/* * Jalview - A Sequence Alignment Editor and Viewer ($$Version-Rel$$) * Copyright (C) $$Year-Rel$$ The Jalview Authors * * This file is part of Jalview. * * Jalview is free software: you can redistribute it and/or * modify it under the terms of the GNU General Public License * as published by the Free Software Foundation, either version 3 * of the License, or (at your option) any later version. * * Jalview is distributed in the hope that it will be useful, but * WITHOUT ANY WARRANTY; without even the implied warranty * of MERCHANTABILITY or FITNESS FOR A PARTICULAR * PURPOSE. See the GNU General Public License for more details. * * You should have received a copy of the GNU General Public License * along with Jalview. If not, see . * The Jalview Authors are detailed in the 'AUTHORS' file. */ package jalview.datamodel; import static org.testng.AssertJUnit.assertEquals; import static org.testng.AssertJUnit.assertFalse; import static org.testng.AssertJUnit.assertNotNull; import static org.testng.AssertJUnit.assertNull; import static org.testng.AssertJUnit.assertSame; import static org.testng.AssertJUnit.assertTrue; import java.io.IOException; import java.util.Arrays; import java.util.Iterator; import java.util.List; import org.testng.Assert; import org.testng.annotations.BeforeClass; import org.testng.annotations.BeforeMethod; import org.testng.annotations.Test; import jalview.analysis.AlignmentGenerator; import jalview.analysis.AlignmentUtils; import jalview.analysis.CrossRef; import jalview.datamodel.AlignedCodonFrame.SequenceToSequenceMapping; import jalview.gui.JvOptionPane; import jalview.io.DataSourceType; import jalview.io.FastaFile; import jalview.io.FileFormat; import jalview.io.FileFormatI; import jalview.io.FormatAdapter; import jalview.util.Comparison; import jalview.util.MapList; /** * Unit tests for Alignment datamodel. * * @author gmcarstairs * */ public class AlignmentTest { @BeforeClass(alwaysRun = true) public void setUpJvOptionPane() { JvOptionPane.setInteractiveMode(false); JvOptionPane.setMockResponse(JvOptionPane.CANCEL_OPTION); } // @formatter:off private static final String TEST_DATA = "# STOCKHOLM 1.0\n" + "#=GS D.melanogaster.1 AC AY119185.1/838-902\n" + "#=GS D.melanogaster.2 AC AC092237.1/57223-57161\n" + "#=GS D.melanogaster.3 AC AY060611.1/560-627\n" + "D.melanogaster.1 G.AGCC.CU...AUGAUCGA\n" + "#=GR D.melanogaster.1 SS ................((((\n" + "D.melanogaster.2 C.AUUCAACU.UAUGAGGAU\n" + "#=GR D.melanogaster.2 SS ................((((\n" + "D.melanogaster.3 G.UGGCGCU..UAUGACGCA\n" + "#=GR D.melanogaster.3 SS (.(((...(....(((((((\n" + "//"; private static final String AA_SEQS_1 = ">Seq1Name/5-8\n" + "K-QY--L\n" + ">Seq2Name/12-15\n" + "-R-FP-W-\n"; private static final String CDNA_SEQS_1 = ">Seq1Name/100-111\n" + "AC-GG--CUC-CAA-CT\n" + ">Seq2Name/200-211\n" + "-CG-TTA--ACG---AAGT\n"; private static final String CDNA_SEQS_2 = ">Seq1Name/50-61\n" + "GCTCGUCGTACT\n" + ">Seq2Name/60-71\n" + "GGGTCAGGCAGT\n"; // @formatter:on private AlignmentI al; /** * Helper method to load an alignment and ensure dataset sequences are set up. * * @param data * @param format * TODO * @return * @throws IOException */ protected AlignmentI loadAlignment(final String data, FileFormatI format) throws IOException { AlignmentI a = new FormatAdapter().readFile(data, DataSourceType.PASTE, format); a.setDataset(null); return a; } /** * assert wrapper: tests all references in the given alignment are consistent * * @param alignment */ public static void assertAlignmentDatasetRefs(AlignmentI alignment) { verifyAlignmentDatasetRefs(alignment, true, null); } /** * assert wrapper: tests all references in the given alignment are consistent * * @param alignment * @param message * - prefixed to any assert failed messages */ public static void assertAlignmentDatasetRefs(AlignmentI alignment, String message) { verifyAlignmentDatasetRefs(alignment, true, message); } /** * verify sequence and dataset references are properly contained within * dataset * * @param alignment * - the alignmentI object to verify (either alignment or dataset) * @param raiseAssert * - when set, testng assertions are raised. * @param message * - null or a string message to prepend to the assert failed * messages. * @return true if alignment references were in order, otherwise false. */ public static boolean verifyAlignmentDatasetRefs(AlignmentI alignment, boolean raiseAssert, String message) { if (message == null) { message = ""; } if (alignment == null) { if (raiseAssert) { Assert.fail(message + "Alignment for verification was null."); } return false; } if (alignment.getDataset() != null) { AlignmentI dataset = alignment.getDataset(); // check all alignment sequences have their dataset within the dataset for (SequenceI seq : alignment.getSequences()) { SequenceI seqds = seq.getDatasetSequence(); if (seqds.getDatasetSequence() != null) { if (raiseAssert) { Assert.fail(message + " Alignment contained a sequence who's dataset sequence has a second dataset reference."); } return false; } if (dataset.findIndex(seqds) == -1) { if (raiseAssert) { Assert.fail(message + " Alignment contained a sequence who's dataset sequence was not in the dataset."); } return false; } } return verifyAlignmentDatasetRefs(alignment.getDataset(), raiseAssert, message); } else { int dsp = -1; // verify all dataset sequences for (SequenceI seqds : alignment.getSequences()) { dsp++; if (seqds.getDatasetSequence() != null) { if (raiseAssert) { Assert.fail(message + " Dataset contained a sequence with non-null dataset reference (ie not a dataset sequence!)"); } return false; } int foundp = alignment.findIndex(seqds); if (foundp != dsp) { if (raiseAssert) { Assert.fail(message + " Dataset sequence array contains a reference at " + dsp + " to a sequence first seen at " + foundp + " (" + seqds.toString() + ")"); } return false; } if (seqds.getDBRefs() != null) { for (DBRefEntry dbr : seqds.getDBRefs()) { if (dbr.getMap() != null) { SequenceI seqdbrmapto = dbr.getMap().getTo(); if (seqdbrmapto != null) { if (seqdbrmapto.getDatasetSequence() != null) { if (raiseAssert) { Assert.fail(message + " DBRefEntry for sequence in alignment had map to sequence which was not a dataset sequence"); } return false; } if (alignment.findIndex(dbr.getMap().getTo()) == -1) { if (raiseAssert) { Assert.fail(message + " DBRefEntry " + dbr + " for sequence " + seqds + " in alignment has map to sequence not in dataset"); } return false; } } } } } } // finally, verify codonmappings involve only dataset sequences. if (alignment.getCodonFrames() != null) { for (AlignedCodonFrame alc : alignment.getCodonFrames()) { for (SequenceToSequenceMapping ssm : alc.getMappings()) { if (ssm.getFromSeq().getDatasetSequence() != null) { if (raiseAssert) { Assert.fail(message + " CodonFrame-SSM-FromSeq is not a dataset sequence"); } return false; } if (alignment.findIndex(ssm.getFromSeq()) == -1) { if (raiseAssert) { Assert.fail(message + " CodonFrame-SSM-FromSeq is not contained in dataset"); } return false; } if (ssm.getMapping().getTo().getDatasetSequence() != null) { if (raiseAssert) { Assert.fail(message + " CodonFrame-SSM-Mapping-ToSeq is not a dataset sequence"); } return false; } if (alignment.findIndex(ssm.getMapping().getTo()) == -1) { if (raiseAssert) { Assert.fail(message + " CodonFrame-SSM-Mapping-ToSeq is not contained in dataset"); } return false; } } } } } return true; // all relationships verified! } /** * call verifyAlignmentDatasetRefs with and without assertion raising enabled, * to check expected pass/fail actually occurs in both conditions * * @param al * @param expected * @param msg */ private void assertVerifyAlignment(AlignmentI al, boolean expected, String msg) { if (expected) { try { Assert.assertTrue(verifyAlignmentDatasetRefs(al, true, null), "Valid test alignment failed when raiseAsserts enabled:" + msg); } catch (AssertionError ae) { ae.printStackTrace(); Assert.fail( "Valid test alignment raised assertion errors when raiseAsserts enabled: " + msg, ae); } // also check validation passes with asserts disabled Assert.assertTrue(verifyAlignmentDatasetRefs(al, false, null), "Valid test alignment tested false when raiseAsserts disabled:" + msg); } else { boolean assertRaised = false; try { verifyAlignmentDatasetRefs(al, true, null); } catch (AssertionError ae) { // expected behaviour assertRaised = true; } if (!assertRaised) { Assert.fail( "Invalid test alignment passed when raiseAsserts enabled:" + msg); } // also check validation passes with asserts disabled Assert.assertFalse(verifyAlignmentDatasetRefs(al, false, null), "Invalid test alignment tested true when raiseAsserts disabled:" + msg); } } @Test(groups = { "Functional" }) public void testVerifyAlignmentDatasetRefs() { SequenceI sq1 = new Sequence("sq1", "ASFDD"), sq2 = new Sequence("sq2", "TTTTTT"); // construct simple valid alignment dataset Alignment al = new Alignment(new SequenceI[] { sq1, sq2 }); // expect this to pass assertVerifyAlignment(al, true, "Simple valid alignment didn't verify"); // check test for sequence->datasetSequence validity sq1.setDatasetSequence(sq2); assertVerifyAlignment(al, false, "didn't detect dataset sequence with a dataset sequence reference."); sq1.setDatasetSequence(null); assertVerifyAlignment(al, true, "didn't reinstate validity after nulling dataset sequence dataset reference"); // now create dataset and check again al.createDatasetAlignment(); assertNotNull(al.getDataset()); assertVerifyAlignment(al, true, "verify failed after createDatasetAlignment"); // create a dbref on sq1 with a sequence ref to sq2 DBRefEntry dbrs1tos2 = new DBRefEntry("UNIPROT", "1", "Q111111"); dbrs1tos2 .setMap(new Mapping(sq2.getDatasetSequence(), new