ 2 ].getName().equals( "Family Diadocidiidae BAT (con_50_majrule)" ) ) {
7709 if ( !isEqual( 0.065284, phylogenies[ 7 ].getNode( "Bradysia_amoena" ).getDistanceToParent() ) ) {
7712 if ( !isEqual( 0.065284, phylogenies[ 8 ].getNode( "Bradysia_amoena" ).getDistanceToParent() ) ) {
7716 catch ( final Exception e ) {
7717 e.printStackTrace( System.out );
7723 private static boolean testNexusTreeParsingIterating() {
7725 final NexusPhylogeniesParser p = new NexusPhylogeniesParser();
7726 p.setSource( Test.PATH_TO_TEST_DATA + "nexus_test_1.nex" );
7727 if ( !p.hasNext() ) {
7730 Phylogeny phy = p.next();
7731 if ( phy == null ) {
7734 if ( phy.getNumberOfExternalNodes() != 25 ) {
7737 if ( !phy.getName().equals( "" ) ) {
7740 if ( p.hasNext() ) {
7744 if ( phy != null ) {
7748 if ( !p.hasNext() ) {
7752 if ( phy == null ) {
7755 if ( phy.getNumberOfExternalNodes() != 25 ) {
7758 if ( !phy.getName().equals( "" ) ) {
7761 if ( p.hasNext() ) {
7765 if ( phy != null ) {
7768 p.setSource( Test.PATH_TO_TEST_DATA + "nexus_test_2.nex" );
7769 if ( !p.hasNext() ) {
7773 if ( phy == null ) {
7776 if ( phy.getNumberOfExternalNodes() != 10 ) {
7779 if ( !phy.getName().equals( "name" ) ) {
7782 if ( p.hasNext() ) {
7786 if ( phy != null ) {
7790 if ( !p.hasNext() ) {
7794 if ( phy == null ) {
7797 if ( phy.getNumberOfExternalNodes() != 10 ) {
7800 if ( !phy.getName().equals( "name" ) ) {
7803 if ( p.hasNext() ) {
7807 if ( phy != null ) {
7810 p.setSource( Test.PATH_TO_TEST_DATA + "nexus_test_3.nex" );
7811 if ( !p.hasNext() ) {
7815 if ( phy == null ) {
7818 if ( phy.getNumberOfExternalNodes() != 3 ) {
7821 if ( !phy.getName().equals( "" ) ) {
7824 if ( phy.isRooted() ) {
7827 if ( p.hasNext() ) {
7831 if ( phy != null ) {
7836 if ( !p.hasNext() ) {
7840 if ( phy == null ) {
7843 if ( phy.getNumberOfExternalNodes() != 3 ) {
7846 if ( !phy.getName().equals( "" ) ) {
7849 if ( p.hasNext() ) {
7853 if ( phy != null ) {
7857 p.setSource( Test.PATH_TO_TEST_DATA + "nexus_test_4_1.nex" );
7858 if ( !p.hasNext() ) {
7863 if ( phy == null ) {
7866 if ( phy.getNumberOfExternalNodes() != 10 ) {
7869 if ( !phy.getName().equals( "tree 0" ) ) {
7873 if ( !p.hasNext() ) {
7877 if ( phy == null ) {
7880 if ( phy.getNumberOfExternalNodes() != 10 ) {
7883 if ( !phy.getName().equals( "tree 1" ) ) {
7887 if ( !p.hasNext() ) {
7891 if ( phy == null ) {
7894 if ( phy.getNumberOfExternalNodes() != 3 ) {
7895 System.out.println( phy.toString() );
7898 if ( !phy.getName().equals( "" ) ) {
7901 if ( phy.isRooted() ) {
7905 if ( !p.hasNext() ) {
7909 if ( phy == null ) {
7912 if ( phy.getNumberOfExternalNodes() != 4 ) {
7915 if ( !phy.getName().equals( "" ) ) {
7918 if ( !phy.isRooted() ) {
7922 if ( !p.hasNext() ) {
7926 if ( phy == null ) {
7929 if ( phy.getNumberOfExternalNodes() != 5 ) {
7930 System.out.println( phy.getNumberOfExternalNodes() );
7933 if ( !phy.getName().equals( "" ) ) {
7936 if ( !phy.isRooted() ) {
7940 if ( !p.hasNext() ) {
7944 if ( phy == null ) {
7947 if ( phy.getNumberOfExternalNodes() != 3 ) {
7950 if ( !phy.getName().equals( "" ) ) {
7953 if ( phy.isRooted() ) {
7957 if ( !p.hasNext() ) {
7961 if ( phy == null ) {
7964 if ( phy.getNumberOfExternalNodes() != 2 ) {
7967 if ( !phy.getName().equals( "" ) ) {
7970 if ( !phy.isRooted() ) {
7974 if ( !p.hasNext() ) {
7978 if ( phy.getNumberOfExternalNodes() != 3 ) {
7981 if ( !phy.toNewHampshire().equals( "((a,b),c);" ) ) {
7984 if ( !phy.isRooted() ) {
7988 if ( !p.hasNext() ) {
7992 if ( phy.getNumberOfExternalNodes() != 3 ) {
7995 if ( !phy.toNewHampshire().equals( "((AA,BB),CC);" ) ) {
7998 if ( !phy.getName().equals( "tree 8" ) ) {
8002 if ( !p.hasNext() ) {
8006 if ( phy.getNumberOfExternalNodes() != 3 ) {
8009 if ( !phy.toNewHampshire().equals( "((a,b),cc);" ) ) {
8012 if ( !phy.getName().equals( "tree 9" ) ) {
8016 if ( !p.hasNext() ) {
8020 if ( phy.getNumberOfExternalNodes() != 3 ) {
8023 if ( !phy.toNewHampshire().equals( "((a,b),c);" ) ) {
8026 if ( !phy.getName().equals( "tree 10" ) ) {
8029 if ( !phy.isRooted() ) {
8033 if ( !p.hasNext() ) {
8037 if ( phy.getNumberOfExternalNodes() != 3 ) {
8040 if ( !phy.toNewHampshire().equals( "((1,2),3);" ) ) {
8043 if ( !phy.getName().equals( "tree 11" ) ) {
8046 if ( phy.isRooted() ) {
8050 if ( !p.hasNext() ) {
8054 if ( phy.getNumberOfExternalNodes() != 3 ) {
8057 if ( !phy.toNewHampshire().equals( "((aa,bb),cc);" ) ) {
8060 if ( !phy.getName().equals( "tree 12" ) ) {
8063 if ( !phy.isRooted() ) {
8067 if ( !p.hasNext() ) {
8071 if ( phy.getNumberOfExternalNodes() != 3 ) {
8074 if ( !phy.toNewHampshire().equals( "((a,b),c);" ) ) {
8077 if ( !phy.getName().equals( "tree 13" ) ) {
8080 if ( !phy.isRooted() ) {
8084 if ( !p.hasNext() ) {
8088 if ( phy.getNumberOfExternalNodes() != 10 ) {
8089 System.out.println( phy.getNumberOfExternalNodes() );
8094 .equals( "(1:0.212481,8:0.297838,(9:0.222729,((6:0.201563,7:0.194547):0.282035,(4:1.146091,(3:1.008881,(10:0.384105,(2:0.235682,5:0.353432):0.32368):0.103875):0.41354):0.254687):0.095341):0.079254):0.0;" ) ) {
8095 System.out.println( phy.toNewHampshire() );
8098 if ( !phy.getName().equals( "tree 14" ) ) {
8101 if ( !phy.isRooted() ) {
8105 if ( !p.hasNext() ) {
8109 if ( phy.getNumberOfExternalNodes() != 10 ) {
8110 System.out.println( phy.getNumberOfExternalNodes() );
8115 .equals( "(1:0.212481,8:0.297838,(9:0.222729,((6:0.201563,7:0.194547):0.282035,(4:1.146091,(3:1.008881,(10:0.384105,(2:0.235682,5:0.353432):0.32368):0.103875):0.41354):0.254687):0.095341):0.079254):0.0;" ) ) {
8116 System.out.println( phy.toNewHampshire() );
8119 if ( !phy.getName().equals( "tree 15" ) ) {
8122 if ( phy.isRooted() ) {
8126 if ( !p.hasNext() ) {
8130 if ( phy.getNumberOfExternalNodes() != 10 ) {
8131 System.out.println( phy.getNumberOfExternalNodes() );
8136 .equals( "(1:0.212481,8:0.297838,(9:0.222729,((6:0.201563,7:0.194547):0.282035,(4:1.146091,(3:1.008881,(10:0.384105,(2:0.235682,5:0.353432):0.32368):0.103875):0.41354):0.254687):0.095341):0.079254):0.0;" ) ) {
8137 System.out.println( phy.toNewHampshire() );
8140 if ( !phy.getName().equals( "tree 16" ) ) {
8143 if ( !phy.isRooted() ) {
8147 if ( !p.hasNext() ) {
8151 if ( phy.getNumberOfExternalNodes() != 10 ) {
8152 System.out.println( phy.getNumberOfExternalNodes() );
8157 .equals( "(1:0.212481,8:0.297838,(9:0.222729,((6:0.201563,7:0.194547):0.282035,(4:1.146091,(3:1.008881,(10:0.384105,(2:0.235682,5:0.353432):0.32368):0.103875):0.41354):0.254687):0.095341):0.079254):0.0;" ) ) {
8158 System.out.println( phy.toNewHampshire() );
8161 if ( !phy.getName().equals( "tree 17" ) ) {
8164 if ( phy.isRooted() ) {
8168 if ( p.hasNext() ) {
8172 if ( phy != null ) {
8177 if ( !p.hasNext() ) {
8181 if ( phy == null ) {
8184 if ( phy.getNumberOfExternalNodes() != 10 ) {
8187 if ( !phy.getName().equals( "tree 0" ) ) {
8191 if ( !p.hasNext() ) {
8195 if ( phy == null ) {
8198 if ( phy.getNumberOfExternalNodes() != 10 ) {
8201 if ( !phy.getName().equals( "tree 1" ) ) {
8205 if ( !p.hasNext() ) {
8209 if ( phy == null ) {
8212 if ( phy.getNumberOfExternalNodes() != 3 ) {
8215 if ( !phy.getName().equals( "" ) ) {
8218 if ( phy.isRooted() ) {
8222 if ( !p.hasNext() ) {
8226 if ( phy == null ) {
8229 if ( phy.getNumberOfExternalNodes() != 4 ) {
8232 if ( !phy.getName().equals( "" ) ) {
8235 if ( !phy.isRooted() ) {
8239 if ( !p.hasNext() ) {
8243 if ( phy == null ) {
8246 if ( phy.getNumberOfExternalNodes() != 5 ) {
8247 System.out.println( phy.getNumberOfExternalNodes() );
8250 if ( !phy.getName().equals( "" ) ) {
8253 if ( !phy.isRooted() ) {
8257 if ( !p.hasNext() ) {
8261 if ( phy == null ) {
8264 if ( phy.getNumberOfExternalNodes() != 3 ) {
8267 if ( !phy.getName().equals( "" ) ) {
8270 if ( phy.isRooted() ) {
8274 final NexusPhylogeniesParser p2 = new NexusPhylogeniesParser();
8275 p2.setSource( Test.PATH_TO_TEST_DATA + "S15613.nex" );
8277 if ( !p2.hasNext() ) {
8281 if ( !isEqual( 0.48039661496919533, phy.getNode( "Diadocidia_spinosula" ).getDistanceToParent() ) ) {
8284 if ( !isEqual( 0.3959796191512233, phy.getNode( "Diadocidia_stanfordensis" ).getDistanceToParent() ) ) {
8288 if ( !p2.hasNext() ) {
8293 if ( !p2.hasNext() ) {
8298 if ( !p2.hasNext() ) {
8303 if ( !p2.hasNext() ) {
8308 if ( !p2.hasNext() ) {
8313 if ( !p2.hasNext() ) {
8318 if ( !p2.hasNext() ) {
8323 if ( !p2.hasNext() ) {
8327 if ( !isEqual( 0.065284, phy.getNode( "Bradysia_amoena" ).getDistanceToParent() ) ) {
8330 if ( p2.hasNext() ) {
8334 if ( phy != null ) {
8339 if ( !p2.hasNext() ) {
8343 if ( !isEqual( 0.48039661496919533, phy.getNode( "Diadocidia_spinosula" ).getDistanceToParent() ) ) {
8346 if ( !isEqual( 0.3959796191512233, phy.getNode( "Diadocidia_stanfordensis" ).getDistanceToParent() ) ) {
8350 catch ( final Exception e ) {
8351 e.printStackTrace( System.out );
8357 private static boolean testNexusTreeParsingTranslating() {
8359 final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
8360 final NexusPhylogeniesParser parser = new NexusPhylogeniesParser();
8361 Phylogeny[] phylogenies = factory.create( Test.PATH_TO_TEST_DATA + "nexus_test_5.nex", parser );
8362 if ( phylogenies.length != 1 ) {
8365 if ( phylogenies[ 0 ].getNumberOfExternalNodes() != 3 ) {
8368 if ( !phylogenies[ 0 ].getName().equals( "Tree0" ) ) {
8371 if ( !phylogenies[ 0 ].getFirstExternalNode().getName().equals( "Scarabaeus" ) ) {
8374 if ( !phylogenies[ 0 ].getFirstExternalNode().getNextExternalNode().getName().equals( "Drosophila" ) ) {
8377 if ( !phylogenies[ 0 ].getFirstExternalNode().getNextExternalNode().getNextExternalNode().getName()
8378 .equals( "Aranaeus" ) ) {
8382 phylogenies = factory.create( Test.PATH_TO_TEST_DATA + "nexus_test_6.nex", parser );
8383 if ( phylogenies.length != 3 ) {
8386 if ( phylogenies[ 0 ].getNumberOfExternalNodes() != 3 ) {
8389 if ( !phylogenies[ 0 ].getName().equals( "Tree0" ) ) {
8392 if ( phylogenies[ 0 ].isRooted() ) {
8395 if ( !phylogenies[ 0 ].getFirstExternalNode().getName().equals( "Scarabaeus" ) ) {
8398 if ( !phylogenies[ 0 ].getFirstExternalNode().getNextExternalNode().getName().equals( "Drosophila" ) ) {
8401 if ( !phylogenies[ 0 ].getFirstExternalNode().getNextExternalNode().getNextExternalNode().getName()
8402 .equals( "Aranaeus" ) ) {
8405 if ( phylogenies[ 1 ].getNumberOfExternalNodes() != 3 ) {
8408 if ( !phylogenies[ 1 ].getName().equals( "Tree1" ) ) {
8411 if ( phylogenies[ 1 ].isRooted() ) {
8414 if ( !phylogenies[ 1 ].getFirstExternalNode().getName().equals( "Scarabaeus" ) ) {
8417 if ( !phylogenies[ 1 ].getFirstExternalNode().getNextExternalNode().getName().equals( "Drosophila" ) ) {
8420 if ( !phylogenies[ 1 ].getFirstExternalNode().getNextExternalNode().getNextExternalNode().getName()
8421 .equals( "Aranaeus" ) ) {
8424 if ( phylogenies[ 2 ].getNumberOfExternalNodes() != 3 ) {
8427 if ( !phylogenies[ 2 ].getName().equals( "Tree2" ) ) {
8430 if ( !phylogenies[ 2 ].isRooted() ) {
8433 if ( !phylogenies[ 2 ].getFirstExternalNode().getName().equals( "Scarabaeus" ) ) {
8436 if ( !phylogenies[ 2 ].getFirstExternalNode().getNextExternalNode().getName().equals( "Drosophila" ) ) {
8439 if ( !phylogenies[ 2 ].getFirstExternalNode().getNextExternalNode().getNextExternalNode().getName()
8440 .equals( "Aranaeus" ) ) {
8444 phylogenies = factory.create( Test.PATH_TO_TEST_DATA + "nexus_test_7.nex", parser );
8445 if ( phylogenies.length != 3 ) {
8448 if ( phylogenies[ 0 ].getNumberOfExternalNodes() != 3 ) {
8451 if ( !phylogenies[ 0 ].getName().equals( "Tree0" ) ) {
8454 if ( phylogenies[ 0 ].isRooted() ) {
8457 if ( !phylogenies[ 0 ].getFirstExternalNode().getName().equals( "Scarabaeus" ) ) {
8460 if ( !phylogenies[ 0 ].getFirstExternalNode().getNextExternalNode().getName().equals( "Drosophila" ) ) {
8463 if ( !phylogenies[ 0 ].getFirstExternalNode().getNextExternalNode().getNextExternalNode().getName()
8464 .equals( "Aranaeus" ) ) {
8467 if ( phylogenies[ 1 ].getNumberOfExternalNodes() != 3 ) {
8470 if ( !phylogenies[ 1 ].getName().equals( "Tree1" ) ) {
8473 if ( phylogenies[ 1 ].isRooted() ) {
8476 if ( !phylogenies[ 1 ].getFirstExternalNode().getName().equals( "Scarabaeus" ) ) {
8479 if ( !phylogenies[ 1 ].getFirstExternalNode().getNextExternalNode().getName().equals( "Drosophila" ) ) {
8482 if ( !phylogenies[ 1 ].getFirstExternalNode().getNextExternalNode().getNextExternalNode().getName()
8483 .equals( "Aranaeus" ) ) {
8486 if ( phylogenies[ 2 ].getNumberOfExternalNodes() != 3 ) {
8489 if ( !phylogenies[ 2 ].getName().equals( "Tree2" ) ) {
8492 if ( !phylogenies[ 2 ].isRooted() ) {
8495 if ( !phylogenies[ 2 ].getFirstExternalNode().getName().equals( "Scarabaeus" ) ) {
8498 if ( !phylogenies[ 2 ].getFirstExternalNode().getNextExternalNode().getName().equals( "Drosophila" ) ) {
8501 if ( !phylogenies[ 2 ].getFirstExternalNode().getNextExternalNode().getNextExternalNode().getName()
8502 .equals( "Aranaeus" ) ) {
8505 phylogenies = factory.create( Test.PATH_TO_TEST_DATA + "S14117.nex", parser );
8506 if ( phylogenies.length != 3 ) {
8509 if ( !isEqual( phylogenies[ 2 ].getNode( "Aloysia lycioides 251-76-02169" ).getDistanceToParent(),
8514 catch ( final Exception e ) {
8515 e.printStackTrace( System.out );
8521 private static boolean testNHParsing() {
8523 final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
8524 final Phylogeny p1 = factory.create( "(A,B1)", new NHXParser() )[ 0 ];
8525 if ( !p1.toNewHampshireX().equals( "(A,B1)" ) ) {
8528 final NHXParser nhxp = new NHXParser();
8529 nhxp.setTaxonomyExtraction( NHXParser.TAXONOMY_EXTRACTION.NO );
8530 nhxp.setReplaceUnderscores( true );
8531 final Phylogeny uc0 = factory.create( "(A__A_,_B_B)", nhxp )[ 0 ];
8532 if ( !uc0.getRoot().getChildNode( 0 ).getName().equals( "A A" ) ) {
8535 if ( !uc0.getRoot().getChildNode( 1 ).getName().equals( "B B" ) ) {
8538 final Phylogeny p1b = factory
8539 .create( " \n \t \b \r \f ; ( \n \t \b \r \f; A ; \n \t \b \r \f, \n \t \b \r \f; B ; \n \t \b \r \f 1 \n \t \b \r \f ; \n \t \b \r \f );;;;; \n \t \b \r \f;;; \n \t \b \r \f ",
8540 new NHXParser() )[ 0 ];
8541 if ( !p1b.toNewHampshireX().equals( "(';A;',';B;1;')" ) ) {
8544 if ( !p1b.toNewHampshire().equals( "(';A;',';B;1;');" ) ) {
8547 final Phylogeny p2 = factory.create( new StringBuffer( "(A,B2)" ).toString(), new NHXParser() )[ 0 ];
8548 final Phylogeny p3 = factory.create( new char[] { '(', 'A', ',', 'B', '3', ')' }, new NHXParser() )[ 0 ];
8549 final Phylogeny p4 = factory.create( "(A,B4);", new NHXParser() )[ 0 ];
8550 final Phylogeny p5 = factory.create( new StringBuffer( "(A,B5);" ).toString(), new NHXParser() )[ 0 ];
8551 final Phylogeny[] p7 = factory.create( "(A,B7);(C,D7)", new NHXParser() );
8552 final Phylogeny[] p8 = factory.create( "(A,B8) (C,D8)", new NHXParser() );
8553 final Phylogeny[] p9 = factory.create( "(A,B9)\n(C,D9)", new NHXParser() );
8554 final Phylogeny[] p10 = factory.create( "(A,B10);(C,D10);", new NHXParser() );
8555 final Phylogeny[] p11 = factory.create( "(A,B11);(C,D11) (E,F11)\t(G,H11)", new NHXParser() );
8556 final Phylogeny[] p12 = factory.create( "(A,B12) (C,D12) (E,F12) (G,H12)", new NHXParser() );
8557 final Phylogeny[] p13 = factory.create( " ; (;A; , ; B ; 1 3 ; \n)\t ( \n ;"
8558 + " C ; ,; D;13;);;;;;;(;E;,;F;13 ;) ; "
8559 + "; ; ( \t\n\r\b; G ;, ;H ;1 3; ) ; ; ;",
8561 if ( !p13[ 0 ].toNewHampshireX().equals( "(';A;',';B;13;')" ) ) {
8564 if ( !p13[ 1 ].toNewHampshireX().equals( "(';C;',';D;13;')" ) ) {
8567 if ( !p13[ 2 ].toNewHampshireX().equals( "(';E;',';F;13;')" ) ) {
8570 if ( !p13[ 3 ].toNewHampshireX().equals( "(';G;',';H;13;')" ) ) {
8573 final Phylogeny[] p14 = factory.create( "(A,B14)ab", new NHXParser() );
8574 final Phylogeny[] p15 = factory.create( "(A,B15)ab;", new NHXParser() );
8575 final String p16_S = "((A,B),C)";
8576 final Phylogeny[] p16 = factory.create( p16_S, new NHXParser() );
8577 if ( p16.length != 1 ) {
8580 if ( !p16[ 0 ].toNewHampshireX().equals( p16_S ) ) {
8583 final String p17_S = "(C,(A,B))";
8584 final Phylogeny[] p17 = factory.create( p17_S, new NHXParser() );
8585 if ( p17.length != 1 ) {
8588 if ( !p17[ 0 ].toNewHampshireX().equals( p17_S ) ) {
8591 final String p18_S = "((A,B),(C,D))";
8592 final Phylogeny[] p18 = factory.create( p18_S, new NHXParser() );
8593 if ( p18.length != 1 ) {
8596 if ( !p18[ 0 ].toNewHampshireX().equals( p18_S ) ) {
8599 final String p19_S = "(((A,B),C),D)";
8600 final Phylogeny[] p19 = factory.create( p19_S, new NHXParser() );
8601 if ( p19.length != 1 ) {
8604 if ( !p19[ 0 ].toNewHampshireX().equals( p19_S ) ) {
8607 final String p20_S = "(A,(B,(C,D)))";
8608 final Phylogeny[] p20 = factory.create( p20_S, new NHXParser() );
8609 if ( p20.length != 1 ) {
8612 if ( !p20[ 0 ].toNewHampshireX().equals( p20_S ) ) {
8615 final String p21_S = "(A,(B,(C,(D,E))))";
8616 final Phylogeny[] p21 = factory.create( p21_S, new NHXParser() );
8617 if ( p21.length != 1 ) {
8620 if ( !p21[ 0 ].toNewHampshireX().equals( p21_S ) ) {
8623 final String p22_S = "((((A,B),C),D),E)";
8624 final Phylogeny[] p22 = factory.create( p22_S, new NHXParser() );
8625 if ( p22.length != 1 ) {
8628 if ( !p22[ 0 ].toNewHampshireX().equals( p22_S ) ) {
8631 final String p23_S = "(A,(B,(C,(D,E)de)cde)bcde)abcde";
8632 final Phylogeny[] p23 = factory.create( p23_S, new NHXParser() );
8633 if ( p23.length != 1 ) {
8634 System.out.println( "xl=" + p23.length );
8638 if ( !p23[ 0 ].toNewHampshireX().equals( p23_S ) ) {
8641 final String p24_S = "((((A,B)ab,C)abc,D)abcd,E)abcde";
8642 final Phylogeny[] p24 = factory.create( p24_S, new NHXParser() );
8643 if ( p24.length != 1 ) {
8646 if ( !p24[ 0 ].toNewHampshireX().equals( p24_S ) ) {
8649 final String p241_S1 = "(A,(B,(C,(D,E)de)cde)bcde)abcde";
8650 final String p241_S2 = "((((A,B)ab,C)abc,D)abcd,E)abcde";
8651 final Phylogeny[] p241 = factory.create( p241_S1 + p241_S2, new NHXParser() );
8652 if ( p241.length != 2 ) {
8655 if ( !p241[ 0 ].toNewHampshireX().equals( p241_S1 ) ) {
8658 if ( !p241[ 1 ].toNewHampshireX().equals( p241_S2 ) ) {
8661 final String p25_S = "((((((((((((((A,B)ab,C)abc,D)abcd,E)"
8662 + "abcde,(B,(C,(D,E)de)cde)bcde)abcde,(B,((A,(B,(C,(D,"
8663 + "E)de)cde)bcde)abcde,(D,E)de)cde)bcde)abcde,B)ab,C)"
8664 + "abc,((((A,B)ab,C)abc,D)abcd,E)abcde)abcd,E)abcde,"
8665 + "((((A,((((((((A,B)ab,C)abc,((((A,B)ab,C)abc,D)abcd,"
8666 + "E)abcde)abcd,E)abcde,((((A,B)ab,C)abc,D)abcd,E)abcde)"
8667 + "ab,C)abc,((((A,B)ab,C)abc,D)abcd,E)abcde)abcd,E)abcde"
8668 + ")ab,C)abc,D)abcd,E)abcde)ab,C)abc,((((A,B)ab,C)abc,D)" + "abcd,E)abcde)abcd,E)abcde";
8669 final Phylogeny[] p25 = factory.create( p25_S, new NHXParser() );
8670 if ( !p25[ 0 ].toNewHampshireX().equals( p25_S ) ) {
8673 final String p26_S = "(A,B)ab";
8674 final Phylogeny[] p26 = factory.create( p26_S, new NHXParser() );
8675 if ( !p26[ 0 ].toNewHampshireX().equals( p26_S ) ) {
8678 final String p27_S = "((((A,B)ab,C)abc,D)abcd,E)abcde";
8679 final Phylogeny[] p27s = factory.create( p27_S, new NHXParser() );
8680 if ( p27s.length != 1 ) {
8681 System.out.println( "xxl=" + p27s.length );
8685 if ( !p27s[ 0 ].toNewHampshireX().equals( p27_S ) ) {
8686 System.out.println( p27s[ 0 ].toNewHampshireX() );
8690 final Phylogeny[] p27 = factory.create( new File( Test.PATH_TO_TEST_DATA + "phylogeny27.nhx" ),
8692 if ( p27.length != 1 ) {
8693 System.out.println( "yl=" + p27.length );
8697 if ( !p27[ 0 ].toNewHampshireX().equals( p27_S ) ) {
8698 System.out.println( p27[ 0 ].toNewHampshireX() );
8702 final String p28_S1 = "((((A,B)ab,C)abc,D)abcd,E)abcde";
8703 final String p28_S2 = "(A,(B,(C,(D,E)de)cde)bcde)abcde";
8704 final String p28_S3 = "(A,B)ab";
8705 final String p28_S4 = "((((A,B),C),D),;E;)";
8706 final Phylogeny[] p28 = factory.create( new File( Test.PATH_TO_TEST_DATA + "phylogeny28.nhx" ),
8708 if ( !p28[ 0 ].toNewHampshireX().equals( p28_S1 ) ) {
8711 if ( !p28[ 1 ].toNewHampshireX().equals( p28_S2 ) ) {
8714 if ( !p28[ 2 ].toNewHampshireX().equals( p28_S3 ) ) {
8717 if ( !p28[ 3 ].toNewHampshireX().equals( "((((A,B),C),D),';E;')" ) ) {
8720 if ( p28.length != 4 ) {
8723 final String p29_S = "((((A:0.01,B:0.684)ab:0.345,C:0.3451)abc:0.3451,D:1.5)abcd:0.134,E:0.32)abcde:0.1345";
8724 final Phylogeny[] p29 = factory.create( p29_S, new NHXParser() );
8725 if ( !p29[ 0 ].toNewHampshireX().equals( p29_S ) ) {
8728 final String p30_S = "((((A:0.01,B:0.02):0.93,C:0.04):0.05,D:1.4):0.06,E):0.72";
8729 final Phylogeny[] p30 = factory.create( p30_S, new NHXParser() );
8730 if ( !p30[ 0 ].toNewHampshireX().equals( p30_S ) ) {
8733 final String p32_S = " ; ; \n \t \b \f \r ;;;;;; ";
