2 * Jalview - A Sequence Alignment Editor and Viewer ($$Version-Rel$$)
3 * Copyright (C) $$Year-Rel$$ The Jalview Authors
5 * This file is part of Jalview.
7 * Jalview is free software: you can redistribute it and/or
8 * modify it under the terms of the GNU General Public License
9 * as published by the Free Software Foundation, either version 3
10 * of the License, or (at your option) any later version.
12 * Jalview is distributed in the hope that it will be useful, but
13 * WITHOUT ANY WARRANTY; without even the implied warranty
14 * of MERCHANTABILITY or FITNESS FOR A PARTICULAR
15 * PURPOSE. See the GNU General Public License for more details.
17 * You should have received a copy of the GNU General Public License
18 * along with Jalview. If not, see <http://www.gnu.org/licenses/>.
19 * The Jalview Authors are detailed in the 'AUTHORS' file.
21 package jalview.analysis;
23 import static org.testng.AssertJUnit.assertEquals;
24 import static org.testng.AssertJUnit.assertNotNull;
25 import static org.testng.AssertJUnit.assertTrue;
27 import jalview.api.AlignViewportI;
28 import jalview.datamodel.AlignedCodon;
29 import jalview.datamodel.Alignment;
30 import jalview.datamodel.AlignmentI;
31 import jalview.datamodel.ColumnSelection;
32 import jalview.datamodel.Sequence;
33 import jalview.datamodel.SequenceI;
34 import jalview.gui.AlignViewport;
35 import jalview.io.FormatAdapter;
37 import java.io.IOException;
39 import org.testng.annotations.Test;
44 // AA encoding codons as ordered on the Jalview help page Amino Acid Table
45 private static String fasta = ">B\n" + "GCT" + "GCC" + "GCA" + "GCG"
46 + "TGT" + "TGC" + "GAT" + "GAC" + "GAA" + "GAG" + "TTT" + "TTC"
47 + "GGT" + "GGC" + "GGA" + "GGG" + "CAT" + "CAC" + "ATT" + "ATC"
48 + "ATA" + "AAA" + "AAG" + "TTG" + "TTA" + "CTT" + "CTC" + "CTA"
49 + "CTG" + "ATG" + "AAT" + "AAC" + "CCT" + "CCC" + "CCA" + "CCG"
50 + "CAA" + "CAG" + "CGT" + "CGC" + "CGA" + "CGG" + "AGA" + "AGG"
51 + "TCT" + "TCC" + "TCA" + "TCG" + "AGT" + "AGC" + "ACT" + "ACC"
52 + "ACA" + "ACG" + "GTT" + "GTC" + "GTA" + "GTG" + "TGG" + "TAT"
53 + "TAC" + "TAA" + "TAG" + "TGA";
55 private static String JAL_1312_example_align_fasta = ">B.FR.83.HXB2_LAI_IIIB_BRU_K03455/45-306\n"
56 + "ATGGGAAAAAATTCGGTTAAGGCCAGGGGGAAAGAAAAAATATAAATTAAAACATATAGTATGGGCAAGCAG\n"
57 + "GGAGCTAGAACGATTCGCAGTTAATCCTGGCCTGTTAGAAACATCAGAAGGCTGTAGACAAATACTGGGACA\n"
58 + "GCTACAACCATCCCTTCAGACAGGATCAGAAGAACTTAGATCATTATATAATACAGTAGCAACCCTCTATTG\n"
59 + "TGTGCATCAAAGGATAGAGATAAAAGACACCAAGGAAGCTTTAGAC\n"
60 + ">gi|27804621|gb|AY178912.1|/1-259\n"