int[] { 1, 5 }, new int[] { 2, 6 }, 1, 1)); sq1.getDatasetSequence().addDBRef(dbrs1tos2); assertVerifyAlignment(al, true, "verify failed after addition of valid DBRefEntry/map"); // now create a dbref on a new sequence which maps to another sequence // outside of the dataset SequenceI sqout = new Sequence("sqout", "ututututucagcagcag"), sqnew = new Sequence("sqnew", "EEERRR"); DBRefEntry sqnewsqout = new DBRefEntry("ENAFOO", "1", "R000001"); sqnewsqout .setMap(new Mapping(sqout, new int[] { 1, 6 }, new int[] { 1, 18 }, 1, 3)); al.getDataset().addSequence(sqnew); assertVerifyAlignment(al, true, "verify failed after addition of new sequence to dataset"); // now start checking exception conditions sqnew.addDBRef(sqnewsqout); assertVerifyAlignment(al, false, "verify passed when a dbref with map to sequence outside of dataset was added"); // make the verify pass by adding the outsider back in al.getDataset().addSequence(sqout); assertVerifyAlignment(al, true, "verify should have passed after adding dbref->to sequence in to dataset"); // and now the same for a codon mapping... SequenceI sqanotherout = new Sequence("sqanotherout", "aggtutaggcagcagcag"); AlignedCodonFrame alc = new AlignedCodonFrame(); alc.addMap(sqanotherout, sqnew, new MapList(new int[] { 1, 6 }, new int[] { 1, 18 }, 3, 1)); al.addCodonFrame(alc); Assert.assertEquals(al.getDataset().getCodonFrames().size(), 1); assertVerifyAlignment(al, false, "verify passed when alCodonFrame mapping to sequence outside of dataset was added"); // make the verify pass by adding the outsider back in al.getDataset().addSequence(sqanotherout); assertVerifyAlignment(al, true, "verify should have passed once all sequences involved in alCodonFrame were added to dataset"); al.getDataset().addSequence(sqanotherout); assertVerifyAlignment(al, false, "verify should have failed when a sequence was added twice to the dataset"); al.getDataset().deleteSequence(sqanotherout); assertVerifyAlignment(al, true, "verify should have passed after duplicate entry for sequence was removed"); } /** * checks that the sequence data for an alignment's dataset is non-redundant. * Fails if there are sequences with same id, sequence, start, and. */ public static void assertDatasetIsNormalised(AlignmentI al) { assertDatasetIsNormalised(al, null); } /** * checks that the sequence data for an alignment's dataset is non-redundant. * Fails if there are sequences with same id, sequence, start, and. * * @param al * - alignment to verify * @param message * - null or message prepended to exception message. */ public static void assertDatasetIsNormalised(AlignmentI al, String message) { if (al.getDataset() != null) { assertDatasetIsNormalised(al.getDataset(), message); return; } /* * look for pairs of sequences with same ID, start, end, and sequence */ List seqSet = al.getSequences(); for (int p = 0; p < seqSet.size(); p++) { SequenceI pSeq = seqSet.get(p); for (int q = p + 1; q < seqSet.size(); q++) { SequenceI qSeq = seqSet.get(q); if (pSeq.getStart() != qSeq.getStart()) { continue; } if (pSeq.getEnd() != qSeq.getEnd()) { continue; } if (!pSeq.getName().equals(qSeq.getName())) { continue; } if (!Arrays.equals(pSeq.getSequence(), qSeq.getSequence())) { continue; } Assert.fail((message == null ? "" : message + " :") + "Found similar sequences at position " + p + " and " + q + "\n" + pSeq.toString()); } } } @Test(groups = { "Functional", "Asserts" }) public void testAssertDatasetIsNormalised() { Sequence sq1 = new Sequence("s1/1-4", "asdf"); Sequence sq1shift = new Sequence("s1/2-5", "asdf"); Sequence sq1seqd = new Sequence("s1/1-4", "asdt"); Sequence sq2 = new Sequence("s2/1-4", "asdf"); Sequence sq1dup = new Sequence("s1/1-4", "asdf"); Alignment al = new Alignment(new SequenceI[] { sq1 }); al.setDataset(null); try { assertDatasetIsNormalised(al); } catch (AssertionError ae) { Assert.fail("Single sequence should be valid normalised dataset."); } al.addSequence(sq2); try { assertDatasetIsNormalised(al); } catch (AssertionError ae) { Assert.fail( "Two different sequences should be valid normalised dataset."); } /* * now change sq2's name in the alignment. should still be valid */ al.findName(sq2.getName()).setName("sq1"); try { assertDatasetIsNormalised(al); } catch (AssertionError ae) { Assert.fail( "Two different sequences in dataset, but same name in alignment, should be valid normalised dataset."); } al.addSequence(sq1seqd); try { assertDatasetIsNormalised(al); } catch (AssertionError ae) { Assert.fail( "sq1 and sq1 with different sequence should be distinct."); } al.addSequence(sq1shift); try { assertDatasetIsNormalised(al); } catch (AssertionError ae) { Assert.fail( "sq1 and sq1 with different start/end should be distinct."); } /* * finally, the failure case */ al.addSequence(sq1dup); boolean ssertRaised = false; try { assertDatasetIsNormalised(al); } catch (AssertionError ae) { ssertRaised = true; } if (!ssertRaised) { Assert.fail("Expected identical sequence to raise exception."); } } /* * Read in Stockholm format test data including secondary structure * annotations. */ @BeforeMethod(alwaysRun = true) public void setUp() throws IOException { al = loadAlignment(TEST_DATA, FileFormat.Stockholm); int i = 0; for (AlignmentAnnotation ann : al.getAlignmentAnnotation()) { ann.setCalcId("CalcIdFor" + al.getSequenceAt(i).getName()); i++; } } /** * Test method that returns annotations that match on calcId. */ @Test(groups = { "Functional" }) public void testFindAnnotation_byCalcId() { Iterable anns = al .findAnnotation("CalcIdForD.melanogaster.2"); Iterator iter = anns.iterator(); assertTrue(iter.hasNext()); AlignmentAnnotation ann = iter.next(); assertEquals("D.melanogaster.2", ann.sequenceRef.getName()); assertFalse(iter.hasNext()); // invalid id anns = al.findAnnotation("CalcIdForD.melanogaster.?"); assertFalse(iter.hasNext()); anns = al.findAnnotation(null); assertFalse(iter.hasNext()); } /** * Test method that returns annotations that match on reference sequence, * label, or calcId. */ @Test(groups = { "Functional" }) public void testFindAnnotations_bySeqLabelandorCalcId() { // TODO: finish testFindAnnotations_bySeqLabelandorCalcId test /* Note - this is an incomplete test - need to check null or * non-null [ matches, not matches ] behaviour for each of the three * parameters..*/ // search for a single, unique calcId with wildcards on other params Iterable anns = al.findAnnotations(null, "CalcIdForD.melanogaster.2", null); Iterator iter = anns.iterator(); assertTrue(iter.hasNext()); AlignmentAnnotation ann = iter.next(); assertEquals("D.melanogaster.2", ann.sequenceRef.getName()); assertFalse(iter.hasNext()); // save reference to test sequence reference parameter SequenceI rseq = ann.sequenceRef; // search for annotation associated with a single sequence anns = al.findAnnotations(rseq, null, null); iter = anns.iterator(); assertTrue(iter.hasNext()); ann = iter.next(); assertEquals("D.melanogaster.2", ann.sequenceRef.getName()); assertFalse(iter.hasNext()); // search for annotation with a non-existant calcId anns = al.findAnnotations(null, "CalcIdForD.melanogaster.?", null); iter = anns.iterator(); assertFalse(iter.hasNext()); // search for annotation with a particular label - expect three anns = al.findAnnotations(null, null, "Secondary Structure"); iter = anns.iterator(); assertTrue(iter.hasNext()); iter.next(); assertTrue(iter.hasNext()); iter.next(); assertTrue(iter.hasNext()); iter.next(); // third found.. so assertFalse(iter.hasNext()); // search for annotation on one sequence with a particular label - expect // one SequenceI sqfound; anns = al.findAnnotations(sqfound = al.getSequenceAt(1), null, "Secondary Structure"); iter = anns.iterator(); assertTrue(iter.hasNext()); // expect reference to sequence 1 in the alignment assertTrue(sqfound == iter.next().sequenceRef); assertFalse(iter.hasNext()); // null on all parameters == find all annotations anns = al.findAnnotations(null, null, null); iter = anns.iterator(); int n = al.getAlignmentAnnotation().length; while (iter.hasNext()) { n--; iter.next(); } assertTrue("Found " + n + " fewer annotations from search.", n == 0); } @Test(groups = { "Functional" }) public void testDeleteAllAnnotations_includingAutocalculated() { AlignmentAnnotation aa = new AlignmentAnnotation("Consensus", "Consensus", 0.5); aa.autoCalculated = true; al.addAnnotation(aa); AlignmentAnnotation[] anns = al.getAlignmentAnnotation(); assertEquals("Wrong number of annotations before deleting", 4, anns.length); al.deleteAllAnnotations(true); assertEquals("Not all deleted", 0, al.getAlignmentAnnotation().length); } @Test(groups = { "Functional" }) public void testDeleteAllAnnotations_excludingAutocalculated() { AlignmentAnnotation aa = new AlignmentAnnotation("Consensus", "Consensus", 0.5); aa.autoCalculated = true; al.addAnnotation(aa); AlignmentAnnotation[] anns = al.getAlignmentAnnotation(); assertEquals("Wrong number of annotations before deleting", 4, anns.length); al.deleteAllAnnotations(false); assertEquals("Not just one annotation left", 1, al.getAlignmentAnnotation().length); } /** * Tests for realigning as per a supplied alignment: Dna as Dna. * * Note: AlignedCodonFrame's state variables are named for protein-to-cDNA * mapping, but can be exploited for a general 'sequence-to-sequence' mapping * as here. * * @throws IOException */ @Test(groups = { "Functional" }) public void testAlignAs_dnaAsDna() throws IOException { // aligned cDNA: AlignmentI al1 = loadAlignment(CDNA_SEQS_1, FileFormat.Fasta); // unaligned cDNA: AlignmentI al2 = loadAlignment(CDNA_SEQS_2, FileFormat.Fasta); /* * Make mappings between sequences. The 'aligned cDNA' is playing the role * of what would normally be