8734 final Phylogeny[] p32 = factory.create( p32_S, new NHXParser() );
8735 if ( ( p32.length != 0 ) ) {
8738 final String p33_S = "A";
8739 final Phylogeny[] p33 = factory.create( p33_S, new NHXParser() );
8740 if ( !p33[ 0 ].toNewHampshireX().equals( p33_S ) ) {
8743 final String p34_S = "B;";
8744 final Phylogeny[] p34 = factory.create( p34_S, new NHXParser() );
8745 if ( !p34[ 0 ].toNewHampshireX().equals( "B" ) ) {
8748 final String p35_S = "B:0.2";
8749 final Phylogeny[] p35 = factory.create( p35_S, new NHXParser() );
8750 if ( !p35[ 0 ].toNewHampshireX().equals( p35_S ) ) {
8753 final String p36_S = "(A)";
8754 final Phylogeny[] p36 = factory.create( p36_S, new NHXParser() );
8755 if ( !p36[ 0 ].toNewHampshireX().equals( p36_S ) ) {
8758 final String p37_S = "((A))";
8759 final Phylogeny[] p37 = factory.create( p37_S, new NHXParser() );
8760 if ( !p37[ 0 ].toNewHampshireX().equals( p37_S ) ) {
8763 final String p38_S = "(((((((A:0.2):0.2):0.3):0.4):0.5):0.6):0.7):0.8";
8764 final Phylogeny[] p38 = factory.create( p38_S, new NHXParser() );
8765 if ( !p38[ 0 ].toNewHampshireX().equals( p38_S ) ) {
8768 final String p39_S = "(((B,((((A:0.2):0.2):0.3):0.4):0.5):0.6):0.7):0.8";
8769 final Phylogeny[] p39 = factory.create( p39_S, new NHXParser() );
8770 if ( !p39[ 0 ].toNewHampshireX().equals( p39_S ) ) {
8773 final String p40_S = "(A,B,C)";
8774 final Phylogeny[] p40 = factory.create( p40_S, new NHXParser() );
8775 if ( !p40[ 0 ].toNewHampshireX().equals( p40_S ) ) {
8778 final String p41_S = "(A,B,C,D,E,F,G,H,I,J,K)";
8779 final Phylogeny[] p41 = factory.create( p41_S, new NHXParser() );
8780 if ( !p41[ 0 ].toNewHampshireX().equals( p41_S ) ) {
8783 final String p42_S = "(A,B,(X,Y,Z),D,E,F,G,H,I,J,K)";
8784 final Phylogeny[] p42 = factory.create( p42_S, new NHXParser() );
8785 if ( !p42[ 0 ].toNewHampshireX().equals( p42_S ) ) {
8788 final String p43_S = "(A,B,C,(AA,BB,CC,(CCC,DDD,EEE,(FFFF,GGGG)x)y,DD,EE,FF,GG,HH),D,E,(EE,FF),F,G,H,(((((5)4)3)2)1),I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,(XX,(YY)),Y,Z)";
8789 final Phylogeny[] p43 = factory.create( p43_S, new NHXParser() );
8790 if ( !p43[ 0 ].toNewHampshireX().equals( p43_S ) ) {
8793 final String p44_S = "(((A,B,C,D),(A,B,C,D),(A,B,C,D),(A,B,C,D)),((A,B,C,D),(A,B,C,D),(A,B,C,D),(A,B,C,D)),((A,B,C,D),(A,B,C,D),(A,B,C,D),(A,B,C,D)),((A,B,C,D),(A,B,C,D),(A,B,C,D),(A,B,C,D)))";
8794 final Phylogeny[] p44 = factory.create( p44_S, new NHXParser() );
8795 if ( !p44[ 0 ].toNewHampshireX().equals( p44_S ) ) {
8798 final String p45_S = "((((((((((A))))))))),(((((((((B))))))))),(((((((((C))))))))))";
8799 final Phylogeny[] p45 = factory.create( p45_S, new NHXParser() );
8800 if ( !p45[ 0 ].toNewHampshireX().equals( p45_S ) ) {
8803 final String p46_S = "";
8804 final Phylogeny[] p46 = factory.create( p46_S, new NHXParser() );
8805 if ( p46.length != 0 ) {
8808 final Phylogeny p47 = factory.create( new StringBuffer( "((A,B)ab:2[0.44],C)" ).toString(), new NHXParser() )[ 0 ];
8809 if ( !isEqual( 0.44, p47.getNode( "ab" ).getBranchData().getConfidence( 0 ).getValue() ) ) {
8812 final Phylogeny p48 = factory.create( new StringBuffer( "((A,B)ab:2[88],C)" ).toString(), new NHXParser() )[ 0 ];
8813 if ( !isEqual( 88, p48.getNode( "ab" ).getBranchData().getConfidence( 0 ).getValue() ) ) {
8816 final Phylogeny p49 = factory
8817 .create( new StringBuffer( "((A,B)a[comment:a,b;(a)]b:2[0.44][comment(a,b,b);],C)" ).toString(),
8818 new NHXParser() )[ 0 ];
8819 if ( !isEqual( 0.44, p49.getNode( "ab" ).getBranchData().getConfidence( 0 ).getValue() ) ) {
8822 final Phylogeny p50 = factory.create( new StringBuffer( "((\"A\",B)ab:2[88],C)" ).toString(), new NHXParser() )[ 0 ];
8823 if ( p50.getNode( "A" ) == null ) {
8826 if ( !p50.toNewHampshire( NH_CONVERSION_SUPPORT_VALUE_STYLE.IN_SQUARE_BRACKETS )
8827 .equals( "((A,B)ab:2.0[88],C);" ) ) {
8830 if ( !p50.toNewHampshire( NH_CONVERSION_SUPPORT_VALUE_STYLE.NONE ).equals( "((A,B)ab:2.0,C);" ) ) {
8833 if ( !p50.toNewHampshire( NH_CONVERSION_SUPPORT_VALUE_STYLE.AS_INTERNAL_NODE_NAMES )
8834 .equals( "((A,B)88:2.0,C);" ) ) {
8837 final Phylogeny p51 = factory.create( new StringBuffer( "((\"A(A\",B)ab:2[88],C)" ).toString(), new NHXParser() )[ 0 ];
8838 if ( p51.getNode( "A(A" ) == null ) {
8841 final Phylogeny p52 = factory.create( new StringBuffer( "(('A(A',B)ab:2[88],C)" ).toString(), new NHXParser() )[ 0 ];
8842 if ( p52.getNode( "A(A" ) == null ) {
8845 final Phylogeny p53 = factory
8846 .create( new StringBuffer( "(('A(A',\"B (x (a' ,b) f(x);\"[com])[ment]ab:2[88],C)" ).toString(),
8847 new NHXParser() )[ 0 ];
8848 if ( p53.getNode( "B (x (a' ,b) f(x);" ) == null ) {
8851 final Phylogeny p54 = factory.create( new StringBuffer( "((A,B):[88],C)" ).toString(), new NHXParser() )[ 0 ];
8852 if ( p54.getNode( "A" ) == null ) {
8855 if ( !p54.toNewHampshire( NH_CONVERSION_SUPPORT_VALUE_STYLE.IN_SQUARE_BRACKETS ).equals( "((A,B)[88],C);" ) ) {
8858 final Phylogeny p55 = factory
8859 .create( new StringBuffer( "((\"lcl|HPV32_L1.:1 s\":0.195593,\"lcl|HPV30_L1.1|;a\":0.114237):0.0359322,\"lcl|HPV56_L1.1|,d\":0.0727412,\"lcl|HPV66_L1.1x\":0.0798012);" ).toString(),
8860 new NHXParser() )[ 0 ];
8863 .equals( "(('lcl|HPV32_L1.:1 s':0.195593,'lcl|HPV30_L1.1|;a':0.114237):0.0359322,'lcl|HPV56_L1.1|,d':0.0727412,lcl|HPV66_L1.1x:0.0798012);" ) ) {
8864 System.out.println( p55.toNewHampshire() );
8867 final Phylogeny p56 = factory
8868 .create( new StringBuffer( "((\"lcl|HPV32_L1.:1 s\":0.195593,\"lcl|HPV30_L1.1|;a\":0.114\n237):0.0359322,\"lcl|HPV56_L1.1|,d\":0.0727412,\"lcl|HPV66_L1.1:x\":0.0798012);" ).toString(),
8869 new NHXParser() )[ 0 ];
8872 .equals( "(('lcl|HPV32_L1.:1 s':0.195593,'lcl|HPV30_L1.1|;a':0.114237):0.0359322,'lcl|HPV56_L1.1|,d':0.0727412,'lcl|HPV66_L1.1:x':0.0798012);" ) ) {
8873 System.out.println( p56.toNewHampshire() );
8876 final Phylogeny p57 = factory
8877 .create( new StringBuffer( "((\"lcl|HPV32_L1.:1 s\":0.195593,\"lcl|HPV30_L1.1|;a\":0.114\n237):0.0359322,\"lcl|HPV56_L1.1|,d\":0.0727412,\"lcl|HPV66_L1.1:x\":0.0798012);" ).toString(),
8878 new NHXParser() )[ 0 ];
8881 .equals( "(('lcl|HPV32_L1.:1 s':0.195593,'lcl|HPV30_L1.1|;a':0.114237):0.0359322,'lcl|HPV56_L1.1|,d':0.0727412,'lcl|HPV66_L1.1:x':0.0798012);" ) ) {
8882 System.out.println( p56.toNewHampshire() );
8885 final String s58 = "('Homo \"man\" sapiens:1',\"Homo 'man' sapiens;\")';root \"1_ )';";
8886 final Phylogeny p58 = factory.create( s58, new NHXParser() )[ 0 ];
8887 if ( !p58.toNewHampshire().equals( s58 ) ) {
8888 System.out.println( p58.toNewHampshire() );
8891 final String s59 = "('Homo \"man sapiens:1',\"Homo 'man sapiens\")\"root; '1_ )\";";
8892 final Phylogeny p59 = factory.create( s59 , new NHXParser() )[ 0 ];
8893 if ( !p59.toNewHampshire().equals( s59 ) ) {
8894 System.out.println( p59.toNewHampshire() );
8897 final String s60 = "('\" ;,:\":\"',\"'abc def' g's_\",'=:0.45+,.:%~`!@#$%^&*()_-+={} | ;,');";
8898 final Phylogeny p60 = factory.create( s60, new NHXParser() )[ 0 ];
8899 if ( !p60.toNewHampshire().equals( s60 ) ) {
8900 System.out.println( p60.toNewHampshire() );
8903 final String s61 = "('H[omo] \"man\" sapiens:1',\"H[omo] 'man' sapiens;\",H[omo] sapiens)';root \"1_ )';";
8904 final Phylogeny p61 = factory.create( s61, new NHXParser() )[ 0 ];
8905 if ( !p61.toNewHampshire()
8906 .equals( "('H{omo} \"man\" sapiens:1',\"H{omo} 'man' sapiens;\",Hsapiens)';root \"1_ )';" ) ) {
8907 System.out.println( p61.toNewHampshire() );
8911 catch ( final Exception e ) {
8912 e.printStackTrace( System.out );
8918 private static boolean testNHParsingSpecialChars() {
8920 final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
8921 final String i0 = "(A!+=~QWERTY!@#$%^&*-,€‚ƒ„…†‡ˆ‰Š‹ŒŽ‘’“”•–—˜˜˜™š›œžŸ¡¢£¤¥¦§¨©ª«¬®¯°±¹²³´µ¶·¸º»¼¿À÷þÿ)";
8922 final Phylogeny p0 = factory.create( i0, new NHXParser() )[ 0 ];
8923 if ( !p0.toNewHampshireX().equals( i0 ) ) {
8924 System.out.println();
8925 System.out.println( p0.toNewHampshireX() );
8926 System.out.println( i0 );
8929 final String i1 = "(हिंदी,한글,ไทย,'Tiếng Việt',ひらがなカタカナ漢字,繁體字,русский)";
8930 final Phylogeny p1 = factory.create( i1, new NHXParser() )[ 0 ];
8931 if ( !p1.toNewHampshireX().equals( i1 ) ) {
8932 System.out.println();
8933 System.out.println( p1.toNewHampshireX() );
8934 System.out.println( i1 );
8938 catch ( final Exception e ) {
8939 e.printStackTrace( System.out );
8947 private static boolean testNHParsingIter() {
8949 final String p0_str = "(A,B);";
8950 final NHXParser p = new NHXParser();
8951 p.setSource( p0_str );
8952 if ( !p.hasNext() ) {
8955 final Phylogeny p0 = p.next();
8956 if ( !p0.toNewHampshire().equals( p0_str ) ) {
8957 System.out.println( p0.toNewHampshire() );
8960 if ( p.hasNext() ) {
8963 if ( p.next() != null ) {
8967 final String p00_str = "(A,B)root;";
8968 p.setSource( p00_str );
8969 final Phylogeny p00 = p.next();
8970 if ( !p00.toNewHampshire().equals( p00_str ) ) {
8971 System.out.println( p00.toNewHampshire() );
8975 final String p000_str = "A;";
8976 p.setSource( p000_str );
8977 final Phylogeny p000 = p.next();
8978 if ( !p000.toNewHampshire().equals( p000_str ) ) {
8979 System.out.println( p000.toNewHampshire() );
8983 final String p0000_str = "A";
8984 p.setSource( p0000_str );
8985 final Phylogeny p0000 = p.next();
8986 if ( !p0000.toNewHampshire().equals( "A;" ) ) {
8987 System.out.println( p0000.toNewHampshire() );
8991 p.setSource( "(A)" );
8992 final Phylogeny p00000 = p.next();
8993 if ( !p00000.toNewHampshire().equals( "(A);" ) ) {
8994 System.out.println( p00000.toNewHampshire() );
8998 final String p1_str = "(A,B)(C,D)(E,F)(G,H)";
8999 p.setSource( p1_str );
9000 if ( !p.hasNext() ) {
9003 final Phylogeny p1_0 = p.next();
9004 if ( !p1_0.toNewHampshire().equals( "(A,B);" ) ) {
9005 System.out.println( p1_0.toNewHampshire() );
9008 if ( !p.hasNext() ) {
9011 final Phylogeny p1_1 = p.next();
9012 if ( !p1_1.toNewHampshire().equals( "(C,D);" ) ) {
9013 System.out.println( "(C,D) != " + p1_1.toNewHampshire() );
9016 if ( !p.hasNext() ) {
9019 final Phylogeny p1_2 = p.next();
9020 if ( !p1_2.toNewHampshire().equals( "(E,F);" ) ) {
9021 System.out.println( "(E,F) != " + p1_2.toNewHampshire() );
9024 if ( !p.hasNext() ) {
9027 final Phylogeny p1_3 = p.next();
9028 if ( !p1_3.toNewHampshire().equals( "(G,H);" ) ) {
9029 System.out.println( "(G,H) != " + p1_3.toNewHampshire() );
9032 if ( p.hasNext() ) {
9035 if ( p.next() != null ) {
9039 final String p2_str = "((1,2,3),B);(C,D) (E,F)root;(G,H); ;(X)";
9040 p.setSource( p2_str );
9041 if ( !p.hasNext() ) {
9044 Phylogeny p2_0 = p.next();
9045 if ( !p2_0.toNewHampshire().equals( "((1,2,3),B);" ) ) {
9046 System.out.println( p2_0.toNewHampshire() );
9049 if ( !p.hasNext() ) {
9052 Phylogeny p2_1 = p.next();
9053 if ( !p2_1.toNewHampshire().equals( "(C,D);" ) ) {
9054 System.out.println( "(C,D) != " + p2_1.toNewHampshire() );
9057 if ( !p.hasNext() ) {
9060 Phylogeny p2_2 = p.next();
9061 if ( !p2_2.toNewHampshire().equals( "(E,F)root;" ) ) {
9062 System.out.println( "(E,F)root != " + p2_2.toNewHampshire() );
9065 if ( !p.hasNext() ) {
9068 Phylogeny p2_3 = p.next();
9069 if ( !p2_3.toNewHampshire().equals( "(G,H);" ) ) {
9070 System.out.println( "(G,H) != " + p2_3.toNewHampshire() );
9073 if ( !p.hasNext() ) {
9076 Phylogeny p2_4 = p.next();
9077 if ( !p2_4.toNewHampshire().equals( "(X);" ) ) {
9078 System.out.println( "(X) != " + p2_4.toNewHampshire() );
9081 if ( p.hasNext() ) {
9084 if ( p.next() != null ) {
9089 if ( !p.hasNext() ) {
9093 if ( !p2_0.toNewHampshire().equals( "((1,2,3),B);" ) ) {
9094 System.out.println( p2_0.toNewHampshire() );
9097 if ( !p.hasNext() ) {
9101 if ( !p2_1.toNewHampshire().equals( "(C,D);" ) ) {
9102 System.out.println( "(C,D) != " + p2_1.toNewHampshire() );
9105 if ( !p.hasNext() ) {
9109 if ( !p2_2.toNewHampshire().equals( "(E,F)root;" ) ) {
9110 System.out.println( "(E,F)root != " + p2_2.toNewHampshire() );
9113 if ( !p.hasNext() ) {
9117 if ( !p2_3.toNewHampshire().equals( "(G,H);" ) ) {
9118 System.out.println( "(G,H) != " + p2_3.toNewHampshire() );
9121 if ( !p.hasNext() ) {
9125 if ( !p2_4.toNewHampshire().equals( "(X);" ) ) {
9126 System.out.println( "(X) != " + p2_4.toNewHampshire() );
9129 if ( p.hasNext() ) {
9132 if ( p.next() != null ) {
9136 final String p3_str = "((A,B),C)abc";
9137 p.setSource( p3_str );
9138 if ( !p.hasNext() ) {
9141 final Phylogeny p3_0 = p.next();
9142 if ( !p3_0.toNewHampshire().equals( "((A,B),C)abc;" ) ) {
9145 if ( p.hasNext() ) {
9148 if ( p.next() != null ) {
9152 final String p4_str = "((A,B)ab,C)abc";
9153 p.setSource( p4_str );
9154 if ( !p.hasNext() ) {
9157 final Phylogeny p4_0 = p.next();
9158 if ( !p4_0.toNewHampshire().equals( "((A,B)ab,C)abc;" ) ) {
9161 if ( p.hasNext() ) {
9164 if ( p.next() != null ) {
9168 final String p5_str = "(((A,B)ab,C)abc,D)abcd";
9169 p.setSource( p5_str );
9170 if ( !p.hasNext() ) {
9173 final Phylogeny p5_0 = p.next();
9174 if ( !p5_0.toNewHampshire().equals( "(((A,B)ab,C)abc,D)abcd;" ) ) {
9177 if ( p.hasNext() ) {
9180 if ( p.next() != null ) {
9184 final String p6_str = "(A,(B,(C,(D,E)de)cde)bcde)abcde";
9185 p.setSource( p6_str );
9186 if ( !p.hasNext() ) {
9189 Phylogeny p6_0 = p.next();
9190 if ( !p6_0.toNewHampshire().equals( "(A,(B,(C,(D,E)de)cde)bcde)abcde;" ) ) {
9193 if ( p.hasNext() ) {
9196 if ( p.next() != null ) {
9200 if ( !p.hasNext() ) {
9204 if ( !p6_0.toNewHampshire().equals( "(A,(B,(C,(D,E)de)cde)bcde)abcde;" ) ) {
9207 if ( p.hasNext() ) {
9210 if ( p.next() != null ) {
9214 final String p7_str = "((((A,B)ab,C)abc,D)abcd,E)abcde";
9215 p.setSource( p7_str );
9216 if ( !p.hasNext() ) {
9219 Phylogeny p7_0 = p.next();
9220 if ( !p7_0.toNewHampshire().equals( "((((A,B)ab,C)abc,D)abcd,E)abcde;" ) ) {
9223 if ( p.hasNext() ) {
9226 if ( p.next() != null ) {
9230 if ( !p.hasNext() ) {
9234 if ( !p7_0.toNewHampshire().equals( "((((A,B)ab,C)abc,D)abcd,E)abcde;" ) ) {
9237 if ( p.hasNext() ) {
9240 if ( p.next() != null ) {
9244 final String p8_str = "((((A,B)ab,C)abc,D)abcd,E)abcde ((((a,b)ab,c)abc,d)abcd,e)abcde";
9245 p.setSource( p8_str );
9246 if ( !p.hasNext() ) {
9249 Phylogeny p8_0 = p.next();
9250 if ( !p8_0.toNewHampshire().equals( "((((A,B)ab,C)abc,D)abcd,E)abcde;" ) ) {
9253 if ( !p.hasNext() ) {
9256 if ( !p.hasNext() ) {
9259 Phylogeny p8_1 = p.next();
9260 if ( !p8_1.toNewHampshire().equals( "((((a,b)ab,c)abc,d)abcd,e)abcde;" ) ) {
9263 if ( p.hasNext() ) {
9266 if ( p.next() != null ) {
9270 if ( !p.hasNext() ) {
9274 if ( !p8_0.toNewHampshire().equals( "((((A,B)ab,C)abc,D)abcd,E)abcde;" ) ) {
9277 if ( !p.hasNext() ) {
9281 if ( !p8_1.toNewHampshire().equals( "((((a,b)ab,c)abc,d)abcd,e)abcde;" ) ) {
9284 if ( p.hasNext() ) {
9287 if ( p.next() != null ) {
9293 if ( p.hasNext() ) {
9297 p.setSource( new File( Test.PATH_TO_TEST_DATA + "phylogeny27.nhx" ) );
9298 if ( !p.hasNext() ) {
9301 Phylogeny p_27 = p.next();
9302 if ( !p_27.toNewHampshireX().equals( "((((A,B)ab,C)abc,D)abcd,E)abcde" ) ) {
9303 System.out.println( p_27.toNewHampshireX() );
9307 if ( p.hasNext() ) {
9310 if ( p.next() != null ) {
9314 if ( !p.hasNext() ) {
9318 if ( !p_27.toNewHampshireX().equals( "((((A,B)ab,C)abc,D)abcd,E)abcde" ) ) {
9319 System.out.println( p_27.toNewHampshireX() );
9323 if ( p.hasNext() ) {
9326 if ( p.next() != null ) {
9330 final String p30_str = "(A,B);(C,D)";
9331 final NHXParser p30 = new NHXParser();
9332 p30.setSource( p30_str );
9333 if ( !p30.hasNext() ) {
9336 Phylogeny phy30 = p30.next();
9337 if ( !phy30.toNewHampshire().equals( "(A,B);" ) ) {
9338 System.out.println( phy30.toNewHampshire() );
9341 if ( !p30.hasNext() ) {
9344 Phylogeny phy301 = p30.next();
9345 if ( !phy301.toNewHampshire().equals( "(C,D);" ) ) {
9346 System.out.println( phy301.toNewHampshire() );
9349 if ( p30.hasNext() ) {
9352 if ( p30.hasNext() ) {
9355 if ( p30.next() != null ) {
9358 if ( p30.next() != null ) {
9362 if ( !p30.hasNext() ) {
9366 if ( !phy30.toNewHampshire().equals( "(A,B);" ) ) {
9367 System.out.println( phy30.toNewHampshire() );
9370 if ( !p30.hasNext() ) {
9373 phy301 = p30.next();
9374 if ( !phy301.toNewHampshire().equals( "(C,D);" ) ) {
9375 System.out.println( phy301.toNewHampshire() );
9378 if ( p30.hasNext() ) {
9381 if ( p30.hasNext() ) {
9384 if ( p30.next() != null ) {
9387 if ( p30.next() != null ) {
9391 catch ( final Exception e ) {
9392 e.printStackTrace( System.out );
9398 private static boolean testNHXconversion() {
9400 final PhylogenyNode n1 = new PhylogenyNode();
9401 final PhylogenyNode n2 = PhylogenyNode.createInstanceFromNhxString( "" );
9402 final PhylogenyNode n3 = PhylogenyNode.createInstanceFromNhxString( "n3" );
9403 final PhylogenyNode n4 = PhylogenyNode.createInstanceFromNhxString( "n4:0.01" );
9404 final PhylogenyNode n5 = PhylogenyNode
9405 .createInstanceFromNhxString( "n5:0.1[&&NHX:S=Ecoli:E=1.1.1.1:D=Y:Co=Y:B=56:T=1]" );
9406 final PhylogenyNode n6 = PhylogenyNode
9407 .createInstanceFromNhxString( "n6:0.000001[&&NHX:S=Ecoli:E=1.1.1.1:D=N:Co=N:B=100:T=1]" );
9408 if ( !n1.toNewHampshireX().equals( "" ) ) {
9411 if ( !n2.toNewHampshireX().equals( "" ) ) {
9414 if ( !n3.toNewHampshireX().equals( "n3" ) ) {
9417 if ( !n4.toNewHampshireX().equals( "n4:0.01" ) ) {
9420 if ( !n5.toNewHampshireX().equals( "n5:0.1[&&NHX:T=1:S=Ecoli:D=Y:B=56]" ) ) {
9423 if ( !n6.toNewHampshireX().equals( "n6:1.0E-6[&&NHX:T=1:S=Ecoli:D=N:B=100]" ) ) {
9424 System.out.println( n6.toNewHampshireX() );
9427 final PhylogenyNode n7 = new PhylogenyNode();
9428 n7.setName( " gks:dr-m4 \" ' `@:[]sadq04 " );
9429 if ( !n7.toNewHampshire( true, PhylogenyNode.NH_CONVERSION_SUPPORT_VALUE_STYLE.IN_SQUARE_BRACKETS )
9430 .equals( "'gks:dr-m4 \" ` `@:[]sadq04'" ) ) {
9431 System.out.println( n7
9432 .toNewHampshire( true, PhylogenyNode.NH_CONVERSION_SUPPORT_VALUE_STYLE.IN_SQUARE_BRACKETS ) );
9436 catch ( final Exception e ) {
9437 e.printStackTrace( System.out );
9443 private static boolean testNHXNodeParsing() {
9445 final PhylogenyNode n1 = new PhylogenyNode();
9446 final PhylogenyNode n2 = PhylogenyNode.createInstanceFromNhxString( "" );
9447 final PhylogenyNode n3 = PhylogenyNode.createInstanceFromNhxString( "n3" );
9448 final PhylogenyNode n4 = PhylogenyNode.createInstanceFromNhxString( "n4:0.01" );
9449 final PhylogenyNode n5 = PhylogenyNode
9450 .createInstanceFromNhxString( "n5:0.1[&&NHX:S=Ecoli:E=1.1.1.1:D=Y:B=56:T=1:On=22:SOn=33:SNn=44:W=2:C=10.20.30:XN=S=tag1=value1=unit1:XN=S=tag3=value3=unit3]" );
9451 if ( !n3.getName().equals( "n3" ) ) {
9454 if ( n3.getDistanceToParent() != PhylogenyDataUtil.BRANCH_LENGTH_DEFAULT ) {
9457 if ( n3.isDuplication() ) {
9460 if ( n3.isHasAssignedEvent() ) {
9463 if ( PhylogenyMethods.getBranchWidthValue( n3 ) != BranchWidth.BRANCH_WIDTH_DEFAULT_VALUE ) {
9466 if ( !n4.getName().equals( "n4" ) ) {
9469 if ( n4.getDistanceToParent() != 0.01 ) {
9472 if ( !n5.getName().equals( "n5" ) ) {
9475 if ( PhylogenyMethods.getConfidenceValue( n5 ) != 56 ) {
9478 if ( n5.getDistanceToParent() != 0.1 ) {
9481 if ( !PhylogenyMethods.getSpecies( n5 ).equals( "Ecoli" ) ) {
9484 if ( !n5.isDuplication() ) {
9487 if ( !n5.isHasAssignedEvent() ) {
9490 final PhylogenyNode n8 = PhylogenyNode
9491 .createInstanceFromNhxString( "ABCD_ECOLI/1-2:0.01",
9492 NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
9493 if ( !n8.getName().equals( "ABCD_ECOLI/1-2" ) ) {
9496 if ( !PhylogenyMethods.getSpecies( n8 ).equals( "ECOLI" ) ) {
9499 final PhylogenyNode n9 = PhylogenyNode
9500 .createInstanceFromNhxString( "ABCD_ECOLI/1-12:0.01",
9501 NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
9502 if ( !n9.getName().equals( "ABCD_ECOLI/1-12" ) ) {
9505 if ( !PhylogenyMethods.getSpecies( n9 ).equals( "ECOLI" ) ) {
9508 final PhylogenyNode n10 = PhylogenyNode
9509 .createInstanceFromNhxString( "n10.ECOLI", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
9510 if ( !n10.getName().equals( "n10.ECOLI" ) ) {
9513 final PhylogenyNode n20 = PhylogenyNode
9514 .createInstanceFromNhxString( "ABCD_ECOLI/1-2", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
9515 if ( !n20.getName().equals( "ABCD_ECOLI/1-2" ) ) {
9518 if ( !PhylogenyMethods.getSpecies( n20 ).equals( "ECOLI" ) ) {
9521 final PhylogenyNode n20x = PhylogenyNode
9522 .createInstanceFromNhxString( "N20_ECOL1/1-2", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
9523 if ( !n20x.getName().equals( "N20_ECOL1/1-2" ) ) {
9526 if ( !PhylogenyMethods.getSpecies( n20x ).equals( "ECOL1" ) ) {
9529 final PhylogenyNode n20xx = PhylogenyNode
