// $Id: // forester -- software libraries and applications // for genomics and evolutionary biology research. // // Copyright (C) 2010 Christian M Zmasek // Copyright (C) 2010 Sanford-Burnham Medical Research Institute // All rights reserved // // This library is free software; you can redistribute it and/or // modify it under the terms of the GNU Lesser General Public // License as published by the Free Software Foundation; either // version 2.1 of the License, or (at your option) any later version. // // This library is distributed in the hope that it will be useful, // but WITHOUT ANY WARRANTY; without even the implied warranty of // MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU // Lesser General Public License for more details. // // You should have received a copy of the GNU Lesser General Public // License along with this library; if not, write to the Free Software // Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301, USA // // Contact: phylosoft @ gmail . com // WWW: https://sites.google.com/site/cmzmasek/home/software/forester package org.forester.ws.seqdb; import java.util.ArrayList; import java.util.List; import java.util.regex.Matcher; import java.util.regex.Pattern; import org.forester.go.GoTerm; import org.forester.phylogeny.data.Accession; import org.forester.phylogeny.data.Annotation; import org.forester.util.ForesterUtil; public final class EbiDbEntry implements SequenceDatabaseEntry { // public static SequenceDatabaseEntry createInstanceFromPlainText( final List lines ) { // final EbiDbEntry e = new EbiDbEntry(); // for( final String line : lines ) { // if ( line.startsWith( "PA" ) ) { // e.setPA( SequenceDbWsTools.extractFrom( line, "PA" ) ); // } // else if ( line.startsWith( "DE" ) ) { // e.setDe( SequenceDbWsTools.extractFrom( line, "DE" ) ); // } // else if ( line.startsWith( "OS" ) ) { // if ( line.indexOf( "(" ) > 0 ) { // e.setOs( SequenceDbWsTools.extractFromTo( line, "OS", "(" ) ); // } // else { // e.setOs( SequenceDbWsTools.extractFrom( line, "OS" ) ); // } // } // else if ( line.startsWith( "OX" ) ) { // if ( line.indexOf( "NCBI_TaxID=" ) > 0 ) { // e.setTaxId( SequenceDbWsTools.extractFromTo( line, "NCBI_TaxID=", ";" ) ); // } // } // } // return e; // } public static SequenceDatabaseEntry createInstanceFromPlainTextForRefSeq( final List lines ) { final Pattern X_PATTERN = Pattern.compile( "^[A-Z]+" ); final Pattern chromosome_PATTERN = Pattern.compile( "\\s+/chromosome=\"(\\w+)\"" ); final Pattern map_PATTERN = Pattern.compile( "\\s+/map=\"([\\w+\\.])\"" ); final Pattern gene_PATTERN = Pattern.compile( "\\s+/gene=\"(.+)\"" ); final Pattern mim_xref_PATTERN = Pattern.compile( "\\s+/db_xref=\"MIM:(\\d+)\"" ); final Pattern taxon_xref_PATTERN = Pattern.compile( "\\s+/db_xref=\"taxon:(\\d+)\"" ); final Pattern interpro_PATTERN = Pattern.compile( "\\s+/db_xref=\"InterPro:(IP\\d+)\"" ); final Pattern uniprot_PATTERN = Pattern.compile( "\\s+/db_xref=\"UniProtKB/TrEMBL:(\\w+)\"" ); final Pattern ec_PATTERN = Pattern.compile( "\\s+/EC_number=\"([\\.