protein here. */ makeMappings(al1, al2); ((Alignment) al2).alignAs(al1, false, true); assertEquals("GC-TC--GUC-GTACT", al2.getSequenceAt(0).getSequenceAsString()); assertEquals("-GG-GTC--AGG--CAGT", al2.getSequenceAt(1).getSequenceAsString()); } /** * Aligning protein from cDNA. * * @throws IOException */ @Test(groups = { "Functional" }) public void testAlignAs_proteinAsCdna() throws IOException { // see also AlignmentUtilsTests AlignmentI al1 = loadAlignment(CDNA_SEQS_1, FileFormat.Fasta); AlignmentI al2 = loadAlignment(AA_SEQS_1, FileFormat.Fasta); makeMappings(al1, al2); // Fudge - alignProteinAsCdna expects mappings to be on protein al2.getCodonFrames().addAll(al1.getCodonFrames()); ((Alignment) al2).alignAs(al1, false, true); assertEquals("K-Q-Y-L-", al2.getSequenceAt(0).getSequenceAsString()); assertEquals("-R-F-P-W", al2.getSequenceAt(1).getSequenceAsString()); } /** * Test aligning cdna as per protein alignment. * * @throws IOException */ @Test(groups = { "Functional" }, enabled = true) // TODO review / update this test after redesign of alignAs method public void testAlignAs_cdnaAsProtein() throws IOException { /* * Load alignments and add mappings for cDNA to protein */ AlignmentI al1 = loadAlignment(CDNA_SEQS_1, FileFormat.Fasta); AlignmentI al2 = loadAlignment(AA_SEQS_1, FileFormat.Fasta); makeMappings(al1, al2); /* * Realign DNA; currently keeping existing gaps in introns only */ ((Alignment) al1).alignAs(al2, false, true); assertEquals("ACG---GCUCCA------ACT---", al1.getSequenceAt(0).getSequenceAsString()); assertEquals("---CGT---TAACGA---AGT---", al1.getSequenceAt(1).getSequenceAsString()); } /** * Test aligning cdna as per protein - single sequences * * @throws IOException */ @Test(groups = { "Functional" }, enabled = true) // TODO review / update this test after redesign of alignAs method public void testAlignAs_cdnaAsProtein_singleSequence() throws IOException { /* * simple case insert one gap */ verifyAlignAs(">dna\nCAAaaa\n", ">protein\nQ-K\n", "CAA---aaa"); /* * simple case but with sequence offsets */ verifyAlignAs(">dna/5-10\nCAAaaa\n", ">protein/20-21\nQ-K\n", "CAA---aaa"); /* * insert gaps as per protein, drop gaps within codons */ verifyAlignAs(">dna/10-18\nCA-Aa-aa--AGA\n", ">aa/6-8\n-Q-K--R\n", "---CAA---aaa------AGA"); } /** * test mapping between a protein and 3di sequence alignment. Assumes 1:1 * @throws IOException */ @Test(groups={"Functional"},enabled=true) public void testAlignAs_3di() throws IOException { String protAl = ">1ji5_A\n" + "-----------------------------DQPVLLLLLLQLLLLLVLLLQQLVVCLVQAD\n" + "DPCNVVSNVVSVVSSVVSVVSNVVSQVVCVVVVHHHDDDVSSVVRYPQDHHDPP--DYPL\n" + "RSLVSLLVSLVVVLVSLVVSLVSCVVVVNVVSNVSSVVVSVVSVVSNVVSCVVVVD----\n" + "---------------------------------------------------\n" + ">1jig_A\n" + "---------------------------DALLVVLLLLLLQLLLALVLLLQQLVLCLVLAD\n" + "DPCNVVSNVVSVVVSVVSVVSNVVSQVVCVVSVHHHDDDVSSVVRYPQDHDDSP--DYPL\n" + "RSLVSLLVSLVVLLVSLVVSLVSCVVNVNPVSNVSSVVSSVVSVVSNVVSVVVND-----\n" + "---------------------------------------------------\n" + "\n"; String tdiAl = ">1ji5_A\n" + "-----------------------------MNKQVIEVLNKQVADWSVLFTKLHNFHWYVK\n" + "GPQFFTLHEKFEELYTESATHIDEIAERILAIGGKPVATKEYLEISSIQEAAYG--ETAE\n" + "GMVEAIMKDYEMMLVELKKGMEIAQNSDDEMTSDLLLGIYTELEKHAWMLRAFLNQ----\n" + "---------------------------------------------------\n" + ">1jig_A\n" + "---------------------------MSTKTNVVEVLNKQVANWNVLYVKLHNYHWYVT\n" + "GPHFFTLHEKFEEFYNEAGTYIDELAERILALEGKPLATKEYLATSSVNEGTSK--ESAE\n" + "EMVQTLVNDYSALIQELKEGMEVAGEAGDATSADMLLAIHTTLEQHVWMLSAFLK-----\n" + "---------------------------------------------------\n" + ""; AlignmentI prot = loadAlignment(protAl, FileFormat.Fasta); ((Alignment) prot).createDatasetAlignment(); AlignmentI tdi = loadAlignment(tdiAl, FileFormat.Fasta); assertTrue(AlignmentUtils.map3diPeptideToProteinAligment(prot, tdi)); AlignmentI newProt = new Alignment( new SequenceI[] { prot.getSequenceAt(0).getSubSequence(25, 35), prot.getSequenceAt(1).getSubSequence(35, 45) }); newProt.setDataset(prot.getDataset()); // TODO Find matching tdi sequence and construct alignment mirroring // the protein alignment // Alignment newTdi = new CrossRef(newProt.getSequencesArray(), // newProt.getDataset()).findXrefSequences("", false); // // newTdi.alignAs(newProt); // // System.out.println("newProt - aa\n"+new // FastaFile().print(newProt.getSequencesArray(), true)); // System.out.println("newProt - 3di\n"+new // FastaFile().print(newTdi.getSequencesArray(), true)); } /** * Helper method that makes mappings and then aligns the first alignment as * the second * * @param fromSeqs * @param toSeqs * @param expected * @throws IOException */ public void verifyAlignAs(String fromSeqs, String toSeqs, String expected) throws IOException { /* * Load alignments and add mappings from nucleotide to protein (or from * first to second if both the same type) */ AlignmentI al1 = loadAlignment(fromSeqs, FileFormat.Fasta); AlignmentI al2 = loadAlignment(toSeqs, FileFormat.Fasta); makeMappings(al1, al2); /* * Realign DNA; currently keeping existing gaps in introns only */ ((Alignment) al1).alignAs(al2, false, true); assertEquals(expected, al1.getSequenceAt(0).getSequenceAsString()); } /** * Helper method to make mappings between sequences, and add the mappings to * the 'mapped from' alignment. If alFrom.isNucleotide() == alTo.isNucleotide() then ratio is always 1:1 * * @param alFrom * @param alTo */ public void makeMappings(AlignmentI alFrom, AlignmentI alTo) { int ratio = (alFrom.isNucleotide() == alTo.isNucleotide() ? 