9530 .createInstanceFromNhxString( "N20_eCOL1/1-2", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
9531 if ( !n20xx.getName().equals( "N20_eCOL1/1-2" ) ) {
9534 if ( PhylogenyMethods.getSpecies( n20xx ).length() > 0 ) {
9537 final PhylogenyNode n20xxx = PhylogenyNode
9538 .createInstanceFromNhxString( "n20_ecoli/1-2", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
9539 if ( !n20xxx.getName().equals( "n20_ecoli/1-2" ) ) {
9542 if ( PhylogenyMethods.getSpecies( n20xxx ).length() > 0 ) {
9545 final PhylogenyNode n20xxxx = PhylogenyNode
9546 .createInstanceFromNhxString( "n20_Ecoli/1-2", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
9547 if ( !n20xxxx.getName().equals( "n20_Ecoli/1-2" ) ) {
9550 if ( PhylogenyMethods.getSpecies( n20xxxx ).length() > 0 ) {
9553 final PhylogenyNode n21 = PhylogenyNode
9554 .createInstanceFromNhxString( "N21_PIG", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
9555 if ( !n21.getName().equals( "N21_PIG" ) ) {
9558 if ( !PhylogenyMethods.getSpecies( n21 ).equals( "PIG" ) ) {
9561 final PhylogenyNode n21x = PhylogenyNode
9562 .createInstanceFromNhxString( "n21_PIG", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
9563 if ( !n21x.getName().equals( "n21_PIG" ) ) {
9566 if ( PhylogenyMethods.getSpecies( n21x ).length() > 0 ) {
9569 final PhylogenyNode n22 = PhylogenyNode
9570 .createInstanceFromNhxString( "n22/PIG", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
9571 if ( !n22.getName().equals( "n22/PIG" ) ) {
9574 if ( PhylogenyMethods.getSpecies( n22 ).length() > 0 ) {
9577 final PhylogenyNode n23 = PhylogenyNode
9578 .createInstanceFromNhxString( "n23/PIG_1", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
9579 if ( !n23.getName().equals( "n23/PIG_1" ) ) {
9582 if ( PhylogenyMethods.getSpecies( n23 ).length() > 0 ) {
9585 final PhylogenyNode a = PhylogenyNode
9586 .createInstanceFromNhxString( "ABCD_ECOLI/1-2", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
9587 if ( !a.getName().equals( "ABCD_ECOLI/1-2" ) ) {
9590 if ( !PhylogenyMethods.getSpecies( a ).equals( "ECOLI" ) ) {
9593 final PhylogenyNode c1 = PhylogenyNode
9594 .createInstanceFromNhxString( "n10_BOVIN/1000-2000",
9595 NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
9596 if ( !c1.getName().equals( "n10_BOVIN/1000-2000" ) ) {
9599 if ( !PhylogenyMethods.getSpecies( c1 ).equals( "BOVIN" ) ) {
9602 final PhylogenyNode c2 = PhylogenyNode
9603 .createInstanceFromNhxString( "N10_Bovin_1/1000-2000",
9604 NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
9605 if ( !c2.getName().equals( "N10_Bovin_1/1000-2000" ) ) {
9608 if ( PhylogenyMethods.getSpecies( c2 ).length() > 0 ) {
9611 final PhylogenyNode e3 = PhylogenyNode
9612 .createInstanceFromNhxString( "n10_RAT~", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
9613 if ( !e3.getName().equals( "n10_RAT~" ) ) {
9616 if ( !PhylogenyMethods.getSpecies( e3 ).equals( "RAT" ) ) {
9619 final PhylogenyNode n11 = PhylogenyNode
9620 .createInstanceFromNhxString( "N111111_ECOLI/1-2:0.4",
9621 NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
9622 if ( !n11.getName().equals( "N111111_ECOLI/1-2" ) ) {
9625 if ( n11.getDistanceToParent() != 0.4 ) {
9628 if ( !PhylogenyMethods.getSpecies( n11 ).equals( "ECOLI" ) ) {
9631 final PhylogenyNode n12 = PhylogenyNode
9632 .createInstanceFromNhxString( "N111111-ECOLI---/jdj:0.4",
9633 NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
9634 if ( !n12.getName().equals( "N111111-ECOLI---/jdj" ) ) {
9637 if ( n12.getDistanceToParent() != 0.4 ) {
9640 if ( PhylogenyMethods.getSpecies( n12 ).length() > 0 ) {
9643 final PhylogenyNode o = PhylogenyNode
9644 .createInstanceFromNhxString( "ABCD_MOUSE", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
9645 if ( !o.getName().equals( "ABCD_MOUSE" ) ) {
9648 if ( !PhylogenyMethods.getSpecies( o ).equals( "MOUSE" ) ) {
9651 if ( n1.getName().compareTo( "" ) != 0 ) {
9654 if ( PhylogenyMethods.getConfidenceValue( n1 ) != Confidence.CONFIDENCE_DEFAULT_VALUE ) {
9657 if ( n1.getDistanceToParent() != PhylogenyDataUtil.BRANCH_LENGTH_DEFAULT ) {
9660 if ( n2.getName().compareTo( "" ) != 0 ) {
9663 if ( PhylogenyMethods.getConfidenceValue( n2 ) != Confidence.CONFIDENCE_DEFAULT_VALUE ) {
9666 if ( n2.getDistanceToParent() != PhylogenyDataUtil.BRANCH_LENGTH_DEFAULT ) {
9669 final PhylogenyNode n00 = PhylogenyNode
9670 .createInstanceFromNhxString( "n7:0.000001[&&NHX:GN=gene_name:AC=accession123:S=Ecoli:D=N:Co=N:B=100:T=1]" );
9671 if ( !n00.getNodeData().getSequence().getName().equals( "gene_name" ) ) {
9674 if ( !n00.getNodeData().getSequence().getAccession().getValue().equals( "accession123" ) ) {
9677 final PhylogenyNode nx = PhylogenyNode.createInstanceFromNhxString( "n5:0.1[&&NHX:S=Ecoli:GN=gene_1]" );
9678 if ( !nx.getNodeData().getSequence().getName().equals( "gene_1" ) ) {
9681 final PhylogenyNode n13 = PhylogenyNode
9682 .createInstanceFromNhxString( "BLAH_12345/1-2", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
9683 if ( !n13.getName().equals( "BLAH_12345/1-2" ) ) {
9686 if ( PhylogenyMethods.getSpecies( n13 ).equals( "12345" ) ) {
9689 if ( !n13.getNodeData().getTaxonomy().getIdentifier().getValue().equals( "12345" ) ) {
9692 if ( !n13.getNodeData().getTaxonomy().getIdentifier().getProvider().equals( "uniprot" ) ) {
9695 final PhylogenyNode n14 = PhylogenyNode
9696 .createInstanceFromNhxString( "BLA1_9QX45/1-2", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
9697 if ( !n14.getName().equals( "BLA1_9QX45/1-2" ) ) {
9700 if ( !PhylogenyMethods.getSpecies( n14 ).equals( "9QX45" ) ) {
9703 final PhylogenyNode n15 = PhylogenyNode
9704 .createInstanceFromNhxString( "something_wicked[123]",
9705 NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
9706 if ( !n15.getName().equals( "something_wicked" ) ) {
9709 if ( n15.getBranchData().getNumberOfConfidences() != 1 ) {
9712 if ( !isEqual( n15.getBranchData().getConfidence( 0 ).getValue(), 123 ) ) {
9715 final PhylogenyNode n16 = PhylogenyNode
9716 .createInstanceFromNhxString( "something_wicked2[9]",
9717 NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
9718 if ( !n16.getName().equals( "something_wicked2" ) ) {
9721 if ( n16.getBranchData().getNumberOfConfidences() != 1 ) {
9724 if ( !isEqual( n16.getBranchData().getConfidence( 0 ).getValue(), 9 ) ) {
9727 final PhylogenyNode n17 = PhylogenyNode
9728 .createInstanceFromNhxString( "something_wicked3[a]",
9729 NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
9730 if ( !n17.getName().equals( "something_wicked3" ) ) {
9733 if ( n17.getBranchData().getNumberOfConfidences() != 0 ) {
9736 final PhylogenyNode n18 = PhylogenyNode
9737 .createInstanceFromNhxString( ":0.5[91]", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
9738 if ( !isEqual( n18.getDistanceToParent(), 0.5 ) ) {
9741 if ( n18.getBranchData().getNumberOfConfidences() != 1 ) {
9744 if ( !isEqual( n18.getBranchData().getConfidence( 0 ).getValue(), 91 ) ) {
9747 final PhylogenyNode n19 = PhylogenyNode
9748 .createInstanceFromNhxString( "BLAH_1-roejojoej", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
9749 if ( !n19.getNodeData().getTaxonomy().getIdentifier().getValue().equals( "1" ) ) {
9752 if ( !n19.getNodeData().getTaxonomy().getIdentifier().getProvider().equals( "uniprot" ) ) {
9755 final PhylogenyNode n30 = PhylogenyNode
9756 .createInstanceFromNhxString( "BLAH_1234567-roejojoej",
9757 NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
9758 if ( !n30.getNodeData().getTaxonomy().getIdentifier().getValue().equals( "1234567" ) ) {
9761 if ( !n30.getNodeData().getTaxonomy().getIdentifier().getProvider().equals( "uniprot" ) ) {
9764 final PhylogenyNode n31 = PhylogenyNode
9765 .createInstanceFromNhxString( "BLAH_12345678-roejojoej",
9766 NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
9767 if ( n31.getNodeData().isHasTaxonomy() ) {
9770 final PhylogenyNode n32 = PhylogenyNode
9771 .createInstanceFromNhxString( "sd_12345678", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
9772 if ( n32.getNodeData().isHasTaxonomy() ) {
9775 final PhylogenyNode n40 = PhylogenyNode
9776 .createInstanceFromNhxString( "BCL2_12345", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
9777 if ( !n40.getNodeData().getTaxonomy().getIdentifier().getValue().equals( "12345" ) ) {
9780 final PhylogenyNode n41 = PhylogenyNode
9781 .createInstanceFromNhxString( "12345", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
9782 if ( n41.getNodeData().isHasTaxonomy() ) {
9785 final PhylogenyNode n42 = PhylogenyNode
9786 .createInstanceFromNhxString( "12345", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
9787 if ( n42.getNodeData().isHasTaxonomy() ) {
9790 final PhylogenyNode n43 = PhylogenyNode.createInstanceFromNhxString( "12345",
9791 NHXParser.TAXONOMY_EXTRACTION.NO );
9792 if ( n43.getNodeData().isHasTaxonomy() ) {
9795 final PhylogenyNode n44 = PhylogenyNode
9796 .createInstanceFromNhxString( "12345~1-2", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
9797 if ( n44.getNodeData().isHasTaxonomy() ) {
9801 catch ( final Exception e ) {
9802 e.printStackTrace( System.out );
9808 private static boolean testNHXParsing() {
9810 final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
9811 final Phylogeny p1 = factory.create( "(A [&&NHX:S=a_species],B1[&&NHX:S=b_species])", new NHXParser() )[ 0 ];
9812 if ( !p1.toNewHampshireX().equals( "(A[&&NHX:S=a_species],B1[&&NHX:S=b_species])" ) ) {
9815 final String p2_S = "(((((((A:0.2[&&NHX:S=qwerty]):0.2[&&NHX:S=uiop]):0.3[&&NHX:S=asdf]):0.4[&&NHX:S=zxc]):0.5[&&NHX:S=a]):0.6[&&NHX:S=asd]):0.7[&&NHX:S=za]):0.8[&&NHX:S=zaq]";
9816 final Phylogeny[] p2 = factory.create( p2_S, new NHXParser() );
9817 if ( !p2[ 0 ].toNewHampshireX().equals( p2_S ) ) {
9820 final String p2b_S = "(((((((A:0.2[&NHX:S=qw,erty]):0.2[&:S=u(io)p]):0.3[&NHX:S=asdf]):0.4[S=zxc]):0.5[]):0.6[&&NH:S=asd]):0.7[&&HX:S=za]):0.8[&&:S=zaq]";
9821 final Phylogeny[] p2b = factory.create( p2b_S, new NHXParser() );
9822 if ( !p2b[ 0 ].toNewHampshireX().equals( "(((((((A:0.2):0.2):0.3):0.4):0.5):0.6):0.7):0.8" ) ) {
9825 final Phylogeny[] p3 = factory
9826 .create( "[ comment&&NHX,())))](((((((A:0.2[&&NHX:S=qwerty]):0.2[&&NHX:S=uiop]):0.3[&&NHX:S=asdf]):0.4[&&NHX:S=zxc]):0.5[&&NHX:S=a]):0.6[&&NHX:S=asd]):0.7[&&NHX:S=za]):0.8[&&NHX:S=zaq]",
9828 if ( !p3[ 0 ].toNewHampshireX().equals( p2_S ) ) {
9831 final Phylogeny[] p4 = factory
9832 .create( "(((((((A:0.2[&&NHX:S=qwerty]):0.2[&&NHX:S=uiop]):0.3[&&NHX:S=asdf]):0.4[&&NHX:S=zxc]):0.5[&&NHX:S=a]):0.6[&&NHX:S=asd]):0.7[&&NHX:S=za]):0.8[&&NHX:S=zaq][comment(]",
9834 if ( !p4[ 0 ].toNewHampshireX().equals( p2_S ) ) {
9837 final Phylogeny[] p5 = factory
9838 .create( "[] ( [][ ][ ] ([((( &&NHXcomment only![[[[[[]([]((((A:0.2[&&NHX:S=q[comment )))]werty][,,,,))]):0.2[&&NHX:S=uiop]):0.3[&&NHX:S=a[comment,,))]sdf])[comment(((]:0.4[&&NHX:S=zxc][comment(((][comment(((]):0.5[&&NHX:S=a]):0.6[&&NHX:S=a[comment(((]sd]):0.7[&&NHX:S=za]):0.8[&&NHX:S=zaq][comment(((]",
9840 if ( !p5[ 0 ].toNewHampshireX().equals( p2_S ) ) {
9843 final String p6_S_C = "(A[][][][1][22][333][4444][55555][666666][&&NHX:S=Aspecies],B[))],C,(AA,BB,CC,(CCC,DDD,EEE,[comment](FFFF,GGGG)x)y,D[comment]D,EE,FF,GG,HH),D,E,(EE,FF),F,G,H,(((((5)4)3)2)1),I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,(XX,(YY)),Y,Z)";
9844 final String p6_S_WO_C = "(A[&&NHX:S=Aspecies],B,C,(AA,BB,CC,(CCC,DDD,EEE,(FFFF,GGGG)x)y,DD,EE,FF,GG,HH),D,E,(EE,FF),F,G,H,(((((5)4)3)2)1),I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,(XX,(YY)),Y,Z)";
9845 final Phylogeny[] p6 = factory.create( p6_S_C, new NHXParser() );
9846 if ( !p6[ 0 ].toNewHampshireX().equals( p6_S_WO_C ) ) {
9849 final String p7_S_C = "(((A [&&NHX:S=species_a], B [&&NHX:S=Vstorri] , C , D),(A,B,C,D[comment])[],[c][]([xxx]A[comment],[comment]B[comment][comment],[comment][comment]C[comment][comment],[comment][comment]D[comment][comment])[comment][comment],[comment] [comment](A,B,C,D)),((A,B,C,D),(A,B,C,D),(A,B,C,D),(A,B,C,D)),((A,B,C[comment][comment][comment][comment][comment] [comment],D),(A,B,C,D),(A,B,C,D),(A,B,C,D)),[comment][comment]((A,B,C,D),(A,B,C,D),(A,B,C,D),(A,B,C,D)))";
9850 final String p7_S_WO_C = "(((A[&&NHX:S=species_a],B[&&NHX:S=Vstorri],C,D),(A,B,C,D),(A,B,C,D),(A,B,C,D)),((A,B,C,D),(A,B,C,D),(A,B,C,D),(A,B,C,D)),((A,B,C,D),(A,B,C,D),(A,B,C,D),(A,B,C,D)),((A,B,C,D),(A,B,C,D),(A,B,C,D),(A,B,C,D)))";
9851 final Phylogeny[] p7 = factory.create( p7_S_C, new NHXParser() );
9852 if ( !p7[ 0 ].toNewHampshireX().equals( p7_S_WO_C ) ) {
9855 final String p8_S_C = "[cmt](((([]([))))))](((((A[&&NHX:S= [a comment] a])))))))[too many comments!:)])),(((((((((B[&&NHX[ a comment in a bad place]:S =b])))))[] [] )))),(((((((((C[&&NHX:S=c]) ))[,,, ])))))))";
9856 final String p8_S_WO_C = "((((((((((A[&&NHX:S=a]))))))))),(((((((((B[&&NHX:S=b]))))))))),(((((((((C[&&NHX:S=c]))))))))))";
9857 final Phylogeny[] p8 = factory.create( p8_S_C, new NHXParser() );
9858 if ( !p8[ 0 ].toNewHampshireX().equals( p8_S_WO_C ) ) {
9861 final Phylogeny p9 = factory.create( "((A:0.2,B:0.3):0.5[91],C:0.1)root:0.1[100]", new NHXParser() )[ 0 ];
9862 if ( !p9.toNewHampshireX().equals( "((A:0.2,B:0.3):0.5[&&NHX:B=91],C:0.1)root:0.1[&&NHX:B=100]" ) ) {
9865 final Phylogeny p10 = factory
9866 .create( " [79] ( (A [co mment] :0 .2[comment],B:0.3[com])[com ment]: 0. 5 \t[ 9 1 ][ comment],C: 0.1)[comment]root:0.1[100] [comment]",
9867 new NHXParser() )[ 0 ];
9868 if ( !p10.toNewHampshireX().equals( "((A:0.2,B:0.3):0.5[&&NHX:B=91],C:0.1)root:0.1[&&NHX:B=100]" ) ) {
9871 final Phylogeny p11 = factory
9872 .create( " [79] ( ('A: \" ' [co mment] :0 .2[comment],B:0.3[com])[com ment]: 0. 5 \t[ 9 1 ][ comment],C: 0.1)[comment]root:0.1[100] [comment]",
9873 new NHXParser() )[ 0 ];
9874 if ( !p11.toNewHampshireX().equals( "(('A: \"':0.2,B:0.3):0.5[&&NHX:B=91],C:0.1)root:0.1[&&NHX:B=100]" ) ) {
9877 final Phylogeny p12 = factory.create( "((A:0.2,B:0.3):0.5[&&NHX:B=91],C:0.1)root:0.1[&&NHX:B=100]",
9878 new NHXParser() )[ 0 ];
9879 if ( !p12.toNewHampshireX().equals( "((A:0.2,B:0.3):0.5[&&NHX:B=91],C:0.1)root:0.1[&&NHX:B=100]" ) ) {
9883 catch ( final Exception e ) {
9884 e.printStackTrace( System.out );
9890 private static boolean testNHXParsingMB() {
9892 final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
9893 final Phylogeny p1 = factory.create( "(1[&prob=0.9500000000000000e+00,prob_stddev=0.1100000000000000e+00,"
9894 + "prob_range={1.000000000000000e+00,1.000000000000000e+00},prob(percent)=\"100\","
9895 + "prob+-sd=\"100+-0\"]:4.129000000000000e-02[&length_mean=4.153987461671767e-02,"
9896 + "length_median=4.129000000000000e-02,length_95%HPD={3.217800000000000e-02,"
9897 + "5.026800000000000e-02}],2[&prob=0.810000000000000e+00,prob_stddev=0.000000000000000e+00,"
9898 + "prob_range={1.000000000000000e+00,1.000000000000000e+00},prob(percent)=\"100\","
9899 + "prob+-sd=\"100+-0\"]:6.375699999999999e-02[&length_mean=6.395210411945065e-02,"
9900 + "length_median=6.375699999999999e-02,length_95%HPD={5.388600000000000e-02,"
9901 + "7.369400000000000e-02}])", new NHXParser() )[ 0 ];
9902 if ( !isEqual( p1.getNode( "1" ).getDistanceToParent(), 4.129e-02 ) ) {
9905 if ( !isEqual( p1.getNode( "1" ).getBranchData().getConfidence( 0 ).getValue(), 0.9500000000000000e+00 ) ) {
9908 if ( !isEqual( p1.getNode( "1" ).getBranchData().getConfidence( 0 ).getStandardDeviation(),
9909 0.1100000000000000e+00 ) ) {
9912 if ( !isEqual( p1.getNode( "2" ).getDistanceToParent(), 6.375699999999999e-02 ) ) {
9915 if ( !isEqual( p1.getNode( "2" ).getBranchData().getConfidence( 0 ).getValue(), 0.810000000000000e+00 ) ) {
9918 final Phylogeny p2 = factory
9919 .create( "(1[something_else(?)s,prob=0.9500000000000000e+00{}(((,p)rob_stddev=0.110000000000e+00,"
9920 + "prob_range={1.000000000000000e+00,1.000000000000000e+00},prob(percent)=\"100\","
9921 + "prob+-sd=\"100+-0\"]:4.129000000000000e-02[&length_mean=4.153987461671767e-02,"
9922 + "length_median=4.129000000000000e-02,length_95%HPD={3.217800000000000e-02,"
9923 + "5.026800000000000e-02}],2[&prob=0.810000000000000e+00,prob_stddev=0.000000000000000e+00,"
9924 + "prob_range={1.000000000000000e+00,1.000000000000000e+00},prob(percent)=\"100\","
9925 + "prob+-sd=\"100+-0\"]:6.375699999999999e-02[&length_mean=6.395210411945065e-02,"
9926 + "length_median=6.375699999999999e-02,length_95%HPD={5.388600000000000e-02,"
9927 + "7.369400000000000e-02}])",
9928 new NHXParser() )[ 0 ];
9929 if ( p2.getNode( "1" ) == null ) {
9932 if ( p2.getNode( "2" ) == null ) {
9936 catch ( final Exception e ) {
9937 e.printStackTrace( System.out );
9944 private static boolean testNHXParsingQuotes() {
9946 final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
9947 final NHXParser p = new NHXParser();
9948 final Phylogeny[] phylogenies_0 = factory.create( new File( Test.PATH_TO_TEST_DATA + "quotes.nhx" ), p );
9949 if ( phylogenies_0.length != 5 ) {
9952 final Phylogeny phy = phylogenies_0[ 4 ];
9953 if ( phy.getNumberOfExternalNodes() != 7 ) {
9956 if ( phy.getNodes( "a name in double quotes from tree ((a,b),c)" ).size() != 1 ) {
9959 if ( phy.getNodes( "charles darwin 'origin of species'" ).size() != 1 ) {
9962 if ( !phy.getNodes( "charles darwin 'origin of species'" ).get( 0 ).getNodeData().getTaxonomy()
9963 .getScientificName().equals( "hsapiens" ) ) {
9966 if ( phy.getNodes( "shouldbetogether single quotes" ).size() != 1 ) {
9969 if ( phy.getNodes( "'single quotes' inside double quotes" ).size() != 1 ) {
9972 if ( phy.getNodes( "\"double quotes\" inside single quotes" ).size() != 1 ) {
9975 if ( phy.getNodes( "noquotes" ).size() != 1 ) {
9978 if ( phy.getNodes( "A ( B C '" ).size() != 1 ) {
9981 final NHXParser p1p = new NHXParser();
9982 p1p.setIgnoreQuotes( true );
9983 final Phylogeny p1 = factory.create( "(\"A\",'B1')", p1p )[ 0 ];
9984 if ( !p1.toNewHampshire().equals( "(A,B1);" ) ) {
9987 final NHXParser p2p = new NHXParser();
9988 p1p.setIgnoreQuotes( false );
9989 final Phylogeny p2 = factory.create( "(\"A\",'B1')", p2p )[ 0 ];
9990 if ( !p2.toNewHampshire().equals( "(A,B1);" ) ) {
9993 final NHXParser p3p = new NHXParser();
9994 p3p.setIgnoreQuotes( false );
9995 final Phylogeny p3 = factory.create( "(\"A)\",'B1')", p3p )[ 0 ];
9996 if ( !p3.toNewHampshire().equals( "('A)',B1);" ) ) {
9999 final NHXParser p4p = new NHXParser();
10000 p4p.setIgnoreQuotes( false );
10001 final Phylogeny p4 = factory.create( "(\"A)\",'B(),; x')", p4p )[ 0 ];
10002 if ( !p4.toNewHampshire().equals( "('A)','B(),; x');" ) ) {
10005 final Phylogeny p10 = factory
10006 .create( " [79] ( (\"A \n\tB \" [co mment] :0 .2[comment],'B':0.3[com])[com ment]: 0. 5 \t[ 9 1 ][ comment],'C (or D?\\//;,))': 0.1)[comment]'\nroot is here (cool, was! ) ':0.1[100] [comment]",
10007 new NHXParser() )[ 0 ];
10008 final String p10_clean_str = "(('A B':0.2,B:0.3):0.5[&&NHX:B=91],'C (or D?\\//;,))':0.1)'root is here (cool, was! )':0.1[&&NHX:B=100]";
10009 if ( !p10.toNewHampshireX().equals( p10_clean_str ) ) {
10012 final Phylogeny p11 = factory.create( p10.toNewHampshireX(), new NHXParser() )[ 0 ];
10013 if ( !p11.toNewHampshireX().equals( p10_clean_str ) ) {
10016 final Phylogeny p12 = factory
10017 .create( " [79] ( (\"A \n\tB \" [[][] :0 .2[comment][\t&\t&\n N\tH\tX:S=mo\tnkey !],'\tB\t\b\t\n\f\rB B ':0.0\b3[])\t[com ment]: 0. 5 \t[ 9 1 ][ \ncomment],'C\t (or D?\\//;,))': 0.\b1)[comment]'\nroot \tis here (cool, \b\t\n\f\r was! ) ':0.1[100] [comment]",
10018 new NHXParser() )[ 0 ];
10019 final String p12_clean_str = "(('A B':0.2[&&NHX:S=monkey!],'BB B':0.03):0.5[&&NHX:B=91],'C (or D?\\//;,))':0.1)'root is here (cool, was! )':0.1[&&NHX:B=100]";
10020 if ( !p12.toNewHampshireX().equals( p12_clean_str ) ) {
10023 final Phylogeny p13 = factory.create( p12.toNewHampshireX(), new NHXParser() )[ 0 ];
10024 if ( !p13.toNewHampshireX().equals( p12_clean_str ) ) {
10027 final String p12_clean_str_nh = "(('A B':0.2,'BB B':0.03):0.5,'C (or D?\\//;,))':0.1)'root is here (cool, was! )':0.1;";
10028 if ( !p13.toNewHampshire().equals( p12_clean_str_nh ) ) {
10031 final Phylogeny p14 = factory.create( p13.toNewHampshire(), new NHXParser() )[ 0 ];
10032 if ( !p14.toNewHampshire().equals( p12_clean_str_nh ) ) {
10036 catch ( final Exception e ) {
10037 e.printStackTrace( System.out );
10043 private static boolean testNodeRemoval() {
10045 final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
10046 final Phylogeny t0 = factory.create( "((a)b)", new NHXParser() )[ 0 ];
10047 PhylogenyMethods.removeNode( t0.getNode( "b" ), t0 );