61 + "-TGGGAGAA-ATTCGGTT-CGGCCAGGGGGAAAGAAAAAATATCAGTTAAAACATATAGTATGGGCAAGCAG\n"
62 + "AGAGCTAGAACGATTCGCAGTTAACCCTGGCCTTTTAGAGACATCACAAGGCTGTAGACAAATACTGGGACA\n"
63 + "GCTACAACCATCCCTTCAGACAGGATCAGAAGAACTTAAATCATTATATAATACAGTAGCAACCCTCTATTG\n"
64 + "TGTTCATCAAAGGATAGATATAAAAGACACCAAGGAAGCTTTAGAT\n"
65 + ">gi|27804623|gb|AY178913.1|/1-259\n"
66 + "-TGGGAGAA-ATTCGGTT-CGGCCAGGGGGAAAGAAAAAATATCAGTTAAAACATATAGTATGGGCAAGCAG\n"
67 + "AGAGCTAGAACGATTCGCAGTTAACCCTGGCCTTTTAGAGACATCACAAGGCTGTAGACAAATACTGGAACA\n"
68 + "GCTACAACCATCCCTTCAGACAGGATCAGAAGAACTTAAATCATTATATAATACAGTAGCAACCCTCTATTG\n"
69 + "TGTTCATCAAAGGATAGATGTAAAAGACACCAAGGAAGCTTTAGAT\n"
70 + ">gi|27804627|gb|AY178915.1|/1-260\n"
71 + "-TGGGAAAA-ATTCGGTTAAGGCCAGGGGGAAAGAAAAAATATAAGTTAAAACATATAGTATGGGCAAGCAG\n"
72 + "GGAGCTAGAACGATTCGCAGTTAACCCTGGCCTGTTAGAAACATCAGAAGGTTGTAGACAAATATTGGGACA\n"
73 + "GCTACAACCATCCCTTGAGACAGGATCAGAAGAACTTAAATCATTATWTAATACCATAGCAGTCCTCTATTG\n"
74 + "TGTACATCAAAGGATAGATATAAAAGACACCAAGGAAGCTTTAGAG\n"
75 + ">gi|27804631|gb|AY178917.1|/1-261\n"
76 + "-TGGGAAAAAATTCGGTTGAGGCCAGGGGGAAAGAAAAAATATAAGTTAAAACATATAGTATGGGCAAGCAG\n"
77 + "GGAGCTAGAACGATTCGCAGTCAACCCTGGCCTGTTAGAAACACCAGAAGGCTGTAGACAAATACTGGGACA\n"
78 + "GCTACAACCGTCCCTTCAGACAGGATCGGAAGAACTTAAATCATTATATAATACAGTAGCAACCCTCTATTG\n"
79 + "TGTGCATCAAAGGATAGATGTAAAAGACACCAAGGAGGCTTTAGAC\n"
80 + ">gi|27804635|gb|AY178919.1|/1-261\n"
81 + "-TGGGAGAGAATTCGGTTACGGCCAGGAGGAAAGAAAAAATATAAATTGAAACATATAGTATGGGCAGGCAG\n"
82 + "AGAGCTAGATCGATTCGCAGTCAATCCTGGCCTGTTAGAAACATCAGAAGGCTGCAGACAGATATTGGGACA\n"
83 + "GCTACAACCGTCCCTTAAGACAGGATCAGAAGAACTTAAATCATTATATAATACAGTAGCAACCCTCTATTG\n"
84 + "TGTACATCAAAGGATAGATGTAAAAGACACCAAGGAAGCTTTAGAT\n"
85 + ">gi|27804641|gb|AY178922.1|/1-261\n"
86 + "-TGGGAGAAAATTCGGTTACGGCCAGGGGGAAAGAAAAGATATAAGTTAAAACATATAGTATGGGCAAGCAG\n"
87 + "GGAGCTAGAACGATTCGCAGTCAACCCTGGCCTGTTAGAAACATCAGAAGGCTGCAGACAAATACTGGGACA\n"
88 + "GTTACACCCATCCCTTCATACAGGATCAGAAGAACTTAAATCATTATATAATACAGTAGCAACCCTCTATTG\n"
89 + "TGTGCATCAAAGGATAGAAGTAAAAGACACCAAGGAAGCTTTAGAC\n"
90 + ">gi|27804647|gb|AY178925.1|/1-261\n"
91 + "-TGGGAAAAAATTCGGTTAAGGCCAGGGGGAAAGAAAAAATATCAATTAAAACATGTAGTATGGGCAAGCAG\n"
92 + "GGAACTAGAACGATTCGCAGTTAATCCTGGCCTGTTAGAAACATCAGAAGGCTGTAGACAAATATTGGGACA\n"
93 + "GCTACAACCATCCCTTCAGACAGGATCAGAGGAACTTAAATCATTATTTAATACAGTAGCAGTCCTCTATTG\n"
94 + "TGTACATCAAAGAATAGATGTAAAAGACACCAAGGAAGCTCTAGAA\n"
95 + ">gi|27804649|gb|AY178926.1|/1-261\n"
96 + "-TGGGAAAAAATTCGGTTAAGGCCAGGGGGAAAGAAAAAATATAAGTTAAAACATATAGTATGGGCAAGCAG\n"
97 + "GGAGCTAGAACGATTCGCGGTCAATCCTGGCCTGTTAGAAACATCAGAAGGCTGTAGACAACTACTGGGACA\n"
98 + "GTTACAACCATCCCTTCAGACAGGATCAGAAGAACTCAAATCATTATATAATACAATAGCAACCCTCTATTG\n"