1 : 3); AlignedCodonFrame acf = new AlignedCodonFrame(); for (int i = 0; i < alFrom.getHeight(); i++) { SequenceI seqFrom = alFrom.getSequenceAt(i); SequenceI seqTo = alTo.getSequenceAt(i); MapList ml = new MapList( new int[] { seqFrom.getStart(), seqFrom.getEnd() }, new int[] { seqTo.getStart(), seqTo.getEnd() }, ratio, 1); acf.addMap(seqFrom, seqTo, ml); } /* * not sure whether mappings 'belong' or protein or nucleotide * alignment, so adding to both ;~) */ alFrom.addCodonFrame(acf); alTo.addCodonFrame(acf); } /** * Test aligning dna as per protein alignment, for the case where there are * introns (i.e. some dna sites have no mapping from a peptide). * * @throws IOException */ @Test(groups = { "Functional" }, enabled = false) // TODO review / update this test after redesign of alignAs method public void testAlignAs_dnaAsProtein_withIntrons() throws IOException { /* * Load alignments and add mappings for cDNA to protein */ String dna1 = "A-Aa-gG-GCC-cT-TT"; String dna2 = "c--CCGgg-TT--T-AA-A"; AlignmentI al1 = loadAlignment( ">Dna1/6-17\n" + dna1 + "\n>Dna2/20-31\n" + dna2 + "\n", FileFormat.Fasta); AlignmentI al2 = loadAlignment( ">Pep1/7-9\n-P--YK\n>Pep2/11-13\nG-T--F\n", FileFormat.Fasta); AlignedCodonFrame acf = new AlignedCodonFrame(); // Seq1 has intron at dna positions 3,4,9 so splice is AAG GCC TTT // Seq2 has intron at dna positions 1,5,6 so splice is CCG TTT AAA MapList ml1 = new MapList(new int[] { 6, 7, 10, 13, 15, 17 }, new int[] { 7, 9 }, 3, 1); acf.addMap(al1.getSequenceAt(0), al2.getSequenceAt(0), ml1); MapList ml2 = new MapList(new int[] { 21, 23, 26, 31 }, new int[] { 11, 13 }, 3, 1); acf.addMap(al1.getSequenceAt(1), al2.getSequenceAt(1), ml2); al2.addCodonFrame(acf); /* * Align ignoring gaps in dna introns and exons */ ((Alignment) al1).alignAs(al2, false, false); assertEquals("---AAagG------GCCcTTT", al1.getSequenceAt(0).getSequenceAsString()); // note 1 gap in protein corresponds to 'gg-' in DNA (3 positions) assertEquals("cCCGgg-TTT------AAA", al1.getSequenceAt(1).getSequenceAsString()); /* * Reset and realign, preserving gaps in dna introns and exons */ al1.getSequenceAt(0).setSequence(dna1); al1.getSequenceAt(1).setSequence(dna2); ((Alignment) al1).alignAs(al2, true, true); // String dna1 = "A-Aa-gG-GCC-cT-TT"; // String dna2 = "c--CCGgg-TT--T-AA-A"; // assumption: we include 'the greater of' protein/dna gap lengths, not both assertEquals("---A-Aa-gG------GCC-cT-TT", al1.getSequenceAt(0).getSequenceAsString()); assertEquals("c--CCGgg-TT--T------AA-A", al1.getSequenceAt(1).getSequenceAsString()); } @Test(groups = "Functional") public void testCopyConstructor() throws IOException { AlignmentI protein = loadAlignment(AA_SEQS_1, FileFormat.Fasta); // create sequence and alignment datasets protein.setDataset(null); AlignedCodonFrame acf = new AlignedCodonFrame(); List acfList = Arrays .asList(new AlignedCodonFrame[] { acf }); protein.getDataset().setCodonFrames(acfList); AlignmentI copy = new Alignment(protein); /* * copy has different aligned sequences but the same dataset sequences */ assertFalse(copy.getSequenceAt(0) == protein.getSequenceAt(0)); assertFalse(copy.getSequenceAt(1) == protein.getSequenceAt(1)); assertSame(copy.getSequenceAt(0).getDatasetSequence(), protein.getSequenceAt(0).getDatasetSequence()); assertSame(copy.getSequenceAt(1).getDatasetSequence(), protein.getSequenceAt(1).getDatasetSequence()); // TODO should the copy constructor copy the dataset? // or make a new one referring to the same dataset sequences?? assertNull(copy.getDataset()); // TODO test metadata is copied when AlignmentI is a dataset // assertArrayEquals(copy.getDataset().getSequencesArray(), protein // .getDataset().getSequencesArray()); } /** * Test behaviour of createDataset * * @throws IOException */ @Test(groups = "Functional") public void testCreateDatasetAlignment() throws IOException { AlignmentI protein = new FormatAdapter().readFile(AA_SEQS_1, DataSourceType.PASTE, FileFormat.Fasta); /* * create a dataset sequence on first sequence * leave the second without one */ protein.getSequenceAt(0).createDatasetSequence(); assertNotNull(protein.getSequenceAt(0).getDatasetSequence()); assertNull(protein.getSequenceAt(1).getDatasetSequence()); /* * add