/* masks_test.c * SRE, Tue Nov 18 11:10:20 1997 [St. Louis] * * Test driver for sequence masking routines in masks.c * * CVS $Id: masks_test.c,v 1.1.1.1 2005/03/22 08:34:46 cmzmasek Exp $ */ #include #include "structs.h" #include "funcs.h" #include "globals.h" #include "squid.h" static char banner[] = "\ masks_test : testing of repeat masking code in masks.c"; static char usage[] = "\ Usage: testdriver [-options]\n\ Available options are:\n\ -h : help; display this usage info\n\ -v : verbose output\n\ "; static char experts[] = "\ --xnu : apply xnu to seqs in \n\ \n"; static struct opt_s OPTIONS[] = { { "-h", TRUE, sqdARG_NONE }, { "-v", TRUE, sqdARG_NONE }, { "--xnu", FALSE, sqdARG_STRING }, }; #define NOPTIONS (sizeof(OPTIONS) / sizeof(struct opt_s)) /* The test sequence and result from the XNU software distribution */ static char *test1 = "\ ACDEFGHIKLMNPQRQRQRQRQRQRQRQRQRSTVWYACDEFGHIKLMNPQRQRQRQRQRQ\ RQRQRQRSTVWYACDEFGHIKLMNPQRQRQRQRQRQRQRQRQRSTVWYACDEFGHIKLMN\ PQRQRQRQRQRQRQRQRQRSTVWYACDEFGHIKLMNPQRQRQRQRQRQRQRQRQRSTVWY\ ACDEFGHIKLMNPQRQRQRQRQRQRQRQRQRSTVWY"; static char *answer1 = "\ ACDEFGHIKLMNPXXXXXXXXXXXXXXXXXXSTVWYACDEFGHIKLMNPXXXXXXXXXXX\ XXXXXXXSTVWYACDEFGHIKLMNPXXXXXXXXXXXXXXXXXXSTVWYACDEFGHIKLMN\ PXXXXXXXXXXXXXXXXXXSTVWYACDEFGHIKLMNPXXXXXXXXXXXXXXXXXXSTVWY\ ACDEFGHIKLMNPXXXXXXXXXXXXXXXXXXSTVWY"; int main(int argc, char **argv) { char *seq; char *dsq; int len; int i,j; char *result; char *optname; /* name of option found by Getopt() */ char *optarg; /* argument found by Getopt() */ int optind; /* index in argv[] */ int be_verbose; char *xnufile; /* NULL, or file to run xnu on */ /*********************************************** * Parse command line ***********************************************/ be_verbose = FALSE; xnufile = NULL; while (Getopt(argc, argv, OPTIONS, NOPTIONS, usage, &optind, &optname, &optarg)) { if (strcmp(optname, "-v") == 0) { be_verbose = TRUE; } else if (strcmp(optname, "--xnu") == 0) { xnufile = optarg; } else if (strcmp(optname, "-h") == 0) { Banner(stdout, banner); puts(usage); puts(experts); exit(0); } } if (argc - optind != 0) Die("Incorrect number of arguments.\n%s\n", usage); SetAlphabet(hmmAMINO); /* XNU test */ seq = test1; len = (int) strlen(seq); dsq = DigitizeSequence(seq, len); XNU(dsq, len); result = MallocOrDie(sizeof(char) * (len+1)); for (i = 0; i < len; i++) result[i] = Alphabet[(int) dsq[i+1]]; result[len] = '\0'; if (be_verbose) { printf("XNU test:\n"); for (i = 1; i <= len; i+=60) { for (j = i; j < i+60 && j <= len; j++) putc(Alphabet[(int) dsq[j]], stdout); putc('\n', stdout); } if (strcmp(answer1, result) == 0) printf("-- OK; Identical to expected\n"); } if (strcmp(answer1, result) != 0) Die("XNU test failed."); free(result); free(dsq); /* On demand XNU test. */ if (xnufile != NULL) { int format; SQFILE *sqfp; SQINFO sqinfo; int xnum; if ((sqfp = SeqfileOpen(xnufile, SQFILE_UNKNOWN, NULL)) == NULL) Die("Failed to open sequence database file %s\n%s\n", xnufile, usage); while (ReadSeq(sqfp, sqfp->format, &seq, &sqinfo)) { dsq = DigitizeSequence(seq, sqinfo.len); xnum = XNU(dsq, sqinfo.len); result = DedigitizeSequence(dsq, sqinfo.len); printf("%-20s\t%5d\n", sqinfo.name, xnum); if (be_verbose) WriteSeq(stdout, SQFILE_FASTA, result, &sqinfo); free(dsq); FreeSequence(seq, &sqinfo); free(result); } SeqfileClose(sqfp); } return EXIT_SUCCESS; }