99 + "TGTGCATCAAAGGATAGAGATAAAAGACACCAAGGAAGCCTTAGAT\n"
100 + ">gi|27804653|gb|AY178928.1|/1-261\n"
101 + "-TGGGAAAGAATTCGGTTAAGGCCAGGGGGAAAGAAACAATATAAATTAAAACATATAGTATGGGCAAGCAG\n"
102 + "GGAGCTAGACCGATTCGCACTTAACCCCGGCCTGTTAGAAACATCAGAAGGCTGTAGACAAATATTGGGACA\n"
103 + "GCTACAATCGTCCCTTCAGACAGGATCAGAAGAACTTAGATCACTATATAATACAGTAGCAGTCCTCTATTG\n"
104 + "TGTGCATCAAAAGATAGATGTAAAAGACACCAAGGAAGCCTTAGAC\n"
105 + ">gi|27804659|gb|AY178931.1|/1-261\n"
106 + "-TGGGAAAAAATTCGGTTACGGCCAGGAGGAAAGAAAAGATATAAATTAAAACATATAGTATGGGCAAGCAG\n"
107 + "GGAGCTAGAACGATTYGCAGTTAATCCTGGCCTTTTAGAAACAGCAGAAGGCTGTAGACAAATACTGGGACA\n"
108 + "GCTACAACCATCCCTTCAGACAGGATCAGAAGAACTTAAATCATTATATAATACAGTAGCAACCCTCTATTG\n"
109 + "TGTACATCAAAGGATAGAGATAAAAGACACCAAGGAAGCTTTAGAA\n";
113 * Corner case for this test is the presence of codons after codons that were
116 * @throws IOException
118 @Test(groups = { "Functional" })
119 public void testTranslateCdna_withUntranslatableCodons()
122 AlignmentI alf = new FormatAdapter().readFile(
123 JAL_1312_example_align_fasta, jalview.io.FormatAdapter.PASTE,
125 ColumnSelection cs = new ColumnSelection();
126 AlignViewportI av = new AlignViewport(alf, cs);
127 Dna dna = new Dna(av, new int[] { 0, alf.getWidth() - 1 });
128 AlignmentI translated = dna.translateCdna();
129 assertNotNull("Couldn't do a full width translation of test data.",
134 * Test variant in which 15 column blocks at a time are translated (the rest
137 * @throws IOException
139 @Test(groups = { "Functional" })
140 public void testTranslateCdna_withUntranslatableCodonsAndHiddenColumns()
143 AlignmentI alf = new FormatAdapter().readFile(
144 JAL_1312_example_align_fasta, jalview.io.FormatAdapter.PASTE,
147 for (int ipos = 0; ipos + vwidth < alf.getWidth(); ipos += vwidth)
149 ColumnSelection cs = new ColumnSelection();
152 cs.hideColumns(0, ipos - 1);
154 cs.hideColumns(ipos + vwidth, alf.getWidth());
155 int[] vcontigs = cs.getVisibleContigs(0, alf.getWidth());
156 AlignViewportI av = new AlignViewport(alf, cs);
157 Dna dna = new Dna(av, vcontigs);
158 AlignmentI transAlf = dna.translateCdna();
160 assertTrue("Translation failed (ipos=" + ipos
161 + ") No alignment data.", transAlf != null);
162 assertTrue("Translation failed (ipos=" + ipos + ") Empty alignment.",
163 transAlf.getHeight() > 0);
164 assertTrue("Translation failed (ipos=" + ipos + ") Translated "
165 + transAlf.getHeight() + " sequences from " + alf.getHeight()
166 + " sequences", alf.getHeight() == transAlf.getHeight());
171 * Test simple translation to Amino Acids (with STOP codons translated to *).