a mapping to the alignment */ AlignedCodonFrame acf = new AlignedCodonFrame(); protein.addCodonFrame(acf); assertNull(protein.getDataset()); assertTrue(protein.getCodonFrames().contains(acf)); /* * create the alignment dataset * note this creates sequence datasets where missing * as a side-effect (in this case, on seq2 */ // TODO promote this method to AlignmentI ((Alignment) protein).createDatasetAlignment(); AlignmentI ds = protein.getDataset(); // side-effect: dataset created on second sequence assertNotNull(protein.getSequenceAt(1).getDatasetSequence()); // dataset alignment has references to dataset sequences assertEquals(ds.getSequenceAt(0), protein.getSequenceAt(0).getDatasetSequence()); assertEquals(ds.getSequenceAt(1), protein.getSequenceAt(1).getDatasetSequence()); // codon frames should have been moved to the dataset // getCodonFrames() should delegate to the dataset: assertTrue(protein.getCodonFrames().contains(acf)); // prove the codon frames are indeed on the dataset: assertTrue(ds.getCodonFrames().contains(acf)); } /** * tests the addition of *all* sequences referred to by a sequence being added * to the dataset */ @Test(groups = "Functional") public void testCreateDatasetAlignmentWithMappedToSeqs() { // Alignment with two sequences, gapped. SequenceI sq1 = new Sequence("sq1", "A--SDF"); SequenceI sq2 = new Sequence("sq2", "G--TRQ"); // cross-references to two more sequences. DBRefEntry dbr = new DBRefEntry("SQ1", "", "sq3"); SequenceI sq3 = new Sequence("sq3", "VWANG"); dbr.setMap( new Mapping(sq3, new MapList(new int[] { 1, 4 }, new int[] { 2, 5 }, 1, 1))); sq1.addDBRef(dbr); SequenceI sq4 = new Sequence("sq4", "ERKWI"); DBRefEntry dbr2 = new DBRefEntry("SQ2", "", "sq4"); dbr2.setMap( new Mapping(sq4, new MapList(new int[] { 1, 4 }, new int[] { 2, 5 }, 1, 1))); sq2.addDBRef(dbr2); // and a 1:1 codonframe mapping between them. AlignedCodonFrame alc = new AlignedCodonFrame(); alc.addMap(sq1, sq2, new MapList(new int[] { 1, 4 }, new int[] { 1, 4 }, 1, 1)); AlignmentI protein = new Alignment(new SequenceI[] { sq1, sq2 }); /* * create the alignment dataset * note this creates sequence datasets where missing * as a side-effect (in this case, on seq2 */ // TODO promote this method to AlignmentI ((Alignment) protein).createDatasetAlignment(); AlignmentI ds = protein.getDataset(); // should be 4 sequences in dataset - two materialised, and two propagated // from dbref assertEquals(4, ds.getHeight()); assertTrue(ds.getSequences().contains(sq1.getDatasetSequence())); assertTrue(ds.getSequences().contains(sq2.getDatasetSequence())); assertTrue(ds.getSequences().contains(sq3)); assertTrue(ds.getSequences().contains(sq4)); // Should have one codon frame mapping between sq1 and sq2 via dataset // sequences assertEquals(ds.getCodonFrame(sq1.getDatasetSequence()), ds.getCodonFrame(sq2.getDatasetSequence())); } @Test(groups = "Functional") public void testAddCodonFrame() { AlignmentI align = new Alignment(new SequenceI[] {}); AlignedCodonFrame acf = new AlignedCodonFrame(); align.addCodonFrame(acf); assertEquals(1, align.getCodonFrames().size()); assertTrue(align.getCodonFrames().contains(acf)); // can't add the same object twice: align.addCodonFrame(acf); assertEquals(1, align.getCodonFrames().size()); // create dataset alignment - mappings move to dataset ((Alignment) align).createDatasetAlignment(); assertSame(align.getCodonFrames(), align.getDataset().getCodonFrames()); assertEquals(1, align.getCodonFrames().size()); AlignedCodonFrame acf2 = new AlignedCodonFrame(); align.addCodonFrame(acf2); assertTrue(align.getDataset().getCodonFrames().contains(acf)); } @Test(groups = "Functional") public void testAddSequencePreserveDatasetIntegrity() { Sequence seq = new Sequence("testSeq", "ABCDEFGHIJKLMNOPQRSTUVWXYZ"); Alignment align = new Alignment(new SequenceI[] { seq }); align.createDatasetAlignment(); AlignmentI ds = align.getDataset(); SequenceI copy = new Sequence(seq); copy.insertCharAt(3, 5, '-'); align.addSequence(copy); Assert.assertEquals(align.getDataset().getHeight(), 1, "Dataset shouldn't have more than one sequence."); Sequence seq2 = new Sequence("newtestSeq", "ABCDEFGHIJKLMNOPQRSTUVWXYZ"); align.addSequence(seq2); Assert.assertEquals(align.getDataset().getHeight(), 2, "Dataset should now have two sequences."); assertAlignmentDatasetRefs(align, "addSequence broke dataset reference integrity"); } /** * Tests that dbrefs with mappings to sequence get updated if the sequence * acquires a dataset sequence */ @Test(groups = "Functional") public void testCreateDataset_updateDbrefMappings() { SequenceI pep = new Sequence("pep", "ASD"); SequenceI dna = new Sequence("dna", "aaaGCCTCGGATggg"); SequenceI cds = new Sequence("cds", "GCCTCGGAT"); // add dbref from dna to peptide DBRefEntry dbr = new