10048 if ( !t0.toNewHampshire().equals( "(a);" ) ) {
10051 final Phylogeny t1 = factory.create( "((a:2)b:4)", new NHXParser() )[ 0 ];
10052 PhylogenyMethods.removeNode( t1.getNode( "b" ), t1 );
10053 if ( !t1.toNewHampshire().equals( "(a:6.0);" ) ) {
10056 final Phylogeny t2 = factory.create( "((a,b),c)", new NHXParser() )[ 0 ];
10057 PhylogenyMethods.removeNode( t2.getNode( "b" ), t2 );
10058 if ( !t2.toNewHampshire().equals( "((a),c);" ) ) {
10062 catch ( final Exception e ) {
10063 e.printStackTrace( System.out );
10069 private static boolean testPhylogenyBranch() {
10071 final PhylogenyNode a1 = PhylogenyNode.createInstanceFromNhxString( "a" );
10072 final PhylogenyNode b1 = PhylogenyNode.createInstanceFromNhxString( "b" );
10073 final PhylogenyBranch a1b1 = new PhylogenyBranch( a1, b1 );
10074 final PhylogenyBranch b1a1 = new PhylogenyBranch( b1, a1 );
10075 if ( !a1b1.equals( a1b1 ) ) {
10078 if ( !a1b1.equals( b1a1 ) ) {
10081 if ( !b1a1.equals( a1b1 ) ) {
10084 final PhylogenyBranch a1_b1 = new PhylogenyBranch( a1, b1, true );
10085 final PhylogenyBranch b1_a1 = new PhylogenyBranch( b1, a1, true );
10086 final PhylogenyBranch a1_b1_ = new PhylogenyBranch( a1, b1, false );
10087 if ( a1_b1.equals( b1_a1 ) ) {
10090 if ( a1_b1.equals( a1_b1_ ) ) {
10093 final PhylogenyBranch b1_a1_ = new PhylogenyBranch( b1, a1, false );
10094 if ( !a1_b1.equals( b1_a1_ ) ) {
10097 if ( a1_b1_.equals( b1_a1_ ) ) {
10100 if ( !a1_b1_.equals( b1_a1 ) ) {
10104 catch ( final Exception e ) {
10105 e.printStackTrace( System.out );
10111 private static boolean testPhyloXMLparsingOfDistributionElement() {
10113 final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
10114 PhyloXmlParser xml_parser = null;
10116 xml_parser = PhyloXmlParser.createPhyloXmlParserXsdValidating();
10118 catch ( final Exception e ) {
10119 // Do nothing -- means were not running from jar.
10121 if ( xml_parser == null ) {
10122 xml_parser = PhyloXmlParser.createPhyloXmlParser();
10123 if ( USE_LOCAL_PHYLOXML_SCHEMA ) {
10124 xml_parser.setValidateAgainstSchema( PHYLOXML_LOCAL_XSD );
10127 xml_parser.setValidateAgainstSchema( PHYLOXML_REMOTE_XSD );
10130 final Phylogeny[] phylogenies_0 = factory.create( new File( Test.PATH_TO_TEST_DATA + "phyloxml_distribution.xml" ),
10132 if ( xml_parser.getErrorCount() > 0 ) {
10133 System.out.println( xml_parser.getErrorMessages().toString() );
10136 if ( phylogenies_0.length != 1 ) {
10139 final Phylogeny t1 = phylogenies_0[ 0 ];
10140 PhylogenyNode n = null;
10141 Distribution d = null;
10142 n = t1.getNode( "root node" );
10143 if ( !n.getNodeData().isHasDistribution() ) {
10146 if ( n.getNodeData().getDistributions().size() != 1 ) {
10149 d = n.getNodeData().getDistribution();
10150 if ( !d.getDesc().equals( "Hirschweg 38" ) ) {
10153 if ( d.getPoints().size() != 1 ) {
10156 if ( d.getPolygons() != null ) {
10159 if ( !d.getPoints().get( 0 ).getAltitude().toString().equals( "472" ) ) {
10162 if ( !d.getPoints().get( 0 ).getAltiudeUnit().equals( "m" ) ) {
10165 if ( !d.getPoints().get( 0 ).getGeodeticDatum().equals( "WGS84" ) ) {
10168 if ( !d.getPoints().get( 0 ).getLatitude().toString().equals( "47.48148427110029" ) ) {
10171 if ( !d.getPoints().get( 0 ).getLongitude().toString().equals( "8.768951296806335" ) ) {
10174 n = t1.getNode( "node a" );
10175 if ( !n.getNodeData().isHasDistribution() ) {
10178 if ( n.getNodeData().getDistributions().size() != 2 ) {
10181 d = n.getNodeData().getDistribution( 1 );
10182 if ( !d.getDesc().equals( "San Diego" ) ) {
10185 if ( d.getPoints().size() != 1 ) {
10188 if ( d.getPolygons() != null ) {
10191 if ( !d.getPoints().get( 0 ).getAltitude().toString().equals( "104" ) ) {
10194 if ( !d.getPoints().get( 0 ).getAltiudeUnit().equals( "m" ) ) {
10197 if ( !d.getPoints().get( 0 ).getGeodeticDatum().equals( "WGS84" ) ) {
10200 if ( !d.getPoints().get( 0 ).getLatitude().toString().equals( "32.880933" ) ) {
10203 if ( !d.getPoints().get( 0 ).getLongitude().toString().equals( "-117.217543" ) ) {
10206 n = t1.getNode( "node bb" );
10207 if ( !n.getNodeData().isHasDistribution() ) {
10210 if ( n.getNodeData().getDistributions().size() != 1 ) {
10213 d = n.getNodeData().getDistribution( 0 );
10214 if ( d.getPoints().size() != 3 ) {
10217 if ( d.getPolygons().size() != 2 ) {
10220 if ( !d.getPoints().get( 0 ).getLatitude().toString().equals( "1" ) ) {
10223 if ( !d.getPoints().get( 0 ).getLongitude().toString().equals( "2" ) ) {
10226 if ( !d.getPoints().get( 1 ).getLatitude().toString().equals( "3" ) ) {
10229 if ( !d.getPoints().get( 1 ).getLongitude().toString().equals( "4" ) ) {
10232 if ( !d.getPoints().get( 2 ).getLatitude().toString().equals( "5" ) ) {
10235 if ( !d.getPoints().get( 2 ).getLongitude().toString().equals( "6" ) ) {
10238 Polygon p = d.getPolygons().get( 0 );
10239 if ( p.getPoints().size() != 3 ) {
10242 if ( !p.getPoints().get( 0 ).getLatitude().toString().equals( "0.1" ) ) {
10245 if ( !p.getPoints().get( 0 ).getLongitude().toString().equals( "0.2" ) ) {
10248 if ( !p.getPoints().get( 0 ).getAltitude().toString().equals( "10" ) ) {
10251 if ( !p.getPoints().get( 2 ).getLatitude().toString().equals( "0.5" ) ) {
10254 if ( !p.getPoints().get( 2 ).getLongitude().toString().equals( "0.6" ) ) {
10257 if ( !p.getPoints().get( 2 ).getAltitude().toString().equals( "30" ) ) {
10260 p = d.getPolygons().get( 1 );
10261 if ( p.getPoints().size() != 3 ) {
10264 if ( !p.getPoints().get( 0 ).getLatitude().toString().equals( "1.49348902489947473" ) ) {
10267 if ( !p.getPoints().get( 0 ).getLongitude().toString().equals( "2.567489393947847492" ) ) {
10270 if ( !p.getPoints().get( 0 ).getAltitude().toString().equals( "10" ) ) {
10274 final StringBuffer t1_sb = new StringBuffer( t1.toPhyloXML( 0 ) );
10275 final Phylogeny[] rt = factory.create( t1_sb, xml_parser );
10276 if ( rt.length != 1 ) {
10279 final Phylogeny t1_rt = rt[ 0 ];
10280 n = t1_rt.getNode( "root node" );
10281 if ( !n.getNodeData().isHasDistribution() ) {
10284 if ( n.getNodeData().getDistributions().size() != 1 ) {
10287 d = n.getNodeData().getDistribution();
10288 if ( !d.getDesc().equals( "Hirschweg 38" ) ) {
10291 if ( d.getPoints().size() != 1 ) {
10294 if ( d.getPolygons() != null ) {
10297 if ( !d.getPoints().get( 0 ).getAltitude().toString().equals( "472" ) ) {
10300 if ( !d.getPoints().get( 0 ).getAltiudeUnit().equals( "m" ) ) {
10303 if ( !d.getPoints().get( 0 ).getGeodeticDatum().equals( "WGS84" ) ) {
10306 if ( !d.getPoints().get( 0 ).getLatitude().toString().equals( "47.48148427110029" ) ) {
10309 if ( !d.getPoints().get( 0 ).getLongitude().toString().equals( "8.768951296806335" ) ) {
10312 n = t1_rt.getNode( "node a" );
10313 if ( !n.getNodeData().isHasDistribution() ) {
10316 if ( n.getNodeData().getDistributions().size() != 2 ) {
10319 d = n.getNodeData().getDistribution( 1 );
10320 if ( !d.getDesc().equals( "San Diego" ) ) {
10323 if ( d.getPoints().size() != 1 ) {
10326 if ( d.getPolygons() != null ) {
10329 if ( !d.getPoints().get( 0 ).getAltitude().toString().equals( "104" ) ) {
10332 if ( !d.getPoints().get( 0 ).getAltiudeUnit().equals( "m" ) ) {
10335 if ( !d.getPoints().get( 0 ).getGeodeticDatum().equals( "WGS84" ) ) {
10338 if ( !d.getPoints().get( 0 ).getLatitude().toString().equals( "32.880933" ) ) {
10341 if ( !d.getPoints().get( 0 ).getLongitude().toString().equals( "-117.217543" ) ) {
10344 n = t1_rt.getNode( "node bb" );
10345 if ( !n.getNodeData().isHasDistribution() ) {
10348 if ( n.getNodeData().getDistributions().size() != 1 ) {
10351 d = n.getNodeData().getDistribution( 0 );
10352 if ( d.getPoints().size() != 3 ) {
10355 if ( d.getPolygons().size() != 2 ) {
10358 if ( !d.getPoints().get( 0 ).getLatitude().toString().equals( "1" ) ) {
10361 if ( !d.getPoints().get( 0 ).getLongitude().toString().equals( "2" ) ) {
10364 if ( !d.getPoints().get( 1 ).getLatitude().toString().equals( "3" ) ) {
10367 if ( !d.getPoints().get( 1 ).getLongitude().toString().equals( "4" ) ) {
10370 if ( !d.getPoints().get( 2 ).getLatitude().toString().equals( "5" ) ) {
10373 if ( !d.getPoints().get( 2 ).getLongitude().toString().equals( "6" ) ) {
10376 p = d.getPolygons().get( 0 );
10377 if ( p.getPoints().size() != 3 ) {
10380 if ( !p.getPoints().get( 0 ).getLatitude().toString().equals( "0.1" ) ) {
10383 if ( !p.getPoints().get( 0 ).getLongitude().toString().equals( "0.2" ) ) {
10386 if ( !p.getPoints().get( 0 ).getAltitude().toString().equals( "10" ) ) {
10389 if ( !p.getPoints().get( 2 ).getLatitude().toString().equals( "0.5" ) ) {
10392 if ( !p.getPoints().get( 2 ).getLongitude().toString().equals( "0.6" ) ) {
10395 if ( !p.getPoints().get( 2 ).getAltitude().toString().equals( "30" ) ) {
10398 p = d.getPolygons().get( 1 );
10399 if ( p.getPoints().size() != 3 ) {
10402 if ( !p.getPoints().get( 0 ).getLatitude().toString().equals( "1.49348902489947473" ) ) {
10405 if ( !p.getPoints().get( 0 ).getLongitude().toString().equals( "2.567489393947847492" ) ) {
10408 if ( !p.getPoints().get( 0 ).getAltitude().toString().equals( "10" ) ) {
10412 catch ( final Exception e ) {
10413 e.printStackTrace( System.out );
10419 private static boolean testPostOrderIterator() {
10421 final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
10422 final Phylogeny t0 = factory.create( "((A,B)ab,(C,D)cd)r", new NHXParser() )[ 0 ];
10423 PhylogenyNodeIterator it0;
10424 for( it0 = t0.iteratorPostorder(); it0.hasNext(); ) {
10427 for( it0.reset(); it0.hasNext(); ) {
10430 final Phylogeny t1 = factory.create( "(((A,B)ab,(C,D)cd)abcd,((E,F)ef,(G,H)gh)efgh)r", new NHXParser() )[ 0 ];
10431 final PhylogenyNodeIterator it = t1.iteratorPostorder();
10432 if ( !it.next().getName().equals( "A" ) ) {
10435 if ( !it.next().getName().equals( "B" ) ) {
10438 if ( !it.next().getName().equals( "ab" ) ) {
10441 if ( !it.next().getName().equals( "C" ) ) {
10444 if ( !it.next().getName().equals( "D" ) ) {
10447 if ( !it.next().getName().equals( "cd" ) ) {
10450 if ( !it.next().getName().equals( "abcd" ) ) {
10453 if ( !it.next().getName().equals( "E" ) ) {
10456 if ( !it.next().getName().equals( "F" ) ) {
10459 if ( !it.next().getName().equals( "ef" ) ) {
10462 if ( !it.next().getName().equals( "G" ) ) {
10465 if ( !it.next().getName().equals( "H" ) ) {
10468 if ( !it.next().getName().equals( "gh" ) ) {
10471 if ( !it.next().getName().equals( "efgh" ) ) {
10474 if ( !it.next().getName().equals( "r" ) ) {
10477 if ( it.hasNext() ) {
10481 catch ( final Exception e ) {
10482 e.printStackTrace( System.out );
10488 private static boolean testPreOrderIterator() {
10490 final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
10491 final Phylogeny t0 = factory.create( "((A,B)ab,(C,D)cd)r", new NHXParser() )[ 0 ];
10492 PhylogenyNodeIterator it0;
10493 for( it0 = t0.iteratorPreorder(); it0.hasNext(); ) {
10496 for( it0.reset(); it0.hasNext(); ) {
10499 PhylogenyNodeIterator it = t0.iteratorPreorder();
10500 if ( !it.next().getName().equals( "r" ) ) {
10503 if ( !it.next().getName().equals( "ab" ) ) {
10506 if ( !it.next().getName().equals( "A" ) ) {
10509 if ( !it.next().getName().equals( "B" ) ) {
10512 if ( !it.next().getName().equals( "cd" ) ) {
10515 if ( !it.next().getName().equals( "C" ) ) {
10518 if ( !it.next().getName().equals( "D" ) ) {
10521 if ( it.hasNext() ) {
10524 final Phylogeny t1 = factory.create( "(((A,B)ab,(C,D)cd)abcd,((E,F)ef,(G,H)gh)efgh)r", new NHXParser() )[ 0 ];
10525 it = t1.iteratorPreorder();
10526 if ( !it.next().getName().equals( "r" ) ) {
10529 if ( !it.next().getName().equals( "abcd" ) ) {
10532 if ( !it.next().getName().equals( "ab" ) ) {
10535 if ( !it.next().getName().equals( "A" ) ) {
10538 if ( !it.next().getName().equals( "B" ) ) {
10541 if ( !it.next().getName().equals( "cd" ) ) {
10544 if ( !it.next().getName().equals( "C" ) ) {
10547 if ( !it.next().getName().equals( "D" ) ) {
10550 if ( !it.next().getName().equals( "efgh" ) ) {
10553 if ( !it.next().getName().equals( "ef" ) ) {
10556 if ( !it.next().getName().equals( "E" ) ) {
10559 if ( !it.next().getName().equals( "F" ) ) {
10562 if ( !it.next().getName().equals( "gh" ) ) {
10565 if ( !it.next().getName().equals( "G" ) ) {
10568 if ( !it.next().getName().equals( "H" ) ) {
10571 if ( it.hasNext() ) {
10575 catch ( final Exception e ) {
10576 e.printStackTrace( System.out );
10582 private static boolean testPropertiesMap() {
10584 final PropertiesMap pm = new PropertiesMap();
10585 final Property p0 = new Property( "dimensions:diameter", "1", "metric:mm", "xsd:decimal", AppliesTo.NODE );
10586 final Property p1 = new Property( "dimensions:length", "2", "metric:mm", "xsd:decimal", AppliesTo.NODE );
10587 final Property p2 = new Property( "something:else",
10589 "improbable:research",
10592 pm.addProperty( p0 );
10593 pm.addProperty( p1 );
10594 pm.addProperty( p2 );
10595 if ( !pm.getProperty( "dimensions:diameter" ).getValue().equals( "1" ) ) {
10598 if ( !pm.getProperty( "dimensions:length" ).getValue().equals( "2" ) ) {
10601 if ( pm.getProperties().size() != 3 ) {
10604 if ( pm.getPropertiesWithGivenReferencePrefix( "dimensions" ).size() != 2 ) {
10607 if ( pm.getPropertiesWithGivenReferencePrefix( "something" ).size() != 1 ) {
10610 if ( pm.getProperties().size() != 3 ) {
10613 pm.removeProperty( "dimensions:diameter" );
10614 if ( pm.getProperties().size() != 2 ) {
10617 if ( pm.getPropertiesWithGivenReferencePrefix( "dimensions" ).size() != 1 ) {
10620 if ( pm.getPropertiesWithGivenReferencePrefix( "something" ).size() != 1 ) {
10624 catch ( final Exception e ) {
10625 e.printStackTrace( System.out );
10631 private static boolean testProteinId() {
10633 final ProteinId id1 = new ProteinId( "a" );
10634 final ProteinId id2 = new ProteinId( "a" );
10635 final ProteinId id3 = new ProteinId( "A" );
10636 final ProteinId id4 = new ProteinId( "b" );
10637 if ( !id1.equals( id1 ) ) {
10640 if ( id1.getId().equals( "x" ) ) {
10643 if ( id1.getId().equals( null ) ) {
10646 if ( !id1.equals( id2 ) ) {
10649 if ( id1.equals( id3 ) ) {
10652 if ( id1.hashCode() != id1.hashCode() ) {
10655 if ( id1.hashCode() != id2.hashCode() ) {
10658 if ( id1.hashCode() == id3.hashCode() ) {
10661 if ( id1.compareTo( id1 ) != 0 ) {
10664 if ( id1.compareTo( id2 ) != 0 ) {
10667 if ( id1.compareTo( id3 ) != 0 ) {
10670 if ( id1.compareTo( id4 ) >= 0 ) {
10673 if ( id4.compareTo( id1 ) <= 0 ) {
10676 if ( !id4.getId().equals( "b" ) ) {
10679 final ProteinId id5 = new ProteinId( " C " );
10680 if ( !id5.getId().equals( "C" ) ) {
10683 if ( id5.equals( id1 ) ) {
10687 catch ( final Exception e ) {
10688 e.printStackTrace( System.out );
10694 private static boolean testReIdMethods() {
10696 final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
10697 final Phylogeny p = factory.create( "((1,2)A,(((X,Y,Z)a,b)3)B,(4,5,6)C)r", new NHXParser() )[ 0 ];
10698 final long count = PhylogenyNode.getNodeCount();
10699 p.levelOrderReID();
10700 if ( p.getNode( "r" ).getId() != count ) {
10703 if ( p.getNode( "A" ).getId() != ( count + 1 ) ) {
10706 if ( p.getNode( "B" ).getId() != ( count + 1 ) ) {
10709 if ( p.getNode( "C" ).getId() != ( count + 1 ) ) {
10712 if ( p.getNode( "1" ).getId() != ( count + 2 ) ) {
10715 if ( p.getNode( "2" ).getId() != ( count + 2 ) ) {
10718 if ( p.getNode( "3" ).getId() != ( count + 2 ) ) {
10721 if ( p.getNode( "4" ).getId() != ( count + 2 ) ) {
10724 if ( p.getNode( "5" ).getId() != ( count + 2 ) ) {
10727 if ( p.getNode( "6" ).getId() != ( count + 2 ) ) {
10730 if ( p.getNode( "a" ).getId() != ( count + 3 ) ) {
10733 if ( p.getNode( "b" ).getId() != ( count + 3 ) ) {
10736 if ( p.getNode( "X" ).getId() != ( count + 4 ) ) {
10739 if ( p.getNode( "Y" ).getId() != ( count + 4 ) ) {
10742 if ( p.getNode( "Z" ).getId() != ( count + 4 ) ) {
10746 catch ( final Exception e ) {
10747 e.printStackTrace( System.out );
10753 private static boolean testRerooting() {
10755 final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
10756 final Phylogeny t1 = factory.create( "((A:1,B:2)AB:1[&&NHX:B=55],(C:3,D:5)CD:3[&&NHX:B=10])ABCD:0.5",
10757 new NHXParser() )[ 0 ];
10758 if ( !t1.isRooted() ) {
10761 t1.reRoot( t1.getNode( "D" ) );
10762 t1.reRoot( t1.getNode( "CD" ) );
10763 t1.reRoot( t1.getNode( "A" ) );
10764 t1.reRoot( t1.getNode( "B" ) );
10765 t1.reRoot( t1.getNode( "AB" ) );
10766 t1.reRoot( t1.getNode( "D" ) );
10767 t1.reRoot( t1.getNode( "C" ) );
10768 t1.reRoot( t1.getNode( "CD" ) );
10769 t1.reRoot( t1.getNode( "A" ) );
10770 t1.reRoot( t1.getNode( "B" ) );
10771 t1.reRoot( t1.getNode( "AB" ) );
10772 t1.reRoot( t1.getNode( "D" ) );
10773 t1.reRoot( t1.getNode( "D" ) );
10774 t1.reRoot( t1.getNode( "C" ) );
10775 t1.reRoot( t1.getNode( "A" ) );
10776 t1.reRoot( t1.getNode( "B" ) );
10777 t1.reRoot( t1.getNode( "AB" ) );
10778 t1.reRoot( t1.getNode( "C" ) );
10779 t1.reRoot( t1.getNode( "D" ) );
10780 t1.reRoot( t1.getNode( "CD" ) );
10781 t1.reRoot( t1.getNode( "D" ) );
10782 t1.reRoot( t1.getNode( "A" ) );
10783 t1.reRoot( t1.getNode( "B" ) );
10784 t1.reRoot( t1.getNode( "AB" ) );
10785 t1.reRoot( t1.getNode( "C" ) );
10786 t1.reRoot( t1.getNode( "D" ) );
10787 t1.reRoot( t1.getNode( "CD" ) );
10788 t1.reRoot( t1.getNode( "D" ) );
10789 if ( !isEqual( t1.getNode( "A" ).getDistanceToParent(), 1 ) ) {
10792 if ( !isEqual( t1.getNode( "B" ).getDistanceToParent(), 2 ) ) {
10795 if ( !isEqual( t1.getNode( "C" ).getDistanceToParent(), 3 ) ) {
10798 if ( !isEqual( t1.getNode( "D" ).getDistanceToParent(), 2.5 ) ) {
10801 if ( !isEqual( t1.getNode( "CD" ).getDistanceToParent(), 2.5 ) ) {
10804 if ( !isEqual( t1.getNode( "AB" ).getDistanceToParent(), 4 ) ) {
10807 final Phylogeny t2 = factory.create( "(((A:1,B:2)AB:10[&&NHX:B=55],C)ABC:3[&&NHX:B=33],D:5)ABCD:0.5",
10808 new NHXParser() )[ 0 ];
10809 t2.reRoot( t2.getNode( "A" ) );
10810 t2.reRoot( t2.getNode( "D" ) );
10811 t2.reRoot( t2.getNode( "ABC" ) );
10812 t2.reRoot( t2.getNode( "A" ) );
10813 t2.reRoot( t2.getNode( "B" ) );
10814 t2.reRoot( t2.getNode( "D" ) );
10815 t2.reRoot( t2.getNode( "C" ) );
10816 t2.reRoot( t2.getNode( "ABC" ) );
10817 t2.reRoot( t2.getNode( "A" ) );
10818 t2.reRoot( t2.getNode( "B" ) );
10819 t2.reRoot( t2.getNode( "AB" ) );
10820 t2.reRoot( t2.getNode( "AB" ) );
10821 t2.reRoot( t2.getNode( "D" ) );
10822 t2.reRoot( t2.getNode( "C" ) );
10823 t2.reRoot( t2.getNode( "B" ) );
10824 t2.reRoot( t2.getNode( "AB" ) );
10825 t2.reRoot( t2.getNode( "D" ) );
10826 t2.reRoot( t2.getNode( "D" ) );
10827 t2.reRoot( t2.getNode( "ABC" ) );
10828 t2.reRoot( t2.getNode( "A" ) );
10829 t2.reRoot( t2.getNode( "B" ) );
10830 t2.reRoot( t2.getNode( "AB" ) );
10831 t2.reRoot( t2.getNode( "D" ) );
10832 t2.reRoot( t2.getNode( "C" ) );
10833 t2.reRoot( t2.getNode( "ABC" ) );
10834 t2.reRoot( t2.getNode( "A" ) );
10835 t2.reRoot( t2.getNode( "B" ) );
10836 t2.reRoot( t2.getNode( "AB" ) );
10837 t2.reRoot( t2.getNode( "D" ) );
10838 t2.reRoot( t2.getNode( "D" ) );
10839 t2.reRoot( t2.getNode( "C" ) );
10840 t2.reRoot( t2.getNode( "A" ) );
10841 t2.reRoot( t2.getNode( "B" ) );
10842 t2.reRoot( t2.getNode( "AB" ) );
10843 t2.reRoot( t2.getNode( "C" ) );
10844 t2.reRoot( t2.getNode( "D" ) );
10845 t2.reRoot( t2.getNode( "ABC" ) );
10846 t2.reRoot( t2.getNode( "D" ) );
10847 t2.reRoot( t2.getNode( "A" ) );
10848 t2.reRoot( t2.getNode( "B" ) );
10849 t2.reRoot( t2.getNode( "AB" ) );
10850 t2.reRoot( t2.getNode( "C" ) );
10851 t2.reRoot( t2.getNode( "D" ) );
10852 t2.reRoot( t2.getNode( "ABC" ) );
10853 t2.reRoot( t2.getNode( "D" ) );
10854 if ( !isEqual( t2.getNode( "AB" ).getBranchData().getConfidence( 0 ).getValue(), 55 ) ) {
10857 if ( !isEqual( t2.getNode( "ABC" ).getBranchData().getConfidence( 0 ).getValue(), 33 ) ) {
10860 t2.reRoot( t2.getNode( "ABC" ) );
10861 if ( !isEqual( t2.getNode( "AB" ).getBranchData().getConfidence( 0 ).getValue(), 55 ) ) {
10864 if ( !isEqual( t2.getNode( "ABC" ).getBranchData().getConfidence( 0 ).getValue(), 33 ) ) {
10867 t2.reRoot( t2.getNode( "AB" ) );
10868 if ( !isEqual( t2.getNode( "AB" ).getBranchData().getConfidence( 0 ).getValue(), 55 ) ) {
10871 if ( !isEqual( t2.getNode( "ABC" ).getBranchData().getConfidence( 0 ).getValue(), 55 ) ) {
10874 if ( !isEqual( t2.getNode( "D" ).getBranchData().getConfidence( 0 ).getValue(), 33 ) ) {
10877 t2.reRoot( t2.getNode( "AB" ) );
10878 if ( !isEqual( t2.getNode( "AB" ).getBranchData().getConfidence( 0 ).getValue(), 55 ) ) {
10881 if ( !isEqual( t2.getNode( "ABC" ).getBranchData().getConfidence( 0 ).getValue(), 55 ) ) {
10884 if ( !isEqual( t2.getNode( "D" ).getBranchData().getConfidence( 0 ).getValue(), 33 ) ) {