173 * @throws IOException
175 @Test(groups = { "Functional" })
176 public void testTranslateCdna_simple() throws IOException
178 AlignmentI alf = new FormatAdapter().readFile(fasta,
179 FormatAdapter.PASTE, "FASTA");
180 ColumnSelection cs = new ColumnSelection();
181 AlignViewportI av = new AlignViewport(alf, cs);
182 Dna dna = new Dna(av, new int[] { 0, alf.getWidth() - 1 });
183 AlignmentI translated = dna.translateCdna();
184 String aa = translated.getSequenceAt(0).getSequenceAsString();
186 "AAAACCDDEEFFGGGGHHIIIKKLLLLLLMNNPPPPQQRRRRRRSSSSSSTTTTVVVVWYY***",
191 * Test translation excluding hidden columns.
193 * @throws IOException
195 @Test(groups = { "Functional" })
196 public void testTranslateCdna_hiddenColumns() throws IOException
198 AlignmentI alf = new FormatAdapter().readFile(fasta,
199 FormatAdapter.PASTE, "FASTA");
200 ColumnSelection cs = new jalview.datamodel.ColumnSelection();
201 cs.hideColumns(6, 14); // hide codons 3/4/5
202 cs.hideColumns(24, 35); // hide codons 9-12
203 cs.hideColumns(177, 191); // hide codons 60-64
204 AlignViewportI av = new AlignViewport(alf, cs);
205 Dna dna = new Dna(av, new int[] { 0, alf.getWidth() - 1 });
206 AlignmentI translated = dna.translateCdna();
207 String aa = translated.getSequenceAt(0).getSequenceAsString();
208 assertEquals("AACDDGGGGHHIIIKKLLLLLLMNNPPPPQQRRRRRRSSSSSSTTTTVVVVW", aa);
212 * Use this test to help debug into any cases of interest.
214 @Test(groups = { "Functional" })
215 public void testCompareCodonPos_oneOnly()
217 assertFollows("-AA--A", "G--GG"); // 2 shifted seq2, 3 shifted seq1
221 * Tests for method that compares 'alignment' of two codon position triplets.
223 @Test(groups = { "Functional" })
224 public void testCompareCodonPos()
227 * Returns 0 for any null argument
229 assertEquals(0, Dna.compareCodonPos(new AlignedCodon(1, 2, 3), null));
230 assertEquals(0, Dna.compareCodonPos(null, new AlignedCodon(1, 2, 3)));
233 * Work through 27 combinations. First 9 cases where first position matches.
235 assertMatches("AAA", "GGG"); // 2 and 3 match
236 assertFollows("AA-A", "GGG"); // 2 matches, 3 shifted seq1
237 assertPrecedes("AAA", "GG-G"); // 2 matches, 3 shifted seq2
238 assertFollows("A-AA", "GG-G"); // 2 shifted seq1, 3 matches
239 assertFollows("A-A-A", "GG-G"); // 2 shifted seq1, 3 shifted seq1
240 assertPrecedes("A-AA", "GG--G"); // 2 shifted seq1, 3 shifted seq2
241 assertPrecedes("AA-A", "G-GG"); // 2 shifted seq2, 3 matches
242 assertFollows("AA--A", "G-GG"); // 2 shifted seq2, 3 shifted seq1
243 assertPrecedes("AAA", "G-GG"); // 2 shifted seq2, 3 shifted seq2
246 * 9 cases where first position is shifted in first sequence.
