1 /* Copyright (c) 2009 Peter Troshin
\r
3 * JAva Bioinformatics Analysis Web Services (JABAWS) @version: 1.0
\r
5 * This library is free software; you can redistribute it and/or modify it under the terms of the
\r
6 * Apache License version 2 as published by the Apache Software Foundation
\r
8 * This library is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without
\r
9 * even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the Apache
\r
10 * License for more details.
\r
12 * A copy of the license is in apache_license.txt. It is also available here:
\r
13 * @see: http://www.apache.org/licenses/LICENSE-2.0.txt
\r
15 * Any republication or derived work distributed in source code form
\r
16 * must include this copyright and license notice.
\r
19 package compbio.ws.client;
\r
21 import static compbio.ws.client.Constraints.hostkey;
\r
22 import static compbio.ws.client.Constraints.pseparator;
\r
23 import static compbio.ws.client.Constraints.servicekey;
\r
25 import java.io.ByteArrayInputStream;
\r
26 import java.io.Closeable;
\r
27 import java.io.IOException;
\r
28 import java.io.PrintWriter;
\r
29 import java.util.Arrays;
\r
30 import java.util.List;
\r
32 import javax.xml.ws.WebServiceException;
\r
34 import org.apache.log4j.Logger;
\r
36 import compbio.data.msa.JABAService;
\r
37 import compbio.data.msa.Metadata;
\r
38 import compbio.data.msa.MsaWS;
\r
39 import compbio.data.msa.SequenceAnnotation;
\r
40 import compbio.data.sequence.Alignment;
\r
41 import compbio.data.sequence.FastaSequence;
\r
42 import compbio.data.sequence.ScoreManager;
\r
43 import compbio.data.sequence.SequenceUtil;
\r
44 import compbio.metadata.JobStatus;
\r
45 import compbio.metadata.JobSubmissionException;
\r
46 import compbio.metadata.Limit;
\r
47 import compbio.metadata.LimitsManager;
\r
48 import compbio.metadata.Option;
\r
49 import compbio.metadata.Preset;
\r
50 import compbio.metadata.PresetManager;
\r
51 import compbio.metadata.ResultNotAvailableException;
\r
52 import compbio.metadata.RunnerConfig;
\r
53 import compbio.metadata.UnsupportedRuntimeException;
\r
54 import compbio.metadata.WrongParameterException;
\r
57 * Class for testing web services
\r
61 * @version 1.0 February 2010
\r
63 public class WSTester {
\r
65 private static Logger log = Logger.getLogger(WSTester.class);
\r
67 * Sequences to be used as input for all WS
\r
69 static final String fastaInput = ">Foo\n"
\r
70 + "MTADGPRELLQLRAAVRHRPQDFVAWLMLADAELGMGDTTAGEMAVQRGLALHPGHPEAV"
\r
72 + "ASDAAPEHPGIALWLHALEDAGQAEAAAAYTRAHQLLPEEPYITAQLLNAVA";
\r
74 static final String fastaAlignment = ">Foo\r\n"
\r
75 + "MTADGPRELLQLRAAVRHRPQDFVAWLMLADAELGMGDTTAGEMAVQRGLALHPGHPEAV--------\r\n"
\r
77 + "ASDAAPEH------------PGIALWLHALE-DAGQAEAAA---AYTRAHQLLPEEPYITAQLLNAVA\r\n"
\r
80 static final List<FastaSequence> seqs = loadSeqs();
\r
82 private static final String FAILED = "FAILED";
\r
83 private static final String OK = "OK";
\r
85 private static final String UNSUPPORTED = "UNSUPPORTED";
\r
88 * Converting input to a form accepted by WS
\r
90 * @return List of FastaSequence records
\r
92 static List<FastaSequence> loadSeqs() {
\r
94 return SequenceUtil.readFasta(new ByteArrayInputStream(fastaInput
\r
96 } catch (IOException ignored) {
\r
97 // Should not happen as a source is not a external stream
\r
98 ignored.printStackTrace();
\r
104 * Converting input to a form accepted by WS
\r
106 * @return List of FastaSequence records
\r
108 static List<FastaSequence> loadAlignment() {