10887 t2.reRoot( t2.getNode( "D" ) );
10888 if ( !isEqual( t2.getNode( "AB" ).getBranchData().getConfidence( 0 ).getValue(), 55 ) ) {
10891 if ( !isEqual( t2.getNode( "ABC" ).getBranchData().getConfidence( 0 ).getValue(), 33 ) ) {
10894 t2.reRoot( t2.getNode( "ABC" ) );
10895 if ( !isEqual( t2.getNode( "AB" ).getBranchData().getConfidence( 0 ).getValue(), 55 ) ) {
10898 if ( !isEqual( t2.getNode( "ABC" ).getBranchData().getConfidence( 0 ).getValue(), 33 ) ) {
10901 final Phylogeny t3 = factory.create( "(A[&&NHX:B=10],B[&&NHX:B=20],C[&&NHX:B=30],D[&&NHX:B=40])",
10902 new NHXParser() )[ 0 ];
10903 t3.reRoot( t3.getNode( "B" ) );
10904 if ( t3.getNode( "B" ).getBranchData().getConfidence( 0 ).getValue() != 20 ) {
10907 if ( t3.getNode( "A" ).getParent().getBranchData().getConfidence( 0 ).getValue() != 20 ) {
10910 if ( t3.getNode( "A" ).getParent().getNumberOfDescendants() != 3 ) {
10913 t3.reRoot( t3.getNode( "B" ) );
10914 if ( t3.getNode( "B" ).getBranchData().getConfidence( 0 ).getValue() != 20 ) {
10917 if ( t3.getNode( "A" ).getParent().getBranchData().getConfidence( 0 ).getValue() != 20 ) {
10920 if ( t3.getNode( "A" ).getParent().getNumberOfDescendants() != 3 ) {
10923 t3.reRoot( t3.getRoot() );
10924 if ( t3.getNode( "B" ).getBranchData().getConfidence( 0 ).getValue() != 20 ) {
10927 if ( t3.getNode( "A" ).getParent().getBranchData().getConfidence( 0 ).getValue() != 20 ) {
10930 if ( t3.getNode( "A" ).getParent().getNumberOfDescendants() != 3 ) {
10934 catch ( final Exception e ) {
10935 e.printStackTrace( System.out );
10941 private static boolean testSDIse() {
10943 final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
10944 final Phylogeny species1 = factory.create( "[&&NHX:S=yeast]", new NHXParser() )[ 0 ];
10945 final Phylogeny gene1 = factory.create( "(A1[&&NHX:S=yeast],A2[&&NHX:S=yeast])", new NHXParser() )[ 0 ];
10946 gene1.setRooted( true );
10947 species1.setRooted( true );
10948 final SDI sdi = new SDI( gene1, species1 );
10949 if ( !gene1.getRoot().isDuplication() ) {
10952 final Phylogeny species2 = factory
10953 .create( "(((([&&NHX:S=A],[&&NHX:S=B]),[&&NHX:S=C]),[&&NHX:S=D]),([&&NHX:S=E],[&&NHX:S=F]))",
10954 new NHXParser() )[ 0 ];
10955 final Phylogeny gene2 = factory
10956 .create( "(((([&&NHX:S=A],[&&NHX:S=B])ab,[&&NHX:S=C])abc,[&&NHX:S=D])abcd,([&&NHX:S=E],[&&NHX:S=F])ef)r",
10957 new NHXParser() )[ 0 ];
10958 species2.setRooted( true );
10959 gene2.setRooted( true );
10960 final SDI sdi2 = new SDI( gene2, species2 );
10961 if ( sdi2.getDuplicationsSum() != 0 ) {
10964 if ( !gene2.getNode( "ab" ).isSpeciation() ) {
10967 if ( !gene2.getNode( "ab" ).isHasAssignedEvent() ) {
10970 if ( !gene2.getNode( "abc" ).isSpeciation() ) {
10973 if ( !gene2.getNode( "abc" ).isHasAssignedEvent() ) {
10976 if ( !gene2.getNode( "r" ).isSpeciation() ) {
10979 if ( !gene2.getNode( "r" ).isHasAssignedEvent() ) {
10982 final Phylogeny species3 = factory
10983 .create( "(((([&&NHX:S=A],[&&NHX:S=B]),[&&NHX:S=C]),[&&NHX:S=D]),([&&NHX:S=E],[&&NHX:S=F]))",
10984 new NHXParser() )[ 0 ];
10985 final Phylogeny gene3 = factory
10986 .create( "(((([&&NHX:S=A],[&&NHX:S=A])aa,[&&NHX:S=C])abc,[&&NHX:S=D])abcd,([&&NHX:S=E],[&&NHX:S=F])ef)r",
10987 new NHXParser() )[ 0 ];
10988 species3.setRooted( true );
10989 gene3.setRooted( true );
10990 final SDI sdi3 = new SDI( gene3, species3 );
10991 if ( sdi3.getDuplicationsSum() != 1 ) {
10994 if ( !gene3.getNode( "aa" ).isDuplication() ) {
10997 if ( !gene3.getNode( "aa" ).isHasAssignedEvent() ) {
11000 final Phylogeny species4 = factory
11001 .create( "(((([&&NHX:S=A],[&&NHX:S=B]),[&&NHX:S=C]),[&&NHX:S=D]),([&&NHX:S=E],[&&NHX:S=F]))",
11002 new NHXParser() )[ 0 ];
11003 final Phylogeny gene4 = factory
11004 .create( "(((([&&NHX:S=A],[&&NHX:S=C])ac,[&&NHX:S=B])abc,[&&NHX:S=D])abcd,([&&NHX:S=E],[&&NHX:S=F])ef)r",
11005 new NHXParser() )[ 0 ];
11006 species4.setRooted( true );
11007 gene4.setRooted( true );
11008 final SDI sdi4 = new SDI( gene4, species4 );
11009 if ( sdi4.getDuplicationsSum() != 1 ) {
11012 if ( !gene4.getNode( "ac" ).isSpeciation() ) {
11015 if ( !gene4.getNode( "abc" ).isDuplication() ) {
11018 if ( gene4.getNode( "abcd" ).isDuplication() ) {
11021 if ( species4.getNumberOfExternalNodes() != 6 ) {
11024 if ( gene4.getNumberOfExternalNodes() != 6 ) {
11027 final Phylogeny species5 = factory
11028 .create( "(((([&&NHX:S=A],[&&NHX:S=B]),[&&NHX:S=C]),[&&NHX:S=D]),([&&NHX:S=E],[&&NHX:S=F]))",
11029 new NHXParser() )[ 0 ];
11030 final Phylogeny gene5 = factory
11031 .create( "(((([&&NHX:S=A],[&&NHX:S=D])ad,[&&NHX:S=C])adc,[&&NHX:S=B])abcd,([&&NHX:S=E],[&&NHX:S=F])ef)r",
11032 new NHXParser() )[ 0 ];
11033 species5.setRooted( true );
11034 gene5.setRooted( true );
11035 final SDI sdi5 = new SDI( gene5, species5 );
11036 if ( sdi5.getDuplicationsSum() != 2 ) {
11039 if ( !gene5.getNode( "ad" ).isSpeciation() ) {
11042 if ( !gene5.getNode( "adc" ).isDuplication() ) {
11045 if ( !gene5.getNode( "abcd" ).isDuplication() ) {
11048 if ( species5.getNumberOfExternalNodes() != 6 ) {
11051 if ( gene5.getNumberOfExternalNodes() != 6 ) {
11054 // Trees from Louxin Zhang 1997 "On a Mirkin-Muchnik-Smith
11055 // Conjecture for Comparing Molecular Phylogenies"
11056 // J. of Comput Bio. Vol. 4, No 2, pp.177-187
11057 final Phylogeny species6 = factory
11058 .create( "(((1:[&&NHX:S=1],5:[&&NHX:S=5])1-5,((4:[&&NHX:S=4],6:[&&NHX:S=6])4-6,2:[&&NHX:S=2])4-6-2)1-5-4-6-2,"
11059 + "((9:[&&NHX:S=9],3:[&&NHX:S=3])9-3,(8:[&&NHX:S=8],7:[&&NHX:S=7])8-7)9-3-8-7)",
11060 new NHXParser() )[ 0 ];
11061 final Phylogeny gene6 = factory
11062 .create( "(((1:0.1[&&NHX:S=1],2:0.1[&&NHX:S=2])1-2:0.1,3:0.1[&&NHX:S=3])1-2-3:0.1,"
11063 + "((4:0.1[&&NHX:S=4],(5:0.1[&&NHX:S=5],6:0.1[&&NHX:S=6])5-6:0.1)4-5-6:0.1,"
11064 + "(7:0.1[&&NHX:S=7],(8:0.1[&&NHX:S=8],9:0.1[&&NHX:S=9])8-9:0.1)7-8-9:0.1)4-5-6-7-8-9:0.1)r;",
11065 new NHXParser() )[ 0 ];
11066 species6.setRooted( true );
11067 gene6.setRooted( true );
11068 final SDI sdi6 = new SDI( gene6, species6 );
11069 if ( sdi6.getDuplicationsSum() != 3 ) {
11072 if ( !gene6.getNode( "r" ).isDuplication() ) {
11075 if ( !gene6.getNode( "4-5-6" ).isDuplication() ) {
11078 if ( !gene6.getNode( "7-8-9" ).isDuplication() ) {
11081 if ( !gene6.getNode( "1-2" ).isSpeciation() ) {
11084 if ( !gene6.getNode( "1-2-3" ).isSpeciation() ) {
11087 if ( !gene6.getNode( "5-6" ).isSpeciation() ) {
11090 if ( !gene6.getNode( "8-9" ).isSpeciation() ) {
11093 if ( !gene6.getNode( "4-5-6-7-8-9" ).isSpeciation() ) {
11096 sdi6.computeMappingCostL();
11097 if ( sdi6.computeMappingCostL() != 17 ) {
11100 if ( species6.getNumberOfExternalNodes() != 9 ) {
11103 if ( gene6.getNumberOfExternalNodes() != 9 ) {
11106 final Phylogeny species7 = Test.createPhylogeny( "(((((((" + "([&&NHX:S=a1],[&&NHX:S=a2]),"
11107 + "([&&NHX:S=b1],[&&NHX:S=b2])" + "),[&&NHX:S=x]),(" + "([&&NHX:S=m1],[&&NHX:S=m2]),"
11108 + "([&&NHX:S=n1],[&&NHX:S=n2])" + ")),(" + "([&&NHX:S=i1],[&&NHX:S=i2]),"
11109 + "([&&NHX:S=j1],[&&NHX:S=j2])" + ")),(" + "([&&NHX:S=e1],[&&NHX:S=e2]),"
11110 + "([&&NHX:S=f1],[&&NHX:S=f2])" + ")),[&&NHX:S=y]),[&&NHX:S=z])" );
11111 species7.setRooted( true );
11112 final Phylogeny gene7_1 = Test
11113 .createPhylogeny( "((((((((a1[&&NHX:S=a1],a2[&&NHX:S=a2]),b1[&&NHX:S=b1]),x[&&NHX:S=x]),m1[&&NHX:S=m1]),i1[&&NHX:S=i1]),e1[&&NHX:S=e1]),y[&&NHX:S=y]),z[&&NHX:S=z])" );
11114 gene7_1.setRooted( true );
11115 final SDI sdi7 = new SDI( gene7_1, species7 );
11116 if ( sdi7.getDuplicationsSum() != 0 ) {
11119 if ( !Test.getEvent( gene7_1, "a1", "a2" ).isSpeciation() ) {
11122 if ( !Test.getEvent( gene7_1, "a1", "b1" ).isSpeciation() ) {
11125 if ( !Test.getEvent( gene7_1, "a1", "x" ).isSpeciation() ) {
11128 if ( !Test.getEvent( gene7_1, "a1", "m1" ).isSpeciation() ) {
11131 if ( !Test.getEvent( gene7_1, "a1", "i1" ).isSpeciation() ) {
11134 if ( !Test.getEvent( gene7_1, "a1", "e1" ).isSpeciation() ) {
11137 if ( !Test.getEvent( gene7_1, "a1", "y" ).isSpeciation() ) {
11140 if ( !Test.getEvent( gene7_1, "a1", "z" ).isSpeciation() ) {
11143 final Phylogeny gene7_2 = Test
11144 .createPhylogeny( "(((((((((a1[&&NHX:S=a1],a2[&&NHX:S=a2]),b1[&&NHX:S=b1]),x[&&NHX:S=x]),m1[&&NHX:S=m1]),i1[&&NHX:S=i1]),j2[&&NHX:S=j2]),e1[&&NHX:S=e1]),y[&&NHX:S=y]),z[&&NHX:S=z])" );
11145 gene7_2.setRooted( true );
11146 final SDI sdi7_2 = new SDI( gene7_2, species7 );
11147 if ( sdi7_2.getDuplicationsSum() != 1 ) {
11150 if ( !Test.getEvent( gene7_2, "a1", "a2" ).isSpeciation() ) {
11153 if ( !Test.getEvent( gene7_2, "a1", "b1" ).isSpeciation() ) {
11156 if ( !Test.getEvent( gene7_2, "a1", "x" ).isSpeciation() ) {
11159 if ( !Test.getEvent( gene7_2, "a1", "m1" ).isSpeciation() ) {
11162 if ( !Test.getEvent( gene7_2, "a1", "i1" ).isSpeciation() ) {
11165 if ( !Test.getEvent( gene7_2, "a1", "j2" ).isDuplication() ) {
11168 if ( !Test.getEvent( gene7_2, "a1", "e1" ).isSpeciation() ) {
11171 if ( !Test.getEvent( gene7_2, "a1", "y" ).isSpeciation() ) {
11174 if ( !Test.getEvent( gene7_2, "a1", "z" ).isSpeciation() ) {
11178 catch ( final Exception e ) {
11184 private static boolean testSDIunrooted() {
11186 final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
11187 final Phylogeny p0 = factory.create( "((((A,B)ab,(C1,C2)cc)abc,D)abcd,(E,F)ef)abcdef", new NHXParser() )[ 0 ];
11188 final List<PhylogenyBranch> l = SDIR.getBranchesInPreorder( p0 );
11189 final Iterator<PhylogenyBranch> iter = l.iterator();
11190 PhylogenyBranch br = iter.next();
11191 if ( !br.getFirstNode().getName().equals( "abcd" ) && !br.getFirstNode().getName().equals( "ef" ) ) {
11194 if ( !br.getSecondNode().getName().equals( "abcd" ) && !br.getSecondNode().getName().equals( "ef" ) ) {
11198 if ( !br.getFirstNode().getName().equals( "abcd" ) && !br.getFirstNode().getName().equals( "abc" ) ) {
11201 if ( !br.getSecondNode().getName().equals( "abcd" ) && !br.getSecondNode().getName().equals( "abc" ) ) {
11205 if ( !br.getFirstNode().getName().equals( "abc" ) && !br.getFirstNode().getName().equals( "ab" ) ) {
11208 if ( !br.getSecondNode().getName().equals( "abc" ) && !br.getSecondNode().getName().equals( "ab" ) ) {
11212 if ( !br.getFirstNode().getName().equals( "ab" ) && !br.getFirstNode().getName().equals( "A" ) ) {
11215 if ( !br.getSecondNode().getName().equals( "ab" ) && !br.getSecondNode().getName().equals( "A" ) ) {
11219 if ( !br.getFirstNode().getName().equals( "ab" ) && !br.getFirstNode().getName().equals( "B" ) ) {
11222 if ( !br.getSecondNode().getName().equals( "ab" ) && !br.getSecondNode().getName().equals( "B" ) ) {
11226 if ( !br.getFirstNode().getName().equals( "ab" ) && !br.getFirstNode().getName().equals( "abc" ) ) {
11229 if ( !br.getSecondNode().getName().equals( "ab" ) && !br.getSecondNode().getName().equals( "abc" ) ) {
11233 if ( !br.getFirstNode().getName().equals( "abc" ) && !br.getFirstNode().getName().equals( "cc" ) ) {
11236 if ( !br.getSecondNode().getName().equals( "abc" ) && !br.getSecondNode().getName().equals( "cc" ) ) {
11240 if ( !br.getFirstNode().getName().equals( "C1" ) && !br.getFirstNode().getName().equals( "cc" ) ) {
11243 if ( !br.getSecondNode().getName().equals( "C1" ) && !br.getSecondNode().getName().equals( "cc" ) ) {
11247 if ( !br.getFirstNode().getName().equals( "C2" ) && !br.getFirstNode().getName().equals( "cc" ) ) {
11250 if ( !br.getSecondNode().getName().equals( "C2" ) && !br.getSecondNode().getName().equals( "cc" ) ) {
11254 if ( !br.getFirstNode().getName().equals( "abc" ) && !br.getFirstNode().getName().equals( "cc" ) ) {
11257 if ( !br.getSecondNode().getName().equals( "abc" ) && !br.getSecondNode().getName().equals( "cc" ) ) {
11261 if ( !br.getFirstNode().getName().equals( "abc" ) && !br.getFirstNode().getName().equals( "abcd" ) ) {
11264 if ( !br.getSecondNode().getName().equals( "abc" ) && !br.getSecondNode().getName().equals( "abcd" ) ) {
11268 if ( !br.getFirstNode().getName().equals( "abcd" ) && !br.getFirstNode().getName().equals( "D" ) ) {
11271 if ( !br.getSecondNode().getName().equals( "abcd" ) && !br.getSecondNode().getName().equals( "D" ) ) {
11275 if ( !br.getFirstNode().getName().equals( "ef" ) && !br.getFirstNode().getName().equals( "abcd" ) ) {
11278 if ( !br.getSecondNode().getName().equals( "ef" ) && !br.getSecondNode().getName().equals( "abcd" ) ) {
11282 if ( !br.getFirstNode().getName().equals( "ef" ) && !br.getFirstNode().getName().equals( "E" ) ) {
11285 if ( !br.getSecondNode().getName().equals( "ef" ) && !br.getSecondNode().getName().equals( "E" ) ) {
11289 if ( !br.getFirstNode().getName().equals( "ef" ) && !br.getFirstNode().getName().equals( "F" ) ) {
11292 if ( !br.getSecondNode().getName().equals( "ef" ) && !br.getSecondNode().getName().equals( "F" ) ) {
11295 if ( iter.hasNext() ) {
11298 final Phylogeny p1 = factory.create( "(C,(A,B)ab)abc", new NHXParser() )[ 0 ];
11299 final List<PhylogenyBranch> l1 = SDIR.getBranchesInPreorder( p1 );
11300 final Iterator<PhylogenyBranch> iter1 = l1.iterator();
11302 if ( !br.getFirstNode().getName().equals( "ab" ) && !br.getFirstNode().getName().equals( "C" ) ) {
11305 if ( !br.getSecondNode().getName().equals( "ab" ) && !br.getSecondNode().getName().equals( "C" ) ) {
11309 if ( !br.getFirstNode().getName().equals( "ab" ) && !br.getFirstNode().getName().equals( "A" ) ) {
11312 if ( !br.getSecondNode().getName().equals( "ab" ) && !br.getSecondNode().getName().equals( "A" ) ) {
11316 if ( !br.getFirstNode().getName().equals( "ab" ) && !br.getFirstNode().getName().equals( "B" ) ) {
11319 if ( !br.getSecondNode().getName().equals( "ab" ) && !br.getSecondNode().getName().equals( "B" ) ) {
11322 if ( iter1.hasNext() ) {
11325 final Phylogeny p2 = factory.create( "((A,B)ab,C)abc", new NHXParser() )[ 0 ];
11326 final List<PhylogenyBranch> l2 = SDIR.getBranchesInPreorder( p2 );
11327 final Iterator<PhylogenyBranch> iter2 = l2.iterator();
11329 if ( !br.getFirstNode().getName().equals( "ab" ) && !br.getFirstNode().getName().equals( "C" ) ) {
11332 if ( !br.getSecondNode().getName().equals( "ab" ) && !br.getSecondNode().getName().equals( "C" ) ) {
11336 if ( !br.getFirstNode().getName().equals( "ab" ) && !br.getFirstNode().getName().equals( "A" ) ) {
11339 if ( !br.getSecondNode().getName().equals( "ab" ) && !br.getSecondNode().getName().equals( "A" ) ) {
11343 if ( !br.getFirstNode().getName().equals( "ab" ) && !br.getFirstNode().getName().equals( "B" ) ) {
11346 if ( !br.getSecondNode().getName().equals( "ab" ) && !br.getSecondNode().getName().equals( "B" ) ) {
11349 if ( iter2.hasNext() ) {
11352 final Phylogeny species0 = factory
11353 .create( "(((([&&NHX:S=A],[&&NHX:S=B]),[&&NHX:S=C]),[&&NHX:S=D]),([&&NHX:S=E],[&&NHX:S=F]))",
11354 new NHXParser() )[ 0 ];
11355 final Phylogeny gene1 = factory
11356 .create( "(((((A:0.6[&&NHX:S=A],B:0.1[&&NHX:S=B])ab:0.1,C:0.1[&&NHX:S=C])abc:0.3,D:1.0[&&NHX:S=D])abcd:0.2,E:0.1[&&NHX:S=E])abcde:0.2,F:0.2[&&NHX:S=F])",
11357 new NHXParser() )[ 0 ];
11358 species0.setRooted( true );
11359 gene1.setRooted( true );
11360 final SDIR sdi_unrooted = new SDIR();
11361 sdi_unrooted.infer( gene1, species0, false, true, true, true, 10 );
11362 if ( sdi_unrooted.getCount() != 1 ) {
11365 if ( sdi_unrooted.getMinimalDuplications() != 0 ) {
11368 if ( !Test.isEqual( sdi_unrooted.getMinimalDiffInSubTreeHeights(), 0.4 ) ) {
11371 if ( !Test.isEqual( sdi_unrooted.getMinimalTreeHeight(), 1.0 ) ) {
11374 if ( sdi_unrooted.getMinimalMappingCost() != Integer.MAX_VALUE ) {
11377 final Phylogeny gene2 = factory
11378 .create( "(((((A:2.6[&&NHX:S=A],B:0.1[&&NHX:S=B])ab:0.1,C:0.1[&&NHX:S=C])abc:0.3,D:1.0[&&NHX:S=D])abcd:0.2,E:0.1[&&NHX:S=E])abcde:0.2,F:0.2[&&NHX:S=F])",
11379 new NHXParser() )[ 0 ];
11380 gene2.setRooted( true );
11381 sdi_unrooted.infer( gene2, species0, false, false, true, true, 10 );
11382 if ( sdi_unrooted.getCount() != 1 ) {
11385 if ( sdi_unrooted.getMinimalDuplications() != 3 ) {
11388 if ( !Test.isEqual( sdi_unrooted.getMinimalDiffInSubTreeHeights(), 0.0 ) ) {
11391 if ( !Test.isEqual( sdi_unrooted.getMinimalTreeHeight(), 2.0 ) ) {
11394 if ( sdi_unrooted.getMinimalMappingCost() != Integer.MAX_VALUE ) {
11397 final Phylogeny species6 = factory
11398 .create( "(((1:[&&NHX:S=1],5:[&&NHX:S=5])1-5,((4:[&&NHX:S=4],6:[&&NHX:S=6])4-6,2:[&&NHX:S=2])4-6-2)1-5-4-6-2,"
11399 + "((9:[&&NHX:S=9],3:[&&NHX:S=3])9-3,(8:[&&NHX:S=8],7:[&&NHX:S=7])8-7)9-3-8-7)",
11400 new NHXParser() )[ 0 ];
11401 final Phylogeny gene6 = factory
11402 .create( "((5:0.1[&&NHX:S=5],6:0.1[&&NHX:S=6])5-6:0.05[&&NHX:S=6],(4:0.1[&&NHX:S=4],"
11403 + "(((1:0.1[&&NHX:S=1],2:0.1[&&NHX:S=2])1-2:0.1[&&NHX:S=2],3:0.25[&&NHX:S=3])1-2-3:0.2[&&NHX:S=2],"
11404 + "(7:0.1[&&NHX:S=7],(8:0.1[&&NHX:S=8],"
11405 + "9:0.1[&&NHX:S=9])8-9:0.1[&&NHX:S=9])7-8-9:0.1[&&NHX:S=8])"
11406 + "4-5-6-7-8-9:0.1[&&NHX:S=5])4-5-6:0.05[&&NHX:S=5])",
11407 new NHXParser() )[ 0 ];
11408 species6.setRooted( true );
11409 gene6.setRooted( true );
11410 Phylogeny[] p6 = sdi_unrooted.infer( gene6, species6, false, true, true, true, 10 );
11411 if ( sdi_unrooted.getCount() != 1 ) {
11414 if ( !Test.isEqual( sdi_unrooted.getMinimalDiffInSubTreeHeights(), 0.0 ) ) {
11417 if ( !Test.isEqual( sdi_unrooted.getMinimalTreeHeight(), 0.375 ) ) {
11420 if ( sdi_unrooted.getMinimalDuplications() != 3 ) {
11423 if ( sdi_unrooted.getMinimalMappingCost() != Integer.MAX_VALUE ) {
11426 if ( !p6[ 0 ].getRoot().isDuplication() ) {
11429 if ( !p6[ 0 ].getNode( "4-5-6" ).isDuplication() ) {
11432 if ( !p6[ 0 ].getNode( "7-8-9" ).isDuplication() ) {
11435 if ( p6[ 0 ].getNode( "1-2" ).isDuplication() ) {
11438 if ( p6[ 0 ].getNode( "1-2-3" ).isDuplication() ) {
11441 if ( p6[ 0 ].getNode( "5-6" ).isDuplication() ) {
11444 if ( p6[ 0 ].getNode( "8-9" ).isDuplication() ) {
11447 if ( p6[ 0 ].getNode( "4-5-6-7-8-9" ).isDuplication() ) {
11451 final Phylogeny species7 = factory
11452 .create( "(((1:[&&NHX:S=1],5:[&&NHX:S=5])1-5,((4:[&&NHX:S=4],6:[&&NHX:S=6])4-6,2:[&&NHX:S=2])4-6-2)1-5-4-6-2,"
11453 + "((9:[&&NHX:S=9],3:[&&NHX:S=3])9-3,(8:[&&NHX:S=8],7:[&&NHX:S=7])8-7)9-3-8-7)",
11454 new NHXParser() )[ 0 ];
11455 final Phylogeny gene7 = factory
11456 .create( "((5:0.1[&&NHX:S=5],6:0.1[&&NHX:S=6])5-6:0.05[&&NHX:S=6],(4:0.1[&&NHX:S=4],"
11457 + "(((1:0.1[&&NHX:S=1],2:0.1[&&NHX:S=2])1-2:0.1[&&NHX:S=2],3:0.25[&&NHX:S=3])1-2-3:0.2[&&NHX:S=2],"
11458 + "(7:0.1[&&NHX:S=7],(8:0.1[&&NHX:S=8],"
11459 + "9:0.1[&&NHX:S=9])8-9:0.1[&&NHX:S=9])7-8-9:0.1[&&NHX:S=8])"
11460 + "4-5-6-7-8-9:0.1[&&NHX:S=5])4-5-6:0.05[&&NHX:S=5])",
11461 new NHXParser() )[ 0 ];
11462 species7.setRooted( true );
11463 gene7.setRooted( true );
11464 Phylogeny[] p7 = sdi_unrooted.infer( gene7, species7, true, true, true, true, 10 );
11465 if ( sdi_unrooted.getCount() != 1 ) {
11468 if ( !Test.isEqual( sdi_unrooted.getMinimalDiffInSubTreeHeights(), 0.0 ) ) {
11471 if ( !Test.isEqual( sdi_unrooted.getMinimalTreeHeight(), 0.375 ) ) {
11474 if ( sdi_unrooted.getMinimalDuplications() != 3 ) {
11477 if ( sdi_unrooted.getMinimalMappingCost() != 17 ) {
11480 if ( !p7[ 0 ].getRoot().isDuplication() ) {
11483 if ( !p7[ 0 ].getNode( "4-5-6" ).isDuplication() ) {
11486 if ( !p7[ 0 ].getNode( "7-8-9" ).isDuplication() ) {
11489 if ( p7[ 0 ].getNode( "1-2" ).isDuplication() ) {
11492 if ( p7[ 0 ].getNode( "1-2-3" ).isDuplication() ) {
11495 if ( p7[ 0 ].getNode( "5-6" ).isDuplication() ) {
11498 if ( p7[ 0 ].getNode( "8-9" ).isDuplication() ) {
11501 if ( p7[ 0 ].getNode( "4-5-6-7-8-9" ).isDuplication() ) {
11505 final Phylogeny species8 = factory
11506 .create( "(((1:[&&NHX:S=1],5:[&&NHX:S=5])1-5,((4:[&&NHX:S=4],6:[&&NHX:S=6])4-6,2:[&&NHX:S=2])4-6-2)1-5-4-6-2,"
11507 + "((9:[&&NHX:S=9],3:[&&NHX:S=3])9-3,(8:[&&NHX:S=8],7:[&&NHX:S=7])8-7)9-3-8-7)",
11508 new NHXParser() )[ 0 ];
11509 final Phylogeny gene8 = factory
11510 .create( "((5:0.1[&&NHX:S=5],6:0.1[&&NHX:S=6])5-6:0.05[&&NHX:S=6],(4:0.1[&&NHX:S=4],"
11511 + "(((1:0.1[&&NHX:S=1],2:0.1[&&NHX:S=2])1-2:0.1[&&NHX:S=2],3:0.25[&&NHX:S=3])1-2-3:0.2[&&NHX:S=2],"
11512 + "(7:0.1[&&NHX:S=7],(8:0.1[&&NHX:S=8],"
11513 + "9:0.1[&&NHX:S=9])8-9:0.1[&&NHX:S=9])7-8-9:0.1[&&NHX:S=8])"
11514 + "4-5-6-7-8-9:0.1[&&NHX:S=5])4-5-6:0.05[&&NHX:S=5])",
11515 new NHXParser() )[ 0 ];
11516 species8.setRooted( true );
11517 gene8.setRooted( true );
11518 Phylogeny[] p8 = sdi_unrooted.infer( gene8, species8, false, false, true, true, 10 );
11519 if ( sdi_unrooted.getCount() != 1 ) {
11522 if ( !Test.isEqual( sdi_unrooted.getMinimalDiffInSubTreeHeights(), 0.0 ) ) {
11525 if ( !Test.isEqual( sdi_unrooted.getMinimalTreeHeight(), 0.375 ) ) {
11528 if ( sdi_unrooted.getMinimalDuplications() != 3 ) {