248 assertFollows("-AAA", "G-GG"); // 2 and 3 match
249 assertFollows("-AA-A", "G-GG"); // 2 matches, 3 shifted seq1
250 // 'enclosing' case: pick first to start precedes
251 assertFollows("-AAA", "G-G-G"); // 2 matches, 3 shifted seq2
252 assertFollows("-A-AA", "G-G-G"); // 2 shifted seq1, 3 matches
253 assertFollows("-A-A-A", "G-G-G"); // 2 shifted seq1, 3 shifted seq1
254 // 'enclosing' case: pick first to start precedes
255 assertFollows("-A-AA", "G-G--G"); // 2 shifted seq1, 3 shifted seq2
256 assertFollows("-AA-A", "G--GG"); // 2 shifted seq2, 3 matches
257 assertFollows("-AA--A", "G--GG"); // 2 shifted seq2, 3 shifted seq1
258 assertPrecedes("-AAA", "G--GG"); // 2 shifted seq2, 3 shifted seq2
261 * 9 cases where first position is shifted in second sequence.
263 assertPrecedes("A-AA", "-GGG"); // 2 and 3 match
264 assertPrecedes("A-A-A", "-GGG"); // 2 matches, 3 shifted seq1
265 assertPrecedes("A-AA", "-GG-G"); // 2 matches, 3 shifted seq2
266 assertPrecedes("A--AA", "-GG-G"); // 2 shifted seq1, 3 matches
267 // 'enclosing' case with middle base deciding:
268 assertFollows("A--AA", "-GGG"); // 2 shifted seq1, 3 shifted seq1
269 assertPrecedes("A--AA", "-GG--G"); // 2 shifted seq1, 3 shifted seq2
270 assertPrecedes("AA-A", "-GGG"); // 2 shifted seq2, 3 matches
271 assertPrecedes("AA--A", "-GGG"); // 2 shifted seq2, 3 shifted seq1
272 assertPrecedes("AAA", "-GGG"); // 2 shifted seq2, 3 shifted seq2
276 * This test generates a random cDNA alignment and its translation, then
277 * reorders the cDNA and retranslates, and verifies that the translations are
278 * the same (apart from ordering).
280 @Test(groups = { "Functional" })
281 public void testTranslateCdna_sequenceOrderIndependent()
284 * Generate cDNA - 8 sequences of 12 bases each.
286 AlignmentI cdna = new DnaAlignmentGenerator().generate(12, 8, 97, 5, 5);
287 ColumnSelection cs = new ColumnSelection();
288 AlignViewportI av = new AlignViewport(cdna, cs);
289 Dna dna = new Dna(av, new int[] { 0, cdna.getWidth() - 1 });
290 AlignmentI translated = dna.translateCdna();
293 * Jumble the cDNA sequences and translate.
295 SequenceI[] sorted = new SequenceI[cdna.getHeight()];
296 final int[] jumbler = new int[] { 6, 7, 3, 4, 2, 0, 1, 5 };
298 for (int i : jumbler)
300 sorted[seqNo++] = cdna.getSequenceAt(i);
302 AlignmentI cdnaReordered = new Alignment(sorted);
303 av = new AlignViewport(cdnaReordered, cs);
304 dna = new Dna(av, new int[] { 0, cdna.getWidth() - 1 });
305 AlignmentI translated2 = dna.translateCdna();
308 * Check translated sequences are the same in both alignments.
310 System.out.println("Original");
311 System.out.println(translated.toString());
312 System.out.println("Sorted");
313 System.out.println(translated2.toString());
315 int sortedSequenceIndex = 0;
316 for (int originalSequenceIndex : jumbler)
318 final String translation1 = translated.getSequenceAt(
319 originalSequenceIndex).getSequenceAsString();
320 final String translation2 = translated2.getSequenceAt(
321 sortedSequenceIndex).getSequenceAsString();
322 assertEquals(translation2, translation1);
323 sortedSequenceIndex++;
328 * Test that all the cases in testCompareCodonPos have a 'symmetric'
329 * comparison (without checking the actual comparison result).