\r
110 return SequenceUtil.readFasta(new ByteArrayInputStream(
\r
111 fastaAlignment.getBytes()));
\r
112 } catch (IOException ignored) {
\r
113 // Should not happen as a source is not a external stream
\r
114 ignored.printStackTrace();
\r
119 private final PrintWriter writer;
\r
121 public WSTester(PrintWriter writer) {
\r
122 this.writer = writer;
\r
128 void printUsage() {
\r
129 writer.println("Usage: <Class or Jar file name> " + hostkey
\r
130 + pseparator + "host_and_context " + "<" + servicekey
\r
131 + pseparator + "serviceName>");
\r
133 writer.println(hostkey
\r
135 + "<host_and_context> - a full URL to the JABAWS web server including context path e.g. http://10.31.1.159:8080/ws");
\r
136 writer.println(servicekey
\r
138 + "<ServiceName> - optional if unspecified all services are tested otherwise one of "
\r
139 + Arrays.toString(Services.values()));
\r
145 * Calls alignment with preset
\r
150 * list of the Preset
\r
151 * @throws UnsupportedRuntimeException
\r
153 <T> boolean presetAlign(MsaWS<T> msaws, List<Preset<T>> presets)
\r
154 throws UnsupportedRuntimeException {
\r
155 boolean succeed = false;
\r
156 for (Preset<T> preset : presets) {
\r
157 writer.print("Aligning with preset '" + preset.getName() + "'... ");
\r
158 Alignment al = null;
\r
160 String taskId = msaws.presetAlign(seqs, preset);
\r
161 al = msaws.getResult(taskId);
\r
163 writer.println(OK);
\r
166 } catch (UnsupportedRuntimeException e) {
\r
167 writer.println(FAILED);
\r
168 // If executable is not supported than none of the presets are
\r
170 throw new UnsupportedRuntimeException(e);
\r
171 } catch (JobSubmissionException e) {
\r
172 // TODO custom message
\r
173 writer.println(FAILED);
\r
175 writer.println(e.getLocalizedMessage());
\r
176 e.printStackTrace(writer);
\r
178 } catch (WrongParameterException e) {
\r
179 // TODO custom message
\r
180 writer.println(FAILED);
\r
182 writer.println(e.getLocalizedMessage());
\r
183 e.printStackTrace(writer);
\r
185 } catch (ResultNotAvailableException e) {
\r
186 // TODO custom message
\r
187 writer.println(FAILED);
\r
189 writer.println(e.getLocalizedMessage());
\r
190 e.printStackTrace(writer);
\r
197 private <T> boolean testMsaWS(MsaWS<T> msaws)
\r
198 throws UnsupportedRuntimeException {
\r
200 boolean succeed = testDefaultAlignment(msaws);
\r
202 // If exception above is thrown than the tests below is not run
\r
204 PresetManager<T> pmanager = msaws.getPresets();
\r
205 if (pmanager != null && pmanager.getPresets().size() > 0) {
\r
206 writer.println("Testing alignment with presets:");
\r
207 List<Preset<T>> plist = pmanager.getPresets();
\r
208 succeed = !succeed ? presetAlign(msaws, plist) : succeed;
\r
210 testMetadata(msaws);
\r
214 * Call most of web services functions and check the output
\r
219 * @throws UnsupportedRuntimeException
\r
220 * is thrown if the connection to a web service was made, but
\r
221 * the web service is not functional. e.g. when native
\r
222 * executable does not exists for a server platform
\r
224 @SuppressWarnings("unchecked")
\r
225 public <T> boolean checkService(JABAService wservice) {
\r
227 if (wservice == null) {
\r
228 throw new NullPointerException(
\r
229 "JABAService instance must be provided!");
\r
231 if (wservice instanceof MsaWS) {
\r
232 return testMsaWS((MsaWS<T>) wservice);
\r
233 } else if (wservice instanceof SequenceAnnotation) {
\r
234 return testSequenceAnnotationWS((SequenceAnnotation<T>) wservice);
\r