11531 if ( sdi_unrooted.getMinimalMappingCost() != Integer.MAX_VALUE ) {
11534 if ( !p8[ 0 ].getRoot().isDuplication() ) {
11537 if ( !p8[ 0 ].getNode( "4-5-6" ).isDuplication() ) {
11540 if ( !p8[ 0 ].getNode( "7-8-9" ).isDuplication() ) {
11543 if ( p8[ 0 ].getNode( "1-2" ).isDuplication() ) {
11546 if ( p8[ 0 ].getNode( "1-2-3" ).isDuplication() ) {
11549 if ( p8[ 0 ].getNode( "5-6" ).isDuplication() ) {
11552 if ( p8[ 0 ].getNode( "8-9" ).isDuplication() ) {
11555 if ( p8[ 0 ].getNode( "4-5-6-7-8-9" ).isDuplication() ) {
11560 catch ( final Exception e ) {
11561 e.printStackTrace( System.out );
11567 private static boolean testSequenceDbWsTools1() {
11569 final PhylogenyNode n = new PhylogenyNode();
11570 n.setName( "NP_001025424" );
11571 Accession acc = SequenceDbWsTools.obtainSeqAccession( n );
11572 if ( ( acc == null ) || !acc.getSource().equals( Source.REFSEQ.toString() )
11573 || !acc.getValue().equals( "NP_001025424" ) ) {
11576 n.setName( "340 0559 -- _NP_001025424_dsfdg15 05" );
11577 acc = SequenceDbWsTools.obtainSeqAccession( n );
11578 if ( ( acc == null ) || !acc.getSource().equals( Source.REFSEQ.toString() )
11579 || !acc.getValue().equals( "NP_001025424" ) ) {
11582 n.setName( "NP_001025424.1" );
11583 acc = SequenceDbWsTools.obtainSeqAccession( n );
11584 if ( ( acc == null ) || !acc.getSource().equals( Source.REFSEQ.toString() )
11585 || !acc.getValue().equals( "NP_001025424" ) ) {
11588 n.setName( "NM_001030253" );
11589 acc = SequenceDbWsTools.obtainSeqAccession( n );
11590 if ( ( acc == null ) || !acc.getSource().equals( Source.REFSEQ.toString() )
11591 || !acc.getValue().equals( "NM_001030253" ) ) {
11594 n.setName( "BCL2_HUMAN" );
11595 acc = SequenceDbWsTools.obtainSeqAccession( n );
11596 if ( ( acc == null ) || !acc.getSource().equals( Source.UNIPROT.toString() )
11597 || !acc.getValue().equals( "BCL2_HUMAN" ) ) {
11598 System.out.println( acc.toString() );
11601 n.setName( "P10415" );
11602 acc = SequenceDbWsTools.obtainSeqAccession( n );
11603 if ( ( acc == null ) || !acc.getSource().equals( Source.UNIPROT.toString() )
11604 || !acc.getValue().equals( "P10415" ) ) {
11605 System.out.println( acc.toString() );
11608 n.setName( " P10415 " );
11609 acc = SequenceDbWsTools.obtainSeqAccession( n );
11610 if ( ( acc == null ) || !acc.getSource().equals( Source.UNIPROT.toString() )
11611 || !acc.getValue().equals( "P10415" ) ) {
11612 System.out.println( acc.toString() );
11615 n.setName( "_P10415|" );
11616 acc = SequenceDbWsTools.obtainSeqAccession( n );
11617 if ( ( acc == null ) || !acc.getSource().equals( Source.UNIPROT.toString() )
11618 || !acc.getValue().equals( "P10415" ) ) {
11619 System.out.println( acc.toString() );
11622 n.setName( "AY695820" );
11623 acc = SequenceDbWsTools.obtainSeqAccession( n );
11624 if ( ( acc == null ) || !acc.getSource().equals( Source.NCBI.toString() )
11625 || !acc.getValue().equals( "AY695820" ) ) {
11626 System.out.println( acc.toString() );
11629 n.setName( "_AY695820_" );
11630 acc = SequenceDbWsTools.obtainSeqAccession( n );
11631 if ( ( acc == null ) || !acc.getSource().equals( Source.NCBI.toString() )
11632 || !acc.getValue().equals( "AY695820" ) ) {
11633 System.out.println( acc.toString() );
11636 n.setName( "AAA59452" );
11637 acc = SequenceDbWsTools.obtainSeqAccession( n );
11638 if ( ( acc == null ) || !acc.getSource().equals( Source.NCBI.toString() )
11639 || !acc.getValue().equals( "AAA59452" ) ) {
11640 System.out.println( acc.toString() );
11643 n.setName( "_AAA59452_" );
11644 acc = SequenceDbWsTools.obtainSeqAccession( n );
11645 if ( ( acc == null ) || !acc.getSource().equals( Source.NCBI.toString() )
11646 || !acc.getValue().equals( "AAA59452" ) ) {
11647 System.out.println( acc.toString() );
11650 n.setName( "AAA59452.1" );
11651 acc = SequenceDbWsTools.obtainSeqAccession( n );
11652 if ( ( acc == null ) || !acc.getSource().equals( Source.NCBI.toString() )
11653 || !acc.getValue().equals( "AAA59452.1" ) ) {
11654 System.out.println( acc.toString() );
11657 n.setName( "_AAA59452.1_" );
11658 acc = SequenceDbWsTools.obtainSeqAccession( n );
11659 if ( ( acc == null ) || !acc.getSource().equals( Source.NCBI.toString() )
11660 || !acc.getValue().equals( "AAA59452.1" ) ) {
11661 System.out.println( acc.toString() );
11664 n.setName( "GI:94894583" );
11665 acc = SequenceDbWsTools.obtainSeqAccession( n );
11666 if ( ( acc == null ) || !acc.getSource().equals( Source.GI.toString() )
11667 || !acc.getValue().equals( "94894583" ) ) {
11668 System.out.println( acc.toString() );
11671 n.setName( "gi|71845847|1,4-alpha-glucan branching enzyme [Dechloromonas aromatica RCB]" );
11672 acc = SequenceDbWsTools.obtainSeqAccession( n );
11673 if ( ( acc == null ) || !acc.getSource().equals( Source.GI.toString() )
11674 || !acc.getValue().equals( "71845847" ) ) {
11675 System.out.println( acc.toString() );
11678 n.setName( "gi|71845847|gb|AAZ45343.1| 1,4-alpha-glucan branching enzyme [Dechloromonas aromatica RCB]" );
11679 acc = SequenceDbWsTools.obtainSeqAccession( n );
11680 if ( ( acc == null ) || !acc.getSource().equals( Source.NCBI.toString() )
11681 || !acc.getValue().equals( "AAZ45343.1" ) ) {
11682 System.out.println( acc.toString() );
11686 catch ( final Exception e ) {
11692 private static boolean testSequenceDbWsTools2() {
11694 final PhylogenyNode n1 = new PhylogenyNode( "NP_001025424" );
11695 SequenceDbWsTools.obtainSeqInformation( n1 );
11696 if ( !n1.getNodeData().getSequence().getName().equals( "Bcl2" ) ) {
11699 if ( !n1.getNodeData().getTaxonomy().getScientificName().equals( "Danio rerio" ) ) {
11702 if ( !n1.getNodeData().getSequence().getAccession().getSource().equals( Source.REFSEQ.toString() ) ) {
11705 if ( !n1.getNodeData().getSequence().getAccession().getValue().equals( "NP_001025424" ) ) {
11708 final PhylogenyNode n2 = new PhylogenyNode( "NM_001030253" );
11709 SequenceDbWsTools.obtainSeqInformation( n2 );
11710 if ( !n2.getNodeData().getSequence().getName().equals( "Danio rerio B-cell CLL/lymphoma 2a (bcl2a), mRNA" ) ) {
11713 if ( !n2.getNodeData().getTaxonomy().getScientificName().equals( "Danio rerio" ) ) {
11716 if ( !n2.getNodeData().getSequence().getAccession().getSource().equals( Source.REFSEQ.toString() ) ) {
11719 if ( !n2.getNodeData().getSequence().getAccession().getValue().equals( "NM_001030253" ) ) {
11722 final PhylogenyNode n3 = new PhylogenyNode( "NM_184234.2" );
11723 SequenceDbWsTools.obtainSeqInformation( n3 );
11724 if ( !n3.getNodeData().getSequence().getName()
11725 .equals( "Homo sapiens RNA binding motif protein 39 (RBM39), transcript variant 1, mRNA" ) ) {
11728 if ( !n3.getNodeData().getTaxonomy().getScientificName().equals( "Homo sapiens" ) ) {
11731 if ( !n3.getNodeData().getSequence().getAccession().getSource().equals( Source.REFSEQ.toString() ) ) {
11734 if ( !n3.getNodeData().getSequence().getAccession().getValue().equals( "NM_184234" ) ) {
11738 catch ( final IOException e ) {
11739 System.out.println();
11740 System.out.println( "the following might be due to absence internet connection:" );
11741 e.printStackTrace( System.out );
11744 catch ( final Exception e ) {
11745 e.printStackTrace();
11751 private static boolean testSequenceIdParsing() {
11753 Accession id = SequenceAccessionTools.parseAccessorFromString( "gb_ADF31344_segmented_worms_" );
11754 if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() )
11755 || !id.getValue().equals( "ADF31344" ) || !id.getSource().equals( "ncbi" ) ) {
11756 if ( id != null ) {
11757 System.out.println( "value =" + id.getValue() );
11758 System.out.println( "provider=" + id.getSource() );
11762 id = SequenceAccessionTools.parseAccessorFromString( "segmented worms|gb_ADF31344" );
11763 if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() )
11764 || !id.getValue().equals( "ADF31344" ) || !id.getSource().equals( "ncbi" ) ) {
11765 if ( id != null ) {
11766 System.out.println( "value =" + id.getValue() );
11767 System.out.println( "provider=" + id.getSource() );
11771 id = SequenceAccessionTools.parseAccessorFromString( "segmented worms gb_ADF31344 and more" );
11772 if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() )
11773 || !id.getValue().equals( "ADF31344" ) || !id.getSource().equals( "ncbi" ) ) {
11774 if ( id != null ) {
11775 System.out.println( "value =" + id.getValue() );
11776 System.out.println( "provider=" + id.getSource() );
11780 id = SequenceAccessionTools.parseAccessorFromString( "gb_AAA96518_1" );
11781 if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() )
11782 || !id.getValue().equals( "AAA96518" ) || !id.getSource().equals( "ncbi" ) ) {
11783 if ( id != null ) {
11784 System.out.println( "value =" + id.getValue() );
11785 System.out.println( "provider=" + id.getSource() );
11789 id = SequenceAccessionTools.parseAccessorFromString( "gb_EHB07727_1_rodents_" );
11790 if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() )
11791 || !id.getValue().equals( "EHB07727" ) || !id.getSource().equals( "ncbi" ) ) {
11792 if ( id != null ) {
11793 System.out.println( "value =" + id.getValue() );
11794 System.out.println( "provider=" + id.getSource() );
11798 id = SequenceAccessionTools.parseAccessorFromString( "dbj_BAF37827_1_turtles_" );
11799 if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() )
11800 || !id.getValue().equals( "BAF37827" ) || !id.getSource().equals( "ncbi" ) ) {
11801 if ( id != null ) {
11802 System.out.println( "value =" + id.getValue() );
11803 System.out.println( "provider=" + id.getSource() );
11807 id = SequenceAccessionTools.parseAccessorFromString( "emb_CAA73223_1_primates_" );
11808 if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() )
11809 || !id.getValue().equals( "CAA73223" ) || !id.getSource().equals( "ncbi" ) ) {
11810 if ( id != null ) {
11811 System.out.println( "value =" + id.getValue() );
11812 System.out.println( "provider=" + id.getSource() );
11816 id = SequenceAccessionTools.parseAccessorFromString( "mites|ref_XP_002434188_1" );
11817 if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() )
11818 || !id.getValue().equals( "XP_002434188" ) || !id.getSource().equals( "refseq" ) ) {
11819 if ( id != null ) {
11820 System.out.println( "value =" + id.getValue() );
11821 System.out.println( "provider=" + id.getSource() );
11825 id = SequenceAccessionTools.parseAccessorFromString( "mites_ref_XP_002434188_1_bla_XP_12345" );
11826 if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() )
11827 || !id.getValue().equals( "XP_002434188" ) || !id.getSource().equals( "refseq" ) ) {
11828 if ( id != null ) {
11829 System.out.println( "value =" + id.getValue() );
11830 System.out.println( "provider=" + id.getSource() );
11834 id = SequenceAccessionTools.parseAccessorFromString( "P4A123" );
11835 if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() )
11836 || !id.getValue().equals( "P4A123" ) || !id.getSource().equals( "uniprot" ) ) {
11837 if ( id != null ) {
11838 System.out.println( "value =" + id.getValue() );
11839 System.out.println( "provider=" + id.getSource() );
11843 id = SequenceAccessionTools.parseAccessorFromString( "XP_12345" );
11844 if ( id != null ) {
11845 System.out.println( "value =" + id.getValue() );
11846 System.out.println( "provider=" + id.getSource() );
11849 id = SequenceAccessionTools.parseAccessorFromString( "N3B004Z009" );
11850 if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() )
11851 || !id.getValue().equals( "N3B004Z009" ) || !id.getSource().equals( "uniprot" ) ) {
11852 if ( id != null ) {
11853 System.out.println( "value =" + id.getValue() );
11854 System.out.println( "provider=" + id.getSource() );
11858 id = SequenceAccessionTools.parseAccessorFromString( "A4CAA4ZBB9" );
11859 if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() )
11860 || !id.getValue().equals( "A4CAA4ZBB9" ) || !id.getSource().equals( "uniprot" ) ) {
11861 if ( id != null ) {
11862 System.out.println( "value =" + id.getValue() );
11863 System.out.println( "provider=" + id.getSource() );
11867 id = SequenceAccessionTools.parseAccessorFromString( "ecoli_A4CAA4ZBB9_rt" );
11868 if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() )
11869 || !id.getValue().equals( "A4CAA4ZBB9" ) || !id.getSource().equals( "uniprot" ) ) {
11870 if ( id != null ) {
11871 System.out.println( "value =" + id.getValue() );
11872 System.out.println( "provider=" + id.getSource() );
11876 id = SequenceAccessionTools.parseAccessorFromString( "Q4CAA4ZBB9" );
11877 if ( id != null ) {
11878 System.out.println( "value =" + id.getValue() );
11879 System.out.println( "provider=" + id.getSource() );
11883 catch ( final Exception e ) {
11884 e.printStackTrace( System.out );
11890 private static boolean testSequenceWriter() {
11892 final String n = ForesterUtil.LINE_SEPARATOR;
11893 if ( !SequenceWriter.toFasta( "name", "awes", 5 ).toString().equals( ">name" + n + "awes" ) ) {
11896 if ( !SequenceWriter.toFasta( "name", "awes", 4 ).toString().equals( ">name" + n + "awes" ) ) {
11899 if ( !SequenceWriter.toFasta( "name", "awes", 3 ).toString().equals( ">name" + n + "awe" + n + "s" ) ) {
11902 if ( !SequenceWriter.toFasta( "name", "awes", 2 ).toString().equals( ">name" + n + "aw" + n + "es" ) ) {
11905 if ( !SequenceWriter.toFasta( "name", "awes", 1 ).toString()
11906 .equals( ">name" + n + "a" + n + "w" + n + "e" + n + "s" ) ) {
11909 if ( !SequenceWriter.toFasta( "name", "abcdefghij", 3 ).toString()
11910 .equals( ">name" + n + "abc" + n + "def" + n + "ghi" + n + "j" ) ) {
11914 catch ( final Exception e ) {
11915 e.printStackTrace();
11921 private static boolean testSpecies() {
11923 final Species s1 = new BasicSpecies( "a" );
11924 final Species s2 = new BasicSpecies( "a" );
11925 final Species s3 = new BasicSpecies( "A" );
11926 final Species s4 = new BasicSpecies( "b" );
11927 if ( !s1.equals( s1 ) ) {
11930 if ( s1.getSpeciesId().equals( "x" ) ) {
11933 if ( s1.getSpeciesId().equals( null ) ) {
11936 if ( !s1.equals( s2 ) ) {
11939 if ( s1.equals( s3 ) ) {
11942 if ( s1.hashCode() != s1.hashCode() ) {
11945 if ( s1.hashCode() != s2.hashCode() ) {
11948 if ( s1.hashCode() == s3.hashCode() ) {
11951 if ( s1.compareTo( s1 ) != 0 ) {
11954 if ( s1.compareTo( s2 ) != 0 ) {
11957 if ( s1.compareTo( s3 ) != 0 ) {
11960 if ( s1.compareTo( s4 ) >= 0 ) {
11963 if ( s4.compareTo( s1 ) <= 0 ) {
11966 if ( !s4.getSpeciesId().equals( "b" ) ) {
11969 final Species s5 = new BasicSpecies( " C " );
11970 if ( !s5.getSpeciesId().equals( "C" ) ) {
11973 if ( s5.equals( s1 ) ) {
11977 catch ( final Exception e ) {
11978 e.printStackTrace( System.out );
11984 private static boolean testSplit() {
11986 final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
11987 final Phylogeny p0 = factory.create( "(((A,B,C),D),(E,(F,G)))R", new NHXParser() )[ 0 ];
11988 //Archaeopteryx.createApplication( p0 );
11989 final Set<PhylogenyNode> ex = new HashSet<PhylogenyNode>();
11990 ex.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11991 ex.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
11992 ex.add( PhylogenyNode.createInstanceFromNhxString( "C" ) );
11993 ex.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
11994 ex.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
11995 ex.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
11996 ex.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
11997 ex.add( PhylogenyNode.createInstanceFromNhxString( "X" ) );
11998 ex.add( PhylogenyNode.createInstanceFromNhxString( "Y" ) );
11999 final TreeSplitMatrix s0 = new TreeSplitMatrix( p0, false, ex );
12000 // System.out.println( s0.toString() );
12002 Set<PhylogenyNode> query_nodes = new HashSet<PhylogenyNode>();
12003 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12004 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
12005 if ( s0.match( query_nodes ) ) {
12008 query_nodes = new HashSet<PhylogenyNode>();
12009 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12010 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
12011 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "C" ) );
12012 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
12013 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
12014 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
12015 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
12016 if ( !s0.match( query_nodes ) ) {
12020 query_nodes = new HashSet<PhylogenyNode>();
12021 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12022 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
12023 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "C" ) );
12024 if ( !s0.match( query_nodes ) ) {
12028 query_nodes = new HashSet<PhylogenyNode>();
12029 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
12030 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
12031 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
12032 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
12033 if ( !s0.match( query_nodes ) ) {
12037 query_nodes = new HashSet<PhylogenyNode>();
12038 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12039 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
12040 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "C" ) );
12041 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
12042 if ( !s0.match( query_nodes ) ) {
12046 query_nodes = new HashSet<PhylogenyNode>();
12047 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
12048 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
12049 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
12050 if ( !s0.match( query_nodes ) ) {
12053 query_nodes = new HashSet<PhylogenyNode>();
12054 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
12055 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
12056 if ( !s0.match( query_nodes ) ) {
12059 query_nodes = new HashSet<PhylogenyNode>();
12060 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
12061 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
12062 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "C" ) );
12063 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
12064 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12065 if ( !s0.match( query_nodes ) ) {
12068 query_nodes = new HashSet<PhylogenyNode>();
12069 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
12070 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
12071 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
12072 if ( !s0.match( query_nodes ) ) {
12075 query_nodes = new HashSet<PhylogenyNode>();
12076 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
12077 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
12078 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
12079 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
12080 if ( !s0.match( query_nodes ) ) {
12083 query_nodes = new HashSet<PhylogenyNode>();
12084 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
12085 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12086 if ( s0.match( query_nodes ) ) {
12089 query_nodes = new HashSet<PhylogenyNode>();
12090 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12091 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
12092 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
12093 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "C" ) );
12094 if ( s0.match( query_nodes ) ) {
12097 query_nodes = new HashSet<PhylogenyNode>();
12098 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
12099 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
12100 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
12101 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
12102 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "C" ) );
12103 if ( s0.match( query_nodes ) ) {
12106 query_nodes = new HashSet<PhylogenyNode>();
12107 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12108 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
12109 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
12110 if ( s0.match( query_nodes ) ) {
12113 query_nodes = new HashSet<PhylogenyNode>();
12114 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12115 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
12116 if ( s0.match( query_nodes ) ) {
12119 query_nodes = new HashSet<PhylogenyNode>();
12120 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12121 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
12122 if ( s0.match( query_nodes ) ) {
12125 query_nodes = new HashSet<PhylogenyNode>();