331 @Test(groups = { "Functional" })
332 public void testCompareCodonPos_isSymmetric()
334 assertSymmetric("AAA", "GGG");
335 assertSymmetric("AA-A", "GGG");
336 assertSymmetric("AAA", "GG-G");
337 assertSymmetric("A-AA", "GG-G");
338 assertSymmetric("A-A-A", "GG-G");
339 assertSymmetric("A-AA", "GG--G");
340 assertSymmetric("AA-A", "G-GG");
341 assertSymmetric("AA--A", "G-GG");
342 assertSymmetric("AAA", "G-GG");
343 assertSymmetric("-AAA", "G-GG");
344 assertSymmetric("-AA-A", "G-GG");
345 assertSymmetric("-AAA", "G-G-G");
346 assertSymmetric("-A-AA", "G-G-G");
347 assertSymmetric("-A-A-A", "G-G-G");
348 assertSymmetric("-A-AA", "G-G--G");
349 assertSymmetric("-AA-A", "G--GG");
350 assertSymmetric("-AA--A", "G--GG");
351 assertSymmetric("-AAA", "G--GG");
352 assertSymmetric("A-AA", "-GGG");
353 assertSymmetric("A-A-A", "-GGG");
354 assertSymmetric("A-AA", "-GG-G");
355 assertSymmetric("A--AA", "-GG-G");
356 assertSymmetric("A--AA", "-GGG");
357 assertSymmetric("A--AA", "-GG--G");
358 assertSymmetric("AA-A", "-GGG");
359 assertSymmetric("AA--A", "-GGG");
360 assertSymmetric("AAA", "-GGG");
363 private void assertSymmetric(String codon1, String codon2)
365 assertEquals("Comparison of '" + codon1 + "' and '" + codon2
366 + " not symmetric", Integer.signum(compare(codon1, codon2)),
367 -Integer.signum(compare(codon2, codon1)));
371 * Assert that the first sequence should map to the same position as the
372 * second in a translated alignment. Also checks that this is true if the
373 * order of the codons is reversed.
378 private void assertMatches(String codon1, String codon2)
380 assertEquals("Expected '" + codon1 + "' matches '" + codon2 + "'", 0,
381 compare(codon1, codon2));
382 assertEquals("Expected '" + codon2 + "' matches '" + codon1 + "'", 0,
383 compare(codon2, codon1));
387 * Assert that the first sequence should precede the second in a translated
393 private void assertPrecedes(String codon1, String codon2)
395 assertEquals("Expected '" + codon1 + "' precedes '" + codon2 + "'",
396 -1, compare(codon1, codon2));
400 * Assert that the first sequence should follow the second in a translated
406 private void assertFollows(String codon1, String codon2)
408 assertEquals("Expected '" + codon1 + "' follows '" + codon2 + "'", 1,
409 compare(codon1, codon2));
413 * Convert two nucleotide strings to base positions and pass to
414 * Dna.compareCodonPos, return the result.
420 private int compare(String s1, String s2)
422 final AlignedCodon cd1 = convertCodon(s1);
423 final AlignedCodon cd2 = convertCodon(s2);
424 System.out.println("K: " + s1 + " " + cd1.toString());
425 System.out.println("G: " + s2 + " " + cd2.toString());
426 System.out.println();
427 return Dna.compareCodonPos(cd1, cd2);
431 * Convert a string e.g. "-GC-T" to base positions e.g. [1, 2, 4]. The string
432 * should have exactly 3 non-gap characters, and use '-' for gaps.
437 private AlignedCodon convertCodon(String s)
439 int[] codon = new int[3];
441 for (int j = 0; j < s.length(); j++)
443 if (s.charAt(j) != '-')
448 return new AlignedCodon(codon[0], codon[1], codon[2]);
452 * Weirdly, maybe worth a test to prove the helper method of this test class.