236 throw new UnsupportedOperationException("The service: "
\r
237 + wservice.getClass() + " is not supported! ");
\r
239 } catch (UnsupportedRuntimeException e) {
\r
240 writer.println(e.getLocalizedMessage());
\r
241 e.printStackTrace(writer);
\r
246 private <T> boolean testSequenceAnnotationWS(SequenceAnnotation<T> wservice)
\r
247 throws UnsupportedRuntimeException {
\r
248 boolean success = testDefaultAnalyse(loadAlignment(), wservice, null,
\r
250 PresetManager<T> presetman = wservice.getPresets();
\r
251 if (presetman != null) {
\r
252 List<Preset<T>> presets = presetman.getPresets();
\r
253 if (presets != null && !presets.isEmpty()) {
\r
254 Preset<T> preset = presets.get(0);
\r
255 success = testDefaultAnalyse(loadAlignment(), wservice, preset,
\r
259 testMetadata(wservice);
\r
263 <T> boolean testDefaultAnalyse(List<FastaSequence> fastalist,
\r
264 SequenceAnnotation<T> wsproxy, Preset<T> preset,
\r
265 List<Option<T>> customOptions) throws UnsupportedRuntimeException {
\r
267 ScoreManager scores = null;
\r
269 String jobId = null;
\r
270 if (customOptions != null) {
\r
271 jobId = wsproxy.customAnalize(fastalist, customOptions);
\r
272 } else if (preset != null) {
\r
273 jobId = wsproxy.presetAnalize(fastalist, preset);
\r
275 jobId = wsproxy.analize(fastalist);
\r
277 writer.println("\n\ncalling analise.........");
\r
278 Thread.sleep(1000);
\r
279 scores = wsproxy.getAnnotation(jobId);
\r
281 } catch (JobSubmissionException e) {
\r
282 writer.println("Exception while submitting job to a web server. "
\r
283 + "Exception details are below:");
\r
284 e.printStackTrace(writer);
\r
285 } catch (ResultNotAvailableException e) {
\r
286 writer.println("Exception while waiting for results. "
\r
287 + "Exception details are below:");
\r
288 e.printStackTrace(writer);
\r
289 } catch (InterruptedException e) {
\r
290 // ignore and propagate an interruption
\r
291 Thread.currentThread().interrupt();
\r
292 writer.println("Exception while waiting for results. "
\r
293 + "Exception details are below:");
\r
294 e.printStackTrace(writer);
\r
295 } catch (WrongParameterException e) {
\r
296 writer.println("Exception while parsing the web method input parameters. "
\r
297 + "Exception details are below:");
\r
298 e.printStackTrace(writer);
\r
300 return scores != null;
\r
303 private <T> void testMetadata(Metadata<T> msaws)
\r
304 throws UnsupportedRuntimeException {
\r
306 writer.print("Querying presets...");
\r
307 PresetManager<T> pmanager = msaws.getPresets();
\r
308 if (pmanager != null && pmanager.getPresets().size() > 0) {
\r
309 writer.println(OK);
\r
311 writer.println(UNSUPPORTED);
\r
314 writer.print("Querying Parameters...");
\r
315 RunnerConfig<T> options = msaws.getRunnerOptions();
\r
316 if (options != null && options.getArguments().size() > 0) {
\r
317 writer.println(OK);
\r
319 writer.println(UNSUPPORTED);
\r
322 writer.print("Querying Limits...");
\r
323 LimitsManager<T> limits = msaws.getLimits();
\r
324 if (limits != null && limits.getLimits().size() > 0) {
\r
325 writer.println(OK);
\r
327 writer.println(UNSUPPORTED);
\r
330 writer.print("Querying Local Engine Limits...");
\r
331 Limit<T> localLimit = msaws
\r
332 .getLimit(PresetManager.LOCAL_ENGINE_LIMIT_PRESET);
\r
333 if (localLimit != null) {
\r
334 writer.println(OK);
\r
336 writer.println(UNSUPPORTED);
\r
341 * Align using default settings
\r
345 * @throws UnsupportedRuntimeException
\r
347 public <T> boolean testDefaultAlignment(MsaWS<T> msaws)
\r