\\-\\d]+)\"" ); final EbiDbEntry e = new EbiDbEntry(); final StringBuilder def = new StringBuilder(); boolean in_definition = false; boolean in_features = false; boolean in_source = false; boolean in_gene = false; boolean in_cds = false; boolean in_protein = false; for( final String line : lines ) { if ( line.startsWith( "ACCESSION " ) ) { e.setAccession( SequenceDbWsTools.extractFrom( line, "ACCESSION" ) ); in_definition = false; } else if ( line.startsWith( "ID " ) ) { e.setAccession( SequenceDbWsTools.extractFromTo( line, "ID", ";" ) ); in_definition = false; } else if ( line.startsWith( "DEFINITION " ) || ( line.startsWith( "DE " ) ) ) { boolean definiton = false; if ( line.startsWith( "DEFINITION " ) ) { definiton = true; } if ( line.indexOf( "[" ) > 0 ) { if ( definiton ) { x( def, ( SequenceDbWsTools.extractFromTo( line, "DEFINITION", "[" ) ) ); } else { x( def, ( SequenceDbWsTools.extractFromTo( line, "DE", "[" ) ) ); } } else if ( line.indexOf( "." ) > 0 ) { if ( definiton ) { x( def, ( SequenceDbWsTools.extractFromTo( line, "DEFINITION", "." ) ) ); } else { x( def, ( SequenceDbWsTools.extractFromTo( line, "DE", "." ) ) ); } } else { if ( definiton ) { x( def, ( SequenceDbWsTools.extractFrom( line, "DEFINITION" ) ) ); } else { x( def, ( SequenceDbWsTools.extractFrom( line, "DE" ) ) ); } } if ( definiton ) { in_definition = true; } } else if ( line.startsWith( " ORGANISM " ) ) { if ( line.indexOf( "(" ) > 0 ) { e.setTaxonomyScientificName( SequenceDbWsTools.extractFromTo( line, " ORGANISM", "(" ) ); } else { e.setTaxonomyScientificName( SequenceDbWsTools.extractFrom( line, " ORGANISM" ) ); } // in_def = false; } else if ( line.startsWith( "OS " ) ) { if ( line.indexOf( "(" ) > 0 ) { e.setTaxonomyScientificName( SequenceDbWsTools.extractFromTo( line, "OS", "(" ) ); } else { e.setTaxonomyScientificName( SequenceDbWsTools.extractFrom( line, "OS" ) ); } } else if ( line.startsWith( " " ) && in_definition ) { def.append( " " ); if ( line.indexOf( "[" ) > 0 ) { def.append( SequenceDbWsTools.extractTo( line, "[" ) ); } else if ( line.indexOf( "." ) > 0 ) { def.append( SequenceDbWsTools.extractTo( line, "." ) ); } else { def.append( line.trim() ); } } else { in_definition = false; } if ( !line.startsWith( "FT " ) && X_PATTERN.matcher( line ).find() ) { in_features = false; in_source = false; in_gene = false; in_cds = false; in_protein = false; // in_def = false; } if ( line.startsWith( "FEATURES " ) || line.startsWith( "FT " ) ) { in_features = true; } if ( in_features && ( line.startsWith( " source " ) || line.startsWith( "FT source " ) ) ) { in_source = true; in_gene = false; in_cds = false; in_protein = false; } if ( in_features && ( line.startsWith( " gene " ) || line.startsWith( "FT gene " ) ) ) { in_source = false; in_gene = true; in_cds = false; in_protein = false; } if ( in_features && ( line.startsWith( " CDS " ) || line.startsWith( "FT CDS " ) ) ) { in_source = false; in_gene = false; in_cds = true; in_protein = false; } if ( in_features && ( line.startsWith( " Protein " ) || line.startsWith( "FT Protein " ) ) ) { in_source = false; in_gene = false; in_cds = false; in_protein = true; } if ( in_source ) { final Matcher m = taxon_xref_PATTERN.matcher( line ); if ( m.find() ) { e.setTaxId( m.group( 1 ) ); } } if ( in_protein || in_cds ) { final Matcher m = ec_PATTERN.matcher( line ); if ( m.find() ) { e.addAnnotation( new Annotation( "EC", m.group( 1 ) ) ); } } if ( in_protein || in_cds || in_gene ) { final Matcher m = gene_PATTERN.matcher( line ); if ( m.find() ) { e.setGeneName( m.group( 1 ) ); } } } if ( def.length() > 0 ) { e.setSequenceName( def.toString().trim() ); } return e; } private static void x( final StringBuilder sb, final String s ) { if ( sb.length() > 0 ) { sb.append( " " ); } sb.append( s.trim() ); } // FIXME actually this is NCBI entry //http://www.ebi.ac.uk/Tools/dbfetch/dbfetch/emb/AAR37336/ private String _pa; private String _de; private String _os; private String _tax_id; private String _symbol; private String _provider; private List _cross_references; private List _annotations; private String _gene_name; // TODO PUBMED 15798186 //TODO (FEATURES) // source /db_xref="taxon:9606" // gene 1..2881 // /gene="RBM39" // // /db_xref="MIM:604739" // CDS // /gene="RBM39" // /db_xref="MIM:604739" // /db_xref="InterPro:IPR002475" // /product="Bcl-2" // /db_xref="UniProtKB/TrEMBL:Q5J7V1" <- reparse? // // Protein /* LOCUS NM_184234 2881 bp mRNA linear PRI 16-JUN-2013 DEFINITION Homo sapiens RNA binding motif protein 39 (RBM39), transcript variant 1, mRNA. ACCESSION NM_184234 VERSION NM_184234.2 GI:336176061 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 2881) AUTHORS Sillars-Hardebol,A.H., Carvalho,B., Belien,J.A., de Wit,M., Delis-van Diemen,P.M., Tijssen,M., van de Wiel,M.A., Ponten,F., Meijer,G.A. and Fijneman,R.J. TITLE CSE1L, DIDO1 and RBM39 in colorectal adenoma to carcinoma progression JOURNAL Cell Oncol (Dordr) 35 (4), 293-300 (2012) PUBMED 22711543 REMARK GeneRIF: Data show that CSE1L, DIDO1 and RBM39 mRNA expression levels correlated with chromosome 20q DNA copy number status. REFERENCE 2 (bases 1 to 2881) AUTHORS Huang,G., Zhou,Z., Wang,H. and Kleinerman,E.S. TITLE CAPER-alpha alternative splicing regulates the expression of vascular endothelial growth factor(1)(6)(5) in Ewing sarcoma cells JOURNAL Cancer 118 (8), 2106-2116 (2012) PUBMED 22009261 REMARK GeneRIF: Increased VEGF(165) expression is secondary to the down-regulation of CAPER-alpha by EWS/FLI-1. CAPER-alpha mediates alternative splicing and controls the shift from VEGF(189) to VEGF(165) . REFERENCE 3 (bases 1 to 2881) AUTHORS Han,B., Stockwin,L.H., Hancock,C., Yu,S.X., Hollingshead,M.G. and Newton,D.L. TITLE Proteomic analysis of nuclei isolated from cancer cell lines treated with indenoisoquinoline NSC 724998, a novel topoisomerase I inhibitor JOURNAL J. Proteome Res. 9 (8), 4016-4027 (2010) PUBMED 20515076 REMARK Erratum:[J Proteome Res. 2011 Apr 1;10(4):2128] REFERENCE 4 (bases 1 to 2881) AUTHORS Zhang,J.Y., Looi,K.S. and Tan,E.M. TITLE Identification of tumor-associated antigens as diagnostic and predictive biomarkers in cancer JOURNAL Methods Mol. Biol. 520, 1-10 (2009) PUBMED 19381943 REFERENCE 5 (bases 1 to 2881) AUTHORS Dutta,J., Fan,G. and Gelinas,C. TITLE CAPERalpha is a novel Rel-TAD-interacting factor that inhibits lymphocyte transformation by the potent Rel/NF-kappaB oncoprotein v-Rel JOURNAL J. Virol. 82 (21), 10792-10802 (2008) PUBMED 18753212 REMARK GeneRIF: this study identifies CAPERalpha (RNA binding motif protein 39) as a new transcriptional coregulator for v-Rel and reveals an important role in modulating Rel's oncogenic activity. REFERENCE 6 (bases 1 to 2881) AUTHORS Cazalla,D., Newton,K. and Caceres,J.F. TITLE A novel SR-related protein is required for the second step of Pre-mRNA splicing JOURNAL Mol. Cell. Biol. 25 (8), 2969-2980 (2005) PUBMED 15798186 REFERENCE 7 (bases 1 to 2881) AUTHORS Dowhan,D.H., Hong,E.P., Auboeuf,D., Dennis,A.P., Wilson,M.M., Berget,S.M. and O'Malley,B.W. TITLE Steroid hormone receptor coactivation and alternative RNA splicing by U2AF65-related proteins CAPERalpha and CAPERbeta JOURNAL Mol. Cell 17 (3), 429-439 (2005) PUBMED 15694343 REFERENCE 8 (bases 1 to 2881) AUTHORS Sun,N.N., Fastje,C.D., Wong,S.S., Sheppard,P.R., Macdonald,S.J., Ridenour,G., Hyde,J.D. and Witten,M.L. TITLE Dose-dependent transcriptome changes by metal ores on a human acute lymphoblastic leukemia cell line JOURNAL Toxicol Ind Health 19 (7-10), 157-163 (2003) PUBMED 15747776 REMARK GeneRIF: 10 genes were down-regulated following treatment of the T-ALL cells with 0.15 and 1.5 microg/mL of metal ores at 72 h REFERENCE 9 (bases 1 to 2881) AUTHORS Jung,D.J., Na,S.Y., Na,D.S. and Lee,J.W. TITLE Molecular cloning and characterization of CAPER, a novel coactivator of activating protein-1 and estrogen receptors JOURNAL J. Biol. Chem. 277 (2), 1229-1234 (2002) PUBMED 11704680 REMARK GeneRIF: This paper describes the mouse gene. REFERENCE 10 (bases 1 to 2881) AUTHORS Imai,H., Chan,E.K., Kiyosawa,K., Fu,X.D. and Tan,E.M. TITLE Novel nuclear autoantigen with splicing factor motifs identified with antibody from hepatocellular carcinoma JOURNAL J. Clin. Invest. 