454 @Test(groups = { "Functional" })
455 public void testConvertCodon()
457 assertEquals("[0, 1, 2]", convertCodon("AAA").toString());
458 assertEquals("[0, 2, 5]", convertCodon("A-A--A").toString());
459 assertEquals("[1, 3, 4]", convertCodon("-A-AA-").toString());
463 * Test dna complementing
465 @Test(groups = "Functional")
466 public void testGetComplement()
468 assertEquals('t', Dna.getComplement('a'));
469 assertEquals('T', Dna.getComplement('A'));
470 assertEquals('a', Dna.getComplement('t'));
471 assertEquals('A', Dna.getComplement('T'));
472 assertEquals('c', Dna.getComplement('g'));
473 assertEquals('C', Dna.getComplement('G'));
474 assertEquals('g', Dna.getComplement('c'));
475 assertEquals('G', Dna.getComplement('C'));
476 // note uU --> aA but not vice versa
477 assertEquals('a', Dna.getComplement('u'));
478 assertEquals('A', Dna.getComplement('U'));
479 // ambiguity codes, see http://www.bioinformatics.org/sms/iupac.html
480 assertEquals('r', Dna.getComplement('y'));
481 assertEquals('R', Dna.getComplement('Y'));
482 assertEquals('y', Dna.getComplement('r'));
483 assertEquals('Y', Dna.getComplement('R'));
484 assertEquals('k', Dna.getComplement('m'));
485 assertEquals('K', Dna.getComplement('M'));
486 assertEquals('m', Dna.getComplement('k'));
487 assertEquals('M', Dna.getComplement('K'));
488 assertEquals('b', Dna.getComplement('v'));
489 assertEquals('B', Dna.getComplement('V'));
490 assertEquals('v', Dna.getComplement('b'));
491 assertEquals('V', Dna.getComplement('B'));
492 assertEquals('d', Dna.getComplement('h'));
493 assertEquals('D', Dna.getComplement('H'));
494 assertEquals('h', Dna.getComplement('d'));
495 assertEquals('H', Dna.getComplement('D'));
496 assertEquals('Q', Dna.getComplement('Q'));
499 @Test(groups = "Functional")
500 public void testReverseSequence()
502 String seq = "-Ac-GtU--rYkMbVdHNX-";
503 String seqRev = new StringBuilder(seq).reverse().toString();
506 SequenceI reversed = Dna.reverseSequence("Seq1", seq, false);
507 assertEquals(1, reversed.getStart());
508 assertEquals(15, reversed.getEnd());
509 assertEquals(20, reversed.getLength());
510 assertEquals(seqRev, reversed.getSequenceAsString());
511 assertEquals("Seq1|rev", reversed.getName());
513 // reverse complement:
514 SequenceI revcomp = Dna.reverseSequence("Seq1", seq, true);
515 assertEquals("-XNDhBvKmRy--AaC-gT-", revcomp.getSequenceAsString());
516 assertEquals("Seq1|revcomp", revcomp.getName());
519 @Test(groups = "Functional")
520 public void testReverseCdna()
522 String seq = "-Ac-GtU--rYkMbVdHNX-";
523 String seqRev = new StringBuilder(seq).reverse().toString();
524 String seqDs = seq.replaceAll("-", "");
525 String seqDsRev = new StringBuilder(seqDs).reverse().toString();
527 SequenceI dna = new Sequence("Seq1", seq);
528 Alignment al = new Alignment(new SequenceI[] {dna});
529 al.createDatasetAlignment();
530 assertEquals(seqDs, al.getSequenceAt(0).getDatasetSequence()
531 .getSequenceAsString());
533 ColumnSelection cs = new ColumnSelection();
534 AlignViewportI av = new AlignViewport(al, cs);
535 Dna testee = new Dna(av, new int[] { 0, al.getWidth() - 1 });
536 AlignmentI reversed = testee.reverseCdna(false);
537 assertEquals(1, reversed.getHeight());
538 assertEquals(seqRev, reversed.getSequenceAt(0).getSequenceAsString());
539 assertEquals(seqDsRev, reversed.getSequenceAt(0).getDatasetSequence()
540 .getSequenceAsString());