348 throws UnsupportedRuntimeException {
\r
349 writer.print("Testing alignment with default parameters:");
\r
350 Alignment al = null;
\r
351 boolean succeed = false;
\r
353 String taskId = msaws.align(seqs);
\r
354 writer.print("\nQuerying job status...");
\r
355 JobStatus status = msaws.getJobStatus(taskId);
\r
356 while (status != JobStatus.FINISHED) {
\r
357 Thread.sleep(1000);
\r
358 status = msaws.getJobStatus(taskId);
\r
360 writer.println(OK);
\r
361 writer.print("Retrieving results...");
\r
362 al = msaws.getResult(taskId);
\r
364 } catch (ResultNotAvailableException e) {
\r
365 writer.println(FAILED);
\r
366 writer.println(e.getLocalizedMessage());
\r
367 e.printStackTrace(writer);
\r
368 } catch (JobSubmissionException e) {
\r
369 writer.println(FAILED);
\r
371 writer.println(e.getLocalizedMessage());
\r
372 e.printStackTrace(writer);
\r
373 } catch (InterruptedException e) {
\r
374 writer.println(FAILED);
\r
376 writer.println(e.getLocalizedMessage());
\r
377 e.printStackTrace(writer);
\r
380 writer.println(OK);
\r
386 * Connect to a WS using the host and the service name
\r
393 <T> JABAService connect(String host, Services service) {
\r
394 JABAService jabaservice = null;
\r
396 writer.print("Connecting to service " + service + " on " + host
\r
398 jabaservice = Jws2Client.connect(host, service);
\r
399 writer.println(OK);
\r
400 } catch (WebServiceException e) {
\r
401 writer.println(FAILED);
\r
402 writer.println(e.getLocalizedMessage());
\r
403 e.printStackTrace(writer);
\r
405 return jabaservice;
\r
409 * Test JWS2 web services
\r
414 * -h=<Your web application server host name, port and JWS2
\r
417 * -s=<ServiceName> which is optional. If service name is not
\r
418 * provided then all known JWS2 web services are tested
\r
419 * @throws IOException
\r
421 public static <T> void main(String[] args) throws IOException {
\r
422 WSTester tester = new WSTester(new PrintWriter(System.out, true));
\r
423 if (args == null || args.length < 1) {
\r
424 tester.printUsage();
\r
427 String host = CmdHelper.getHost(args);
\r
428 String serviceName = CmdHelper.getServiceName(args);
\r
429 if (!Jws2Client.validURL(host)) {
\r
431 .println("<host_and_context> parameter is not provided or is incorrect!");
\r
434 boolean succeed = false;
\r
435 MsaWS<T> msaws = null;
\r
436 if (serviceName != null) {
\r
437 Services service = Services.getService(serviceName);
\r
438 if (service == null) {
\r
439 tester.writer.println("Service '" + serviceName
\r
440 + "' is not supported. Valid values are: "
\r
441 + Arrays.toString(Services.values()));
\r
442 tester.writer.println();
\r
443 tester.printUsage();
\r
447 msaws = (MsaWS<T>) tester.connect(host, service);
\r
448 if (msaws == null) {
\r
452 succeed = tester.checkService(msaws);
\r
454 ((Closeable) msaws).close();
\r
456 // TODO test results printing!
\r
457 tester.reportResults(service, succeed);
\r
462 .println("<ServiceName> is not provided checking all known services...");
\r
464 for (Services serv : Services.values()) {
\r
465 tester.writer.println();
\r
466 msaws = (MsaWS<T>) tester.connect(host, serv);
\r
467 if (msaws == null) {
\r
471 succeed = tester.checkService(msaws);
\r
473 ((Closeable) msaws).close();
\r
475 tester.reportResults(serv, succeed);
\r
479 private void reportResults(Services serv, boolean succeed) {
\r
481 writer.println("Check is completed. The Service " + serv
\r
484 writer.println("Check is completed. The Service " + serv
\r
485 + " HAS SOME PROBLEMS");
\r