92 (5), 2419-2426 (1993) PUBMED 8227358 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from DC346351.1, BC141835.1 and C75555.1. On Jun 16, 2011 this sequence version replaced gi:35493810. Summary: This gene encodes a member of the U2AF65 family of proteins. The encoded protein is found in the nucleus, where it co-localizes with core spliceosomal proteins. It has been shown to play a role in both steroid hormone receptor-mediated transcription and alternative splicing, and it is also a transcriptional coregulator of the viral oncoprotein v-Rel. Multiple transcript variants have been observed for this gene. A related pseudogene has been identified on chromosome X. [provided by RefSeq, Aug 2011]. Transcript Variant: This variant (1) encodes the longest isoform (a, also called CC1.4). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BC141835.1, L10911.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025081, ERS025082 [ECO:0000350] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-578 DC346351.1 3-580 579-2872 BC141835.1 429-2722 2873-2881 C75555.1 1-9 c FEATURES Location/Qualifiers source 1..2881 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="20" /map="20q11.22" gene 1..2881 /gene="RBM39" /gene_synonym="CAPER; CAPERalpha; FSAP59; HCC1; RNPC2" /note="RNA binding motif protein 39" /db_xref="GeneID:9584" /db_xref="HGNC:15923" /db_xref="HPRD:09201" /db_xref="MIM:604739" exon 1..396 /gene="RBM39" /gene_synonym="CAPER; CAPERalpha; FSAP59; HCC1; RNPC2" /inference="alignment:Splign:1.39.8" STS 35..262 /gene="RBM39" /gene_synonym="CAPER; CAPERalpha; FSAP59; HCC1; RNPC2" /standard_name="REN58946" /db_xref="UniSTS:383746" misc_feature 221..223 /gene="RBM39" /gene_synonym="CAPER; CAPERalpha; FSAP59; HCC1; RNPC2" /note="upstream in-frame stop codon" STS 299..453 /gene="RBM39" /gene_synonym="CAPER; CAPERalpha; FSAP59; HCC1; RNPC2" /standard_name="G64285" /db_xref="UniSTS:158667" exon 397..460 /gene="RBM39" /gene_synonym="CAPER; CAPERalpha; FSAP59; HCC1; RNPC2" /inference="alignment:Splign:1.39.8" CDS 410..2002 /gene="RBM39" /gene_synonym="CAPER; CAPERalpha; FSAP59; HCC1; RNPC2" /note="isoform a is encoded by transcript variant 1; coactivator of activating protein-1 and estrogen receptors; functional spliceosome-associated protein 59; RNA-binding region (RNP1, RRM) containing 2; hepatocellular carcinoma protein 1; splicing factor HCC1" /codon_start=1 /product="RNA-binding protein 39 isoform a" /protein_id="NP_909122.1" /db_xref="GI:35493811" /db_xref="CCDS:CCDS13266.1" /db_xref="GeneID:9584" /db_xref="HGNC:15923" /db_xref="HPRD:09201" /db_xref="MIM:604739" /translation="MADDIDIEAMLEAPYKKDENKLSSANGHEERSKKRKKSKSRSRS HERKRSKSKERKRSRDRERKKSKSRERKRSRSKERRRSRSRSRDRRFRGRYRSPYSGP KFNSAIRGKIGLPHSIKLSRRRSRSKSPFRKDKSPVREPIDNLTPEERDARTVFCMQL AARIRPRDLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFVDVSSVPLAIGLTGQRV LGVPIIVQASQAEKNRAAAMANNLQKGSAGPMRLYVGSLHFNITEDMLRGIFEPFGRI ESIQLMMDSETGRSKGYGFITFSDSECAKKALEQLNGFELAGRPMKVGHVTERTDASS ASSFLDSDELERTGIDLGTTGRLQLMARLAEGTGLQIPPAAQQALQMSGSLAFGAVAE