12126 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12127 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "C" ) );
12128 if ( s0.match( query_nodes ) ) {
12131 query_nodes = new HashSet<PhylogenyNode>();
12132 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12133 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
12134 if ( s0.match( query_nodes ) ) {
12137 query_nodes = new HashSet<PhylogenyNode>();
12138 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12139 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
12140 if ( s0.match( query_nodes ) ) {
12143 query_nodes = new HashSet<PhylogenyNode>();
12144 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12145 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
12146 if ( s0.match( query_nodes ) ) {
12149 query_nodes = new HashSet<PhylogenyNode>();
12150 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12151 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
12152 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
12153 if ( s0.match( query_nodes ) ) {
12156 query_nodes = new HashSet<PhylogenyNode>();
12157 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12158 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
12159 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
12160 if ( s0.match( query_nodes ) ) {
12163 query_nodes = new HashSet<PhylogenyNode>();
12164 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
12165 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
12166 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12167 if ( s0.match( query_nodes ) ) {
12170 query_nodes = new HashSet<PhylogenyNode>();
12171 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
12172 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
12173 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12174 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
12175 if ( s0.match( query_nodes ) ) {
12179 // query_nodes = new HashSet<PhylogenyNode>();
12180 // query_nodes.add( new PhylogenyNode( "X" ) );
12181 // query_nodes.add( new PhylogenyNode( "Y" ) );
12182 // query_nodes.add( new PhylogenyNode( "A" ) );
12183 // query_nodes.add( new PhylogenyNode( "B" ) );
12184 // query_nodes.add( new PhylogenyNode( "C" ) );
12185 // query_nodes.add( new PhylogenyNode( "D" ) );
12186 // query_nodes.add( new PhylogenyNode( "E" ) );
12187 // query_nodes.add( new PhylogenyNode( "F" ) );
12188 // query_nodes.add( new PhylogenyNode( "G" ) );
12189 // if ( !s0.match( query_nodes ) ) {
12192 // query_nodes = new HashSet<PhylogenyNode>();
12193 // query_nodes.add( new PhylogenyNode( "X" ) );
12194 // query_nodes.add( new PhylogenyNode( "Y" ) );
12195 // query_nodes.add( new PhylogenyNode( "A" ) );
12196 // query_nodes.add( new PhylogenyNode( "B" ) );
12197 // query_nodes.add( new PhylogenyNode( "C" ) );
12198 // if ( !s0.match( query_nodes ) ) {
12202 // query_nodes = new HashSet<PhylogenyNode>();
12203 // query_nodes.add( new PhylogenyNode( "X" ) );
12204 // query_nodes.add( new PhylogenyNode( "Y" ) );
12205 // query_nodes.add( new PhylogenyNode( "D" ) );
12206 // query_nodes.add( new PhylogenyNode( "E" ) );
12207 // query_nodes.add( new PhylogenyNode( "F" ) );
12208 // query_nodes.add( new PhylogenyNode( "G" ) );
12209 // if ( !s0.match( query_nodes ) ) {
12213 // query_nodes = new HashSet<PhylogenyNode>();
12214 // query_nodes.add( new PhylogenyNode( "X" ) );
12215 // query_nodes.add( new PhylogenyNode( "Y" ) );
12216 // query_nodes.add( new PhylogenyNode( "A" ) );
12217 // query_nodes.add( new PhylogenyNode( "B" ) );
12218 // query_nodes.add( new PhylogenyNode( "C" ) );
12219 // query_nodes.add( new PhylogenyNode( "D" ) );
12220 // if ( !s0.match( query_nodes ) ) {
12224 // query_nodes = new HashSet<PhylogenyNode>();
12225 // query_nodes.add( new PhylogenyNode( "X" ) );
12226 // query_nodes.add( new PhylogenyNode( "Y" ) );
12227 // query_nodes.add( new PhylogenyNode( "E" ) );
12228 // query_nodes.add( new PhylogenyNode( "F" ) );
12229 // query_nodes.add( new PhylogenyNode( "G" ) );
12230 // if ( !s0.match( query_nodes ) ) {
12234 // query_nodes = new HashSet<PhylogenyNode>();
12235 // query_nodes.add( new PhylogenyNode( "X" ) );
12236 // query_nodes.add( new PhylogenyNode( "Y" ) );
12237 // query_nodes.add( new PhylogenyNode( "F" ) );
12238 // query_nodes.add( new PhylogenyNode( "G" ) );
12239 // if ( !s0.match( query_nodes ) ) {
12243 query_nodes = new HashSet<PhylogenyNode>();
12244 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "X" ) );
12245 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "Y" ) );
12246 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
12247 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
12248 if ( s0.match( query_nodes ) ) {
12252 query_nodes = new HashSet<PhylogenyNode>();
12253 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "X" ) );
12254 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "Y" ) );
12255 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12256 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
12257 if ( s0.match( query_nodes ) ) {
12260 ///////////////////////////
12262 query_nodes = new HashSet<PhylogenyNode>();
12263 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "X" ) );
12264 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "Y" ) );
12265 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12266 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
12267 if ( s0.match( query_nodes ) ) {
12271 query_nodes = new HashSet<PhylogenyNode>();
12272 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "X" ) );
12273 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "Y" ) );
12274 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12275 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
12276 if ( s0.match( query_nodes ) ) {
12280 query_nodes = new HashSet<PhylogenyNode>();
12281 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "X" ) );
12282 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "Y" ) );
12283 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12284 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "C" ) );
12285 if ( s0.match( query_nodes ) ) {
12289 query_nodes = new HashSet<PhylogenyNode>();
12290 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "X" ) );
12291 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "Y" ) );
12292 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12293 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
12294 if ( s0.match( query_nodes ) ) {
12298 query_nodes = new HashSet<PhylogenyNode>();
12299 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "X" ) );
12300 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "Y" ) );
12301 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12302 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
12303 if ( s0.match( query_nodes ) ) {
12307 query_nodes = new HashSet<PhylogenyNode>();
12308 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "Y" ) );
12309 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12310 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
12311 if ( s0.match( query_nodes ) ) {
12315 query_nodes = new HashSet<PhylogenyNode>();
12316 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "X" ) );
12317 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "Y" ) );
12318 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12319 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
12320 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
12321 if ( s0.match( query_nodes ) ) {
12325 query_nodes = new HashSet<PhylogenyNode>();
12326 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "X" ) );
12327 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "Y" ) );
12328 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12329 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
12330 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
12331 if ( s0.match( query_nodes ) ) {
12335 query_nodes = new HashSet<PhylogenyNode>();
12336 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "X" ) );
12337 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "Y" ) );
12338 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
12339 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
12340 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12341 if ( s0.match( query_nodes ) ) {
12345 query_nodes = new HashSet<PhylogenyNode>();
12346 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "X" ) );
12347 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "Y" ) );
12348 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
12349 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
12350 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12351 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
12352 if ( s0.match( query_nodes ) ) {
12356 catch ( final Exception e ) {
12357 e.printStackTrace();
12363 private static boolean testSplitStrict() {
12365 final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
12366 final Phylogeny p0 = factory.create( "(((A,B,C),D),(E,(F,G)))R", new NHXParser() )[ 0 ];
12367 final Set<PhylogenyNode> ex = new HashSet<PhylogenyNode>();
12368 ex.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12369 ex.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
12370 ex.add( PhylogenyNode.createInstanceFromNhxString( "C" ) );
12371 ex.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
12372 ex.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
12373 ex.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
12374 ex.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
12375 final TreeSplitMatrix s0 = new TreeSplitMatrix( p0, true, ex );
12376 Set<PhylogenyNode> query_nodes = new HashSet<PhylogenyNode>();
12377 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12378 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
12379 if ( s0.match( query_nodes ) ) {
12382 query_nodes = new HashSet<PhylogenyNode>();
12383 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12384 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
12385 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "C" ) );
12386 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
12387 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
12388 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
12389 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
12390 if ( !s0.match( query_nodes ) ) {
12394 query_nodes = new HashSet<PhylogenyNode>();
12395 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12396 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
12397 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "C" ) );
12398 if ( !s0.match( query_nodes ) ) {
12402 query_nodes = new HashSet<PhylogenyNode>();
12403 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
12404 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
12405 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
12406 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
12407 if ( !s0.match( query_nodes ) ) {
12411 query_nodes = new HashSet<PhylogenyNode>();
12412 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12413 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
12414 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "C" ) );
12415 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
12416 if ( !s0.match( query_nodes ) ) {
12420 query_nodes = new HashSet<PhylogenyNode>();
12421 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
12422 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
12423 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
12424 if ( !s0.match( query_nodes ) ) {
12428 query_nodes = new HashSet<PhylogenyNode>();
12429 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
12430 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
12431 if ( !s0.match( query_nodes ) ) {
12435 query_nodes = new HashSet<PhylogenyNode>();
12436 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
12437 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
12438 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "C" ) );
12439 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
12440 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12441 if ( !s0.match( query_nodes ) ) {
12445 query_nodes = new HashSet<PhylogenyNode>();
12446 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
12447 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
12448 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
12449 if ( !s0.match( query_nodes ) ) {
12453 query_nodes = new HashSet<PhylogenyNode>();
12454 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
12455 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
12456 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
12457 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
12458 if ( !s0.match( query_nodes ) ) {
12462 query_nodes = new HashSet<PhylogenyNode>();
12463 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
12464 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12465 if ( s0.match( query_nodes ) ) {
12469 query_nodes = new HashSet<PhylogenyNode>();
12470 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12471 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
12472 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
12473 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "C" ) );
12474 if ( s0.match( query_nodes ) ) {
12478 query_nodes = new HashSet<PhylogenyNode>();
12479 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
12480 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
12481 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
12482 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
12483 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "C" ) );
12484 if ( s0.match( query_nodes ) ) {
12488 query_nodes = new HashSet<PhylogenyNode>();
12489 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12490 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
12491 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
12492 if ( s0.match( query_nodes ) ) {
12496 query_nodes = new HashSet<PhylogenyNode>();
12497 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12498 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
12499 if ( s0.match( query_nodes ) ) {
12503 query_nodes = new HashSet<PhylogenyNode>();
12504 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12505 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
12506 if ( s0.match( query_nodes ) ) {
12510 query_nodes = new HashSet<PhylogenyNode>();
12511 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12512 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "C" ) );
12513 if ( s0.match( query_nodes ) ) {
12517 query_nodes = new HashSet<PhylogenyNode>();
12518 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12519 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
12520 if ( s0.match( query_nodes ) ) {
12524 query_nodes = new HashSet<PhylogenyNode>();
12525 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12526 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
12527 if ( s0.match( query_nodes ) ) {
12531 query_nodes = new HashSet<PhylogenyNode>();
12532 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12533 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
12534 if ( s0.match( query_nodes ) ) {
12538 query_nodes = new HashSet<PhylogenyNode>();
12539 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12540 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
12541 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
12542 if ( s0.match( query_nodes ) ) {
12546 query_nodes = new HashSet<PhylogenyNode>();
12547 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12548 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
12549 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
12550 if ( s0.match( query_nodes ) ) {
12554 query_nodes = new HashSet<PhylogenyNode>();
12555 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
12556 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
12557 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12558 if ( s0.match( query_nodes ) ) {
12562 query_nodes = new HashSet<PhylogenyNode>();
12563 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
12564 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
12565 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12566 query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
12567 if ( s0.match( query_nodes ) ) {
12571 catch ( final Exception e ) {
12572 e.printStackTrace();
12578 private static boolean testSubtreeDeletion() {
12580 final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
12581 final Phylogeny t1 = factory.create( "((A,B,C)abc,(D,E,F)def)r", new NHXParser() )[ 0 ];
12582 t1.deleteSubtree( t1.getNode( "A" ), false );
12583 if ( t1.getNumberOfExternalNodes() != 5 ) {
12586 t1.toNewHampshireX();
12587 t1.deleteSubtree( t1.getNode( "E" ), false );
12588 if ( t1.getNumberOfExternalNodes() != 4 ) {
12591 t1.toNewHampshireX();
12592 t1.deleteSubtree( t1.getNode( "F" ), false );
12593 if ( t1.getNumberOfExternalNodes() != 3 ) {
12596 t1.toNewHampshireX();
12597 t1.deleteSubtree( t1.getNode( "D" ), false );
12598 t1.toNewHampshireX();
12599 if ( t1.getNumberOfExternalNodes() != 3 ) {
12602 t1.deleteSubtree( t1.getNode( "def" ), false );
12603 t1.toNewHampshireX();
12604 if ( t1.getNumberOfExternalNodes() != 2 ) {
12607 t1.deleteSubtree( t1.getNode( "B" ), false );
12608 t1.toNewHampshireX();
12609 if ( t1.getNumberOfExternalNodes() != 1 ) {
12612 t1.deleteSubtree( t1.getNode( "C" ), false );
12613 t1.toNewHampshireX();
12614 if ( t1.getNumberOfExternalNodes() != 1 ) {
12617 t1.deleteSubtree( t1.getNode( "abc" ), false );
12618 t1.toNewHampshireX();
12619 if ( t1.getNumberOfExternalNodes() != 1 ) {
12622 t1.deleteSubtree( t1.getNode( "r" ), false );
12623 if ( t1.getNumberOfExternalNodes() != 0 ) {
12626 if ( !t1.isEmpty() ) {
12629 final Phylogeny t2 = factory.create( "(((1,2,3)A,B,C)abc,(D,E,F)def)r", new NHXParser() )[ 0 ];
12630 t2.deleteSubtree( t2.getNode( "A" ), false );
12631 t2.toNewHampshireX();
12632 if ( t2.getNumberOfExternalNodes() != 5 ) {
12635 t2.deleteSubtree( t2.getNode( "abc" ), false );
12636 t2.toNewHampshireX();
12637 if ( t2.getNumberOfExternalNodes() != 3 ) {
12640 t2.deleteSubtree( t2.getNode( "def" ), false );
12641 t2.toNewHampshireX();
12642 if ( t2.getNumberOfExternalNodes() != 1 ) {
12646 catch ( final Exception e ) {
12647 e.printStackTrace( System.out );
12653 private static boolean testSupportCount() {
12655 final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
12656 final Phylogeny t0_1 = factory.create( "(((A,B),C),(D,E))", new NHXParser() )[ 0 ];
12657 final Phylogeny[] phylogenies_1 = factory.create( "(((A,B),C),(D,E)) " + "(((C,B),A),(D,E))"
12658 + "(((A,B),C),(D,E)) " + "(((A,B),C),(D,E))"
12659 + "(((A,B),C),(D,E))" + "(((C,B),A),(D,E))"
12660 + "(((E,B),D),(C,A))" + "(((C,B),A),(D,E))"
12661 + "(((A,B),C),(D,E))" + "(((A,B),C),(D,E))",
12663 SupportCount.count( t0_1, phylogenies_1, true, false );
12664 final Phylogeny t0_2 = factory.create( "(((((A,B),C),D),E),(F,G))", new NHXParser() )[ 0 ];
12665 final Phylogeny[] phylogenies_2 = factory.create( "(((((A,B),C),D),E),(F,G))"
12666 + "(((((A,B),C),D),E),((F,G),X))"
12667 + "(((((A,Y),B),C),D),((F,G),E))"
12668 + "(((((A,B),C),D),E),(F,G))"
12669 + "(((((A,B),C),D),E),(F,G))"
12670 + "(((((A,B),C),D),E),(F,G))"
12671 + "(((((A,B),C),D),E),(F,G),Z)"
12672 + "(((((A,B),C),D),E),(F,G))"
12673 + "((((((A,B),C),D),E),F),G)"
12674 + "(((((X,Y),F,G),E),((A,B),C)),D)",
12676 SupportCount.count( t0_2, phylogenies_2, true, false );
12677 final PhylogenyNodeIterator it = t0_2.iteratorPostorder();
12678 while ( it.hasNext() ) {
12679 final PhylogenyNode n = it.next();
12680 if ( !n.isExternal() && ( PhylogenyMethods.getConfidenceValue( n ) != 10 ) ) {
12684 final Phylogeny t0_3 = factory.create( "(((A,B)ab,C)abc,((D,E)de,F)def)", new NHXParser() )[ 0 ];
12685 final Phylogeny[] phylogenies_3 = factory.create( "(((A,B),C),((D,E),F))" + "(((A,C),B),((D,F),E))"
12686 + "(((C,A),B),((F,D),E))" + "(((A,B),F),((D,E),C))" + "(((((A,B),C),D),E),F)", new NHXParser() );
12687 SupportCount.count( t0_3, phylogenies_3, true, false );
12688 t0_3.reRoot( t0_3.getNode( "def" ).getId() );
12689 if ( PhylogenyMethods.getConfidenceValue( t0_3.getNode( "ab" ) ) != 3 ) {
12692 if ( PhylogenyMethods.getConfidenceValue( t0_3.getNode( "abc" ) ) != 4 ) {
12695 if ( PhylogenyMethods.getConfidenceValue( t0_3.getNode( "def" ) ) != 4 ) {
12698 if ( PhylogenyMethods.getConfidenceValue( t0_3.getNode( "de" ) ) != 2 ) {