FSFVIDLQTRLSQQTEASALAAAASVQPLATQCFQLSNMFNPQTEEEVGWDTEIKDDV IEECNKHGGVIHIYVDKNSAQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPL PTYHNLFPDSMTATQLLVPSRR" misc_feature 413..415 /gene="RBM39" /gene_synonym="CAPER; CAPERalpha; FSAP59; HCC1; RNPC2" /experiment="experimental evidence, no additional details recorded" /note="N-acetylalanine; propagated from UniProtKB/Swiss-Prot (Q14498.2); acetylation site" exon 461..510 /gene="RBM39" /gene_synonym="CAPER; CAPERalpha; FSAP59; HCC1; RNPC2" /inference="alignment:Splign:1.39.8" exon 1902..2874 /gene="RBM39" /gene_synonym="CAPER; CAPERalpha; FSAP59; HCC1; RNPC2" /inference="alignment:Splign:1.39.8" STS 1956..2182 /gene="RBM39" /gene_synonym="CAPER; CAPERalpha; FSAP59; HCC1; RNPC2" /standard_name="REN58786" /db_xref="UniSTS:383586" STS 2104..2148 /gene="RBM39" /gene_synonym="CAPER; CAPERalpha; FSAP59; HCC1; RNPC2" /standard_name="D19S1033" /db_xref="UniSTS:154759" STS 2145..2400 /gene="RBM39" /gene_synonym="CAPER; CAPERalpha; FSAP59; HCC1; RNPC2" /standard_name="REN58785" /db_xref="UniSTS:383585" polyA_signal 2851..2856 /gene="RBM39" /gene_synonym="CAPER; CAPERalpha; FSAP59; HCC1; RNPC2" polyA_site 2874 /gene="RBM39" /gene_synonym="CAPER; CAPERalpha; FSAP59; HCC1; RNPC2" ORIGIN 1 atttggagct tggggcagct tctcgcgaga gcccgtgctg agggctctgt gaggccccgt 61 gtgtttgtgt gtgtgtatgt gtgctggtga atgtgagtac agggaagcag cggccgccat 121 ttcagggagc ttgtcgacgc tgtcgcaggg gtggatcctg agctgccgaa gccgccgtcc 181 tgctctcccg cgtgggcttc tctaattcca ttgttttttt tagattctct cgggcctagc 241 cgtccttgga acccgatatt cgggctgggc ggttccgcgg cctgggccta ggggcttaac */ private EbiDbEntry() { } private void addCrossReference( final Accession accession ) { if ( _cross_references == null ) { _cross_references = new ArrayList(); } System.out.println( "XREF ADDED: " + accession ); _cross_references.add( accession ); } @Override public Object clone() throws CloneNotSupportedException { throw new CloneNotSupportedException(); } @Override public String getAccession() { return _pa; } @Override public List getCrossReferences() { return _cross_references; } @Override public String getGeneName() { return _gene_name; } @Override public List getGoTerms() { return null; } @Override public String getProvider() { return _provider; } @Override public String getSequenceName() { return _de; } @Override public String getSequenceSymbol() { return _symbol; } @Override public String getTaxonomyIdentifier() { return _tax_id; } @Override public String getTaxonomyScientificName() { return _os; } @Override public boolean isEmpty() { return ( ForesterUtil.isEmpty( getAccession() ) && ForesterUtil.isEmpty( getSequenceName() ) && ForesterUtil.isEmpty( getTaxonomyScientificName() ) && ForesterUtil.isEmpty( getTaxonomyIdentifier() ) && ForesterUtil.isEmpty( getSequenceSymbol() ) ); } private void setSequenceName( final String rec_name ) { if ( _de == null ) { _de = rec_name; } } private void setGeneName( final String gene_name ) { if ( _gene_name == null ) { _gene_name = gene_name; } } private void setTaxonomyScientificName( final String os ) { if ( _os == null ) { _os = os; } } private void setAccession( final String pa ) { if ( _pa == null ) { _pa = pa; } } public void setProvider( final String provider ) { _provider = provider; } private void setTaxId( final String tax_id ) { if ( _tax_id == null ) { _tax_id = tax_id; } } @Override public List getAnnotations() { return _annotations; } private void addAnnotation( final Annotation annotation ) { if ( _annotations == null ) { _annotations = new ArrayList(); } _annotations.add( annotation ); } }