12701 if ( PhylogenyMethods.getConfidenceValue( t0_3.getNode( "A" ) ) != 5 ) {
12704 if ( PhylogenyMethods.getConfidenceValue( t0_3.getNode( "B" ) ) != 5 ) {
12707 if ( PhylogenyMethods.getConfidenceValue( t0_3.getNode( "C" ) ) != 5 ) {
12710 if ( PhylogenyMethods.getConfidenceValue( t0_3.getNode( "D" ) ) != 5 ) {
12713 if ( PhylogenyMethods.getConfidenceValue( t0_3.getNode( "E" ) ) != 5 ) {
12716 if ( PhylogenyMethods.getConfidenceValue( t0_3.getNode( "F" ) ) != 5 ) {
12719 final Phylogeny t0_4 = factory.create( "(((((A,B)1,C)2,D)3,E)4,F)", new NHXParser() )[ 0 ];
12720 final Phylogeny[] phylogenies_4 = factory.create( "((((((A,X),C),B),D),E),F) "
12721 + "(((A,B,Z),C,Q),(((D,Y),E),F))", new NHXParser() );
12722 SupportCount.count( t0_4, phylogenies_4, true, false );
12723 t0_4.reRoot( t0_4.getNode( "F" ).getId() );
12724 if ( PhylogenyMethods.getConfidenceValue( t0_4.getNode( "1" ) ) != 1 ) {
12727 if ( PhylogenyMethods.getConfidenceValue( t0_4.getNode( "2" ) ) != 2 ) {
12730 if ( PhylogenyMethods.getConfidenceValue( t0_4.getNode( "3" ) ) != 1 ) {
12733 if ( PhylogenyMethods.getConfidenceValue( t0_4.getNode( "4" ) ) != 2 ) {
12736 if ( PhylogenyMethods.getConfidenceValue( t0_4.getNode( "A" ) ) != 2 ) {
12739 if ( PhylogenyMethods.getConfidenceValue( t0_4.getNode( "B" ) ) != 2 ) {
12742 if ( PhylogenyMethods.getConfidenceValue( t0_4.getNode( "C" ) ) != 2 ) {
12745 if ( PhylogenyMethods.getConfidenceValue( t0_4.getNode( "D" ) ) != 2 ) {
12748 if ( PhylogenyMethods.getConfidenceValue( t0_4.getNode( "E" ) ) != 2 ) {
12751 if ( PhylogenyMethods.getConfidenceValue( t0_4.getNode( "F" ) ) != 2 ) {
12754 Phylogeny a = factory.create( "(((((A,B)1,C)2,D)3,E)4,F)", new NHXParser() )[ 0 ];
12755 final Phylogeny b1 = factory.create( "(((((B,A)1,C)2,D)3,E)4,F)", new NHXParser() )[ 0 ];
12756 double d = SupportCount.compare( b1, a, true, true, true );
12757 if ( !Test.isEqual( d, 5.0 / 5.0 ) ) {
12760 a = factory.create( "(((((A,B)1,C)2,D)3,E)4,F)", new NHXParser() )[ 0 ];
12761 final Phylogeny b2 = factory.create( "(((((C,B)1,A)2,D)3,E)4,F)", new NHXParser() )[ 0 ];
12762 d = SupportCount.compare( b2, a, true, true, true );
12763 if ( !Test.isEqual( d, 4.0 / 5.0 ) ) {
12766 a = factory.create( "(((((A,B)1,C)2,D)3,E)4,F)", new NHXParser() )[ 0 ];
12767 final Phylogeny b3 = factory.create( "(((((F,C)1,A)2,B)3,D)4,E)", new NHXParser() )[ 0 ];
12768 d = SupportCount.compare( b3, a, true, true, true );
12769 if ( !Test.isEqual( d, 2.0 / 5.0 ) ) {
12772 a = factory.create( "(((((A,B)1,C)2,D)3,E)4,F)r", new NHXParser() )[ 0 ];
12773 final Phylogeny b4 = factory.create( "(((((F,C)1,A)2,B)3,D)4,E)r", new NHXParser() )[ 0 ];
12774 d = SupportCount.compare( b4, a, true, true, false );
12775 if ( !Test.isEqual( d, 1.0 / 5.0 ) ) {
12779 catch ( final Exception e ) {
12780 e.printStackTrace( System.out );
12786 private static boolean testSupportTransfer() {
12788 final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
12789 final Phylogeny p1 = factory.create( "(((A,B)ab:97,C)abc:57,((D,E)de:10,(F,G)fg:50,(H,I)hi:64)defghi)",
12790 new NHXParser() )[ 0 ];
12791 final Phylogeny p2 = factory
12792 .create( "(((A:0.1,B:0.3)ab:0.4,C)abc:0.5,((D,E)de,(F,G)fg,(H,I)hi:0.59)defghi)", new NHXParser() )[ 0 ];
12793 if ( PhylogenyMethods.getConfidenceValue( p2.getNode( "ab" ) ) >= 0.0 ) {
12796 if ( PhylogenyMethods.getConfidenceValue( p2.getNode( "abc" ) ) >= 0.0 ) {
12799 support_transfer.moveBranchLengthsToBootstrap( p1 );
12800 support_transfer.transferSupportValues( p1, p2 );
12801 if ( p2.getNode( "ab" ).getDistanceToParent() != 0.4 ) {
12804 if ( p2.getNode( "abc" ).getDistanceToParent() != 0.5 ) {
12807 if ( p2.getNode( "hi" ).getDistanceToParent() != 0.59 ) {
12810 if ( PhylogenyMethods.getConfidenceValue( p2.getNode( "ab" ) ) != 97 ) {
12813 if ( PhylogenyMethods.getConfidenceValue( p2.getNode( "abc" ) ) != 57 ) {
12816 if ( PhylogenyMethods.getConfidenceValue( p2.getNode( "de" ) ) != 10 ) {
12819 if ( PhylogenyMethods.getConfidenceValue( p2.getNode( "fg" ) ) != 50 ) {
12822 if ( PhylogenyMethods.getConfidenceValue( p2.getNode( "hi" ) ) != 64 ) {
12826 catch ( final Exception e ) {
12827 e.printStackTrace( System.out );
12833 private static boolean testTaxonomyExtraction() {
12835 final PhylogenyNode n0 = PhylogenyNode
12836 .createInstanceFromNhxString( "sd_12345678", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
12837 if ( n0.getNodeData().isHasTaxonomy() ) {
12840 final PhylogenyNode n1 = PhylogenyNode
12841 .createInstanceFromNhxString( "sd_12345x", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
12842 if ( n1.getNodeData().isHasTaxonomy() ) {
12843 System.out.println( n1.toString() );
12846 final PhylogenyNode n2x = PhylogenyNode
12847 .createInstanceFromNhxString( "12345", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
12848 if ( n2x.getNodeData().isHasTaxonomy() ) {
12851 final PhylogenyNode n3 = PhylogenyNode
12852 .createInstanceFromNhxString( "BLAG_12345", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
12853 if ( !n3.getNodeData().getTaxonomy().getIdentifier().getValue().equals( "12345" ) ) {
12854 System.out.println( n3.toString() );
12857 final PhylogenyNode n4 = PhylogenyNode
12858 .createInstanceFromNhxString( "blag-12345", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
12859 if ( n4.getNodeData().isHasTaxonomy() ) {
12860 System.out.println( n4.toString() );
12863 final PhylogenyNode n5 = PhylogenyNode
12864 .createInstanceFromNhxString( "12345-blag", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
12865 if ( n5.getNodeData().isHasTaxonomy() ) {
12866 System.out.println( n5.toString() );
12869 final PhylogenyNode n6 = PhylogenyNode
12870 .createInstanceFromNhxString( "BLAG-12345-blag", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
12871 if ( n6.getNodeData().isHasTaxonomy() ) {
12872 System.out.println( n6.toString() );
12875 final PhylogenyNode n7 = PhylogenyNode
12876 .createInstanceFromNhxString( "BLAG-12345_blag", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
12877 if ( n7.getNodeData().isHasTaxonomy() ) {
12878 System.out.println( n7.toString() );
12881 final PhylogenyNode n8 = PhylogenyNode
12882 .createInstanceFromNhxString( "BLAG_12345-blag", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
12883 if ( !n8.getNodeData().getTaxonomy().getIdentifier().getValue().equals( "12345" ) ) {
12884 System.out.println( n8.toString() );
12887 final PhylogenyNode n9 = PhylogenyNode
12888 .createInstanceFromNhxString( "BLAG_12345/blag", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
12889 if ( !n9.getNodeData().getTaxonomy().getIdentifier().getValue().equals( "12345" ) ) {
12890 System.out.println( n9.toString() );
12893 final PhylogenyNode n10x = PhylogenyNode
12894 .createInstanceFromNhxString( "BLAG_12X45-blag", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
12895 if ( n10x.getNodeData().isHasTaxonomy() ) {
12896 System.out.println( n10x.toString() );
12899 final PhylogenyNode n10xx = PhylogenyNode
12900 .createInstanceFromNhxString( "BLAG_1YX45-blag", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
12901 if ( n10xx.getNodeData().isHasTaxonomy() ) {
12902 System.out.println( n10xx.toString() );
12905 final PhylogenyNode n10 = PhylogenyNode
12906 .createInstanceFromNhxString( "BLAG_9YX45-blag", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
12907 if ( !n10.getNodeData().getTaxonomy().getTaxonomyCode().equals( "9YX45" ) ) {
12908 System.out.println( n10.toString() );
12911 final PhylogenyNode n11 = PhylogenyNode
12912 .createInstanceFromNhxString( "BLAG_Mus_musculus", NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
12913 if ( !n11.getNodeData().getTaxonomy().getScientificName().equals( "Mus musculus" ) ) {
12914 System.out.println( n11.toString() );
12917 final PhylogenyNode n12 = PhylogenyNode
12918 .createInstanceFromNhxString( "BLAG_Mus_musculus_musculus",
12919 NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
12920 if ( !n12.getNodeData().getTaxonomy().getScientificName().equals( "Mus musculus musculus" ) ) {
12921 System.out.println( n12.toString() );
12924 final PhylogenyNode n13 = PhylogenyNode
12925 .createInstanceFromNhxString( "BLAG_Mus_musculus1", NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
12926 if ( n13.getNodeData().isHasTaxonomy() ) {
12927 System.out.println( n13.toString() );
12930 final PhylogenyNode n14 = PhylogenyNode
12931 .createInstanceFromNhxString( "Mus_musculus_392", NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
12932 if ( !n14.getNodeData().getTaxonomy().getScientificName().equals( "Mus musculus" ) ) {
12933 System.out.println( n14.toString() );
12936 final PhylogenyNode n15 = PhylogenyNode
12937 .createInstanceFromNhxString( "Mus_musculus_K392", NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
12938 if ( !n15.getNodeData().getTaxonomy().getScientificName().equals( "Mus musculus" ) ) {
12939 System.out.println( n15.toString() );
12942 final PhylogenyNode n16 = PhylogenyNode
12943 .createInstanceFromNhxString( "Mus musculus 392", NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
12944 if ( !n16.getNodeData().getTaxonomy().getScientificName().equals( "Mus musculus" ) ) {
12945 System.out.println( n16.toString() );
12948 final PhylogenyNode n17 = PhylogenyNode
12949 .createInstanceFromNhxString( "Mus musculus K392", NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
12950 if ( !n17.getNodeData().getTaxonomy().getScientificName().equals( "Mus musculus" ) ) {
12951 System.out.println( n17.toString() );
12954 final PhylogenyNode n18 = PhylogenyNode
12955 .createInstanceFromNhxString( "Mus_musculus_musculus_392", NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
12956 if ( !n18.getNodeData().getTaxonomy().getScientificName().equals( "Mus musculus musculus" ) ) {
12957 System.out.println( n18.toString() );
12960 final PhylogenyNode n19 = PhylogenyNode
12961 .createInstanceFromNhxString( "Mus_musculus_musculus_K392",
12962 NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
12963 if ( !n19.getNodeData().getTaxonomy().getScientificName().equals( "Mus musculus musculus" ) ) {
12964 System.out.println( n19.toString() );
12967 final PhylogenyNode n20 = PhylogenyNode
12968 .createInstanceFromNhxString( "Mus musculus musculus 392", NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
12969 if ( !n20.getNodeData().getTaxonomy().getScientificName().equals( "Mus musculus musculus" ) ) {
12970 System.out.println( n20.toString() );
12973 final PhylogenyNode n21 = PhylogenyNode
12974 .createInstanceFromNhxString( "Mus musculus musculus K392",
12975 NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
12976 if ( !n21.getNodeData().getTaxonomy().getScientificName().equals( "Mus musculus musculus" ) ) {
12977 System.out.println( n21.toString() );
12980 final PhylogenyNode n23 = PhylogenyNode
12981 .createInstanceFromNhxString( "9EMVE_Nematostella_vectensis",
12982 NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
12983 if ( !n23.getNodeData().getTaxonomy().getScientificName().equals( "Nematostella vectensis" ) ) {
12984 System.out.println( n23.toString() );
12987 final PhylogenyNode n24 = PhylogenyNode
12988 .createInstanceFromNhxString( "9EMVE_Nematostella", NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
12989 if ( !n24.getNodeData().getTaxonomy().getTaxonomyCode().equals( "9EMVE" ) ) {
12990 System.out.println( n24.toString() );
12994 final PhylogenyNode n25 = PhylogenyNode
12995 .createInstanceFromNhxString( "Nematostella_vectensis_NEMVE",
12996 NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
12997 if ( !n25.getNodeData().getTaxonomy().getTaxonomyCode().equals( "NEMVE" ) ) {
12998 System.out.println( n25.toString() );
13001 final PhylogenyNode n26 = PhylogenyNode
13002 .createInstanceFromNhxString( "Nematostella_vectensis_9EMVE",
13003 NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
13004 if ( !n26.getNodeData().getTaxonomy().getScientificName().equals( "Nematostella vectensis" ) ) {
13005 System.out.println( n26.toString() );
13008 final PhylogenyNode n27 = PhylogenyNode
13009 .createInstanceFromNhxString( "Nematostella_9EMVE", NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
13010 if ( !n27.getNodeData().getTaxonomy().getTaxonomyCode().equals( "9EMVE" ) ) {
13011 System.out.println( n27.toString() );
13015 catch ( final Exception e ) {
13016 e.printStackTrace( System.out );
13022 private static boolean testTreeCopy() {
13024 final String str_0 = "((((a,b),c),d)[&&NHX:S=lizards],e[&&NHX:S=reptiles])r[&&NHX:S=animals]";
13025 final Phylogeny t0 = Phylogeny.createInstanceFromNhxString( str_0 );
13026 final Phylogeny t1 = t0.copy();
13027 if ( !t1.toNewHampshireX().equals( t0.toNewHampshireX() ) ) {
13030 if ( !t1.toNewHampshireX().equals( str_0 ) ) {
13033 t0.deleteSubtree( t0.getNode( "c" ), true );
13034 t0.deleteSubtree( t0.getNode( "a" ), true );
13035 t0.getRoot().getNodeData().getTaxonomy().setScientificName( "metazoa" );
13036 t0.getNode( "b" ).setName( "Bee" );
13037 if ( !t0.toNewHampshireX().equals( "((Bee,d)[&&NHX:S=lizards],e[&&NHX:S=reptiles])r[&&NHX:S=metazoa]" ) ) {
13040 if ( !t1.toNewHampshireX().equals( str_0 ) ) {
13043 t0.deleteSubtree( t0.getNode( "e" ), true );
13044 t0.deleteSubtree( t0.getNode( "Bee" ), true );
13045 t0.deleteSubtree( t0.getNode( "d" ), true );
13046 if ( !t1.toNewHampshireX().equals( str_0 ) ) {
13050 catch ( final Exception e ) {
13051 e.printStackTrace();
13057 private static boolean testTreeMethods() {
13059 final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
13060 final Phylogeny t0 = factory.create( "((((A,B)ab,C)abc,D)abcd,E)", new NHXParser() )[ 0 ];
13061 PhylogenyMethods.collapseSubtreeStructure( t0.getNode( "abcd" ) );
13062 if ( !t0.toNewHampshireX().equals( "((A,B,C,D)abcd,E)" ) ) {
13063 System.out.println( t0.toNewHampshireX() );
13066 final Phylogeny t1 = factory.create( "((((A:0.1,B)ab:0.2,C)abc:0.3,D)abcd:0.4,E)", new NHXParser() )[ 0 ];
13067 PhylogenyMethods.collapseSubtreeStructure( t1.getNode( "abcd" ) );
13068 if ( !isEqual( t1.getNode( "A" ).getDistanceToParent(), 0.6 ) ) {
13071 if ( !isEqual( t1.getNode( "B" ).getDistanceToParent(), 0.5 ) ) {
13074 if ( !isEqual( t1.getNode( "C" ).getDistanceToParent(), 0.3 ) ) {
13078 catch ( final Exception e ) {
13079 e.printStackTrace( System.out );
13085 private static boolean testUniprotEntryRetrieval() {
13087 final SequenceDatabaseEntry entry = SequenceDbWsTools.obtainUniProtEntry( "P12345", 5000 );
13088 if ( !entry.getAccession().equals( "P12345" ) ) {
13091 if ( !entry.getTaxonomyScientificName().equals( "Oryctolagus cuniculus" ) ) {
13094 if ( !entry.getSequenceName().equals( "Aspartate aminotransferase, mitochondrial" ) ) {
13097 if ( !entry.getSequenceSymbol().equals( "mAspAT" ) ) {
13100 if ( !entry.getGeneName().equals( "GOT2" ) ) {
13103 if ( !entry.getTaxonomyIdentifier().equals( "9986" ) ) {
13106 if ( entry.getMolecularSequence() == null ) {
13110 .getMolecularSequence()
13111 .getMolecularSequenceAsString()
13112 .startsWith( "MALLHSARVLSGVASAFHPGLAAAASARASSWWAHVEMGPPDPILGVTEAYKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKGLDKEYLPIGGLAEFCRASAELALGENSEV" )
13113 || !entry.getMolecularSequence().getMolecularSequenceAsString().endsWith( "LAHAIHQVTK" ) ) {
13114 System.out.println( "got: " + entry.getMolecularSequence().getMolecularSequenceAsString() );
13115 System.out.println( "expected something else." );
13119 catch ( final IOException e ) {
13120 System.out.println();
13121 System.out.println( "the following might be due to absence internet connection:" );
13122 e.printStackTrace( System.out );
13125 catch ( final NullPointerException f ) {
13126 f.printStackTrace( System.out );
13129 catch ( final Exception e ) {
13135 private static boolean testUniprotTaxonomySearch() {
13137 List<UniProtTaxonomy> results = SequenceDbWsTools.getTaxonomiesFromCommonNameStrict( "starlet sea anemone",
13139 if ( results.size() != 1 ) {
13142 if ( !results.get( 0 ).getCode().equals( "NEMVE" ) ) {
13145 if ( !results.get( 0 ).getCommonName().equalsIgnoreCase( "starlet sea anemone" ) ) {
13148 if ( !results.get( 0 ).getId().equalsIgnoreCase( "45351" ) ) {
13151 if ( !results.get( 0 ).getRank().equalsIgnoreCase( "species" ) ) {
13154 if ( !results.get( 0 ).getScientificName().equals( "Nematostella vectensis" ) ) {
13158 results = SequenceDbWsTools.getTaxonomiesFromScientificNameStrict( "Nematostella vectensis", 10 );
13159 if ( results.size() != 1 ) {
13162 if ( !results.get( 0 ).getCode().equals( "NEMVE" ) ) {
13165 if ( !results.get( 0 ).getCommonName().equalsIgnoreCase( "starlet sea anemone" ) ) {
13168 if ( !results.get( 0 ).getId().equalsIgnoreCase( "45351" ) ) {
13171 if ( !results.get( 0 ).getRank().equalsIgnoreCase( "species" ) ) {
13174 if ( !results.get( 0 ).getScientificName().equals( "Nematostella vectensis" ) ) {
13178 results = SequenceDbWsTools.getTaxonomiesFromId( "45351", 10 );
13179 if ( results.size() != 1 ) {
13182 if ( !results.get( 0 ).getCode().equals( "NEMVE" ) ) {
13185 if ( !results.get( 0 ).getCommonName().equalsIgnoreCase( "starlet sea anemone" ) ) {
13188 if ( !results.get( 0 ).getId().equalsIgnoreCase( "45351" ) ) {
13191 if ( !results.get( 0 ).getRank().equalsIgnoreCase( "species" ) ) {
13194 if ( !results.get( 0 ).getScientificName().equals( "Nematostella vectensis" ) ) {
13198 results = SequenceDbWsTools.getTaxonomiesFromTaxonomyCode( "NEMVE", 10 );
13199 if ( results.size() != 1 ) {
13202 if ( !results.get( 0 ).getCode().equals( "NEMVE" ) ) {
13205 if ( !results.get( 0 ).getCommonName().equalsIgnoreCase( "starlet sea anemone" ) ) {
13208 if ( !results.get( 0 ).getId().equalsIgnoreCase( "45351" ) ) {
13211 if ( !results.get( 0 ).getRank().equalsIgnoreCase( "species" ) ) {
13214 if ( !results.get( 0 ).getScientificName().equals( "Nematostella vectensis" ) ) {
13217 if ( !results.get( 0 ).getLineage().get( 1 ).equals( "Eukaryota" ) ) {
13220 if ( !results.get( 0 ).getLineage().get( 2 ).equals( "Metazoa" ) ) {
13223 if ( !results.get( 0 ).getLineage().get( results.get( 0 ).getLineage().size() - 1 )
13224 .equals( "Nematostella vectensis" ) ) {
13225 System.out.println( results.get( 0 ).getLineage() );
13230 results = SequenceDbWsTools.getTaxonomiesFromScientificNameStrict( "Xenopus tropicalis", 10 );
13231 if ( results.size() != 1 ) {
13234 if ( !results.get( 0 ).getCode().equals( "XENTR" ) ) {
13237 if ( !results.get( 0 ).getCommonName().equalsIgnoreCase( "Western clawed frog" ) ) {
13240 if ( !results.get( 0 ).getId().equalsIgnoreCase( "8364" ) ) {
13243 if ( !results.get( 0 ).getRank().equalsIgnoreCase( "species" ) ) {
13246 if ( !results.get( 0 ).getScientificName().equals( "Xenopus tropicalis" ) ) {
13249 if ( !results.get( 0 ).getLineage().get( results.get( 0 ).getLineage().size() - 1 )
13250 .equals( "Xenopus tropicalis" ) ) {
13251 System.out.println( results.get( 0 ).getLineage() );
13256 results = SequenceDbWsTools.getTaxonomiesFromId( "8364", 10 );
13257 if ( results.size() != 1 ) {
13260 if ( !results.get( 0 ).getCode().equals( "XENTR" ) ) {
13263 if ( !results.get( 0 ).getCommonName().equalsIgnoreCase( "Western clawed frog" ) ) {
13266 if ( !results.get( 0 ).getId().equalsIgnoreCase( "8364" ) ) {
13269 if ( !results.get( 0 ).getRank().equalsIgnoreCase( "species" ) ) {
13272 if ( !results.get( 0 ).getScientificName().equals( "Xenopus tropicalis" ) ) {
13275 if ( !results.get( 0 ).getLineage().get( results.get( 0 ).getLineage().size() - 1 )
13276 .equals( "Xenopus tropicalis" ) ) {
13277 System.out.println( results.get( 0 ).getLineage() );
13282 results = SequenceDbWsTools.getTaxonomiesFromTaxonomyCode( "XENTR", 10 );
13283 if ( results.size() != 1 ) {
13286 if ( !results.get( 0 ).getCode().equals( "XENTR" ) ) {
13289 if ( !results.get( 0 ).getCommonName().equalsIgnoreCase( "Western clawed frog" ) ) {
13292 if ( !results.get( 0 ).getId().equalsIgnoreCase( "8364" ) ) {
13295 if ( !results.get( 0 ).getRank().equalsIgnoreCase( "species" ) ) {
13298 if ( !results.get( 0 ).getScientificName().equals( "Xenopus tropicalis" ) ) {
13301 if ( !results.get( 0 ).getLineage().get( results.get( 0 ).getLineage().size() - 1 )
13302 .equals( "Xenopus tropicalis" ) ) {
13303 System.out.println( results.get( 0 ).getLineage() );
13307 catch ( final IOException e ) {
13308 System.out.println();
13309 System.out.println( "the following might be due to absence internet connection:" );
13310 e.printStackTrace( System.out );
13313 catch ( final Exception e ) {