DBRefEntry("UNIPROT", "", "pep"); dbr.setMap( new Mapping(pep, new MapList(new int[] { 4, 15 }, new int[] { 1, 4 }, 3, 1))); dna.addDBRef(dbr); // add dbref from dna to peptide DBRefEntry dbr2 = new DBRefEntry("UNIPROT", "", "pep"); dbr2.setMap( new Mapping(pep, new MapList(new int[] { 1, 12 }, new int[] { 1, 4 }, 3, 1))); cds.addDBRef(dbr2); // add dbref from peptide to dna DBRefEntry dbr3 = new DBRefEntry("EMBL", "", "dna"); dbr3.setMap( new Mapping(dna, new MapList(new int[] { 1, 4 }, new int[] { 4, 15 }, 1, 3))); pep.addDBRef(dbr3); // add dbref from peptide to cds DBRefEntry dbr4 = new DBRefEntry("EMBLCDS", "", "cds"); dbr4.setMap( new Mapping(cds, new MapList(new int[] { 1, 4 }, new int[] { 1, 12 }, 1, 3))); pep.addDBRef(dbr4); AlignmentI protein = new Alignment(new SequenceI[] { pep }); /* * create the alignment dataset */ ((Alignment) protein).createDatasetAlignment(); AlignmentI ds = protein.getDataset(); // should be 3 sequences in dataset assertEquals(3, ds.getHeight()); assertTrue(ds.getSequences().contains(pep.getDatasetSequence())); assertTrue(ds.getSequences().contains(dna)); assertTrue(ds.getSequences().contains(cds)); /* * verify peptide.cdsdbref.peptidedbref is now mapped to peptide dataset */ List dbRefs = pep.getDBRefs(); assertEquals(2, dbRefs.size()); assertSame(dna, dbRefs.get(0).map.to); assertSame(cds, dbRefs.get(1).map.to); assertEquals(1, dna.getDBRefs().size()); assertSame(pep.getDatasetSequence(), dna.getDBRefs().get(0).map.to); assertEquals(1, cds.getDBRefs().size()); assertSame(pep.getDatasetSequence(), cds.getDBRefs().get(0).map.to); } @Test(groups = { "Functional" }) public void testFindGroup() { SequenceI seq1 = new Sequence("seq1", "ABCDEF---GHI"); SequenceI seq2 = new Sequence("seq2", "---JKLMNO---"); AlignmentI a = new Alignment(new SequenceI[] { seq1, seq2 }); assertNull(a.findGroup(null, 0)); assertNull(a.findGroup(seq1, 1)); assertNull(a.findGroup(seq1, -1)); /* * add a group consisting of just "DEF" */ SequenceGroup sg1 = new SequenceGroup(); sg1.addSequence(seq1, false); sg1.setStartRes(3); sg1.setEndRes(5); a.addGroup(sg1); assertNull(a.findGroup(seq1, 2)); // position not in group assertNull(a.findGroup(seq1, 6)); // position not in group assertNull(a.findGroup(seq2, 5)); // sequence not in group assertSame(a.findGroup(seq1, 3), sg1); // yes assertSame(a.findGroup(seq1, 4), sg1); assertSame(a.findGroup(seq1, 5), sg1); /* * add a group consisting of * EF-- * KLMN */ SequenceGroup sg2 = new SequenceGroup(); sg2.addSequence(seq1, false); sg2.addSequence(seq2, false); sg2.setStartRes(4); sg2.setEndRes(7); a.addGroup(sg2); assertNull(a.findGroup(seq1, 2)); // unchanged assertSame(a.findGroup(seq1, 3), sg1); // unchanged /* * if a residue is in more than one group, method returns * the first found (in order groups were added) */ assertSame(a.findGroup(seq1, 4), sg1); assertSame(a.findGroup(seq1, 5), sg1); /* * seq2 only belongs to the second group */ assertSame(a.findGroup(seq2, 4), sg2); assertSame(a.findGroup(seq2, 5), sg2); assertSame(a.findGroup(seq2, 6), sg2); assertSame(a.findGroup(seq2, 7), sg2); assertNull(a.findGroup(seq2, 3)); assertNull(a.findGroup(seq2, 8)); } @Test(groups = { "Functional" }) public void testDeleteSequenceByIndex() { // create random alignment AlignmentGenerator gen = new AlignmentGenerator(false); AlignmentI a = gen.generate(20, 15, 123, 5, 5); // delete sequence 10, alignment reduced by 1 int height = a.getAbsoluteHeight(); a.deleteSequence(10); assertEquals(a.getAbsoluteHeight(), height - 1); // try to delete -ve index, nothing happens a.deleteSequence(-1); assertEquals(a.getAbsoluteHeight(), height - 1); // try to delete beyond end of alignment, nothing happens a.deleteSequence(14); assertEquals(a.getAbsoluteHeight(), height - 1); } @Test(groups = { "Functional" }) public void testDeleteSequenceBySeq() { // create random alignment AlignmentGenerator gen = new AlignmentGenerator(false); AlignmentI a = gen.generate(20, 15, 123, 5, 5); // delete sequence 10, alignment reduced by 1 int height = a.getAbsoluteHeight(); SequenceI seq = a.getSequenceAt(10); a.deleteSequence(seq); assertEquals(a.getAbsoluteHeight(), height - 1); // try to delete non-existent sequence, nothing happens seq = new Sequence("cds", "GCCTCGGAT"); assertEquals(a.getAbsoluteHeight(), height - 1); } @Test(groups = { "Functional" }) public void testDeleteHiddenSequence() { // create random alignment AlignmentGenerator gen = new AlignmentGenerator(false); AlignmentI a = gen.generate(20, 15, 123, 5, 5); // delete a sequence which is hidden, check it is NOT removed from hidden // sequences int height = a.getAbsoluteHeight(); SequenceI seq = a.getSequenceAt(2); a.getHiddenSequences().hideSequence(seq); assertEquals(a.getHiddenSequences().getSize(), 1); a.deleteSequence(2); assertEquals(a.getAbsoluteHeight(), height - 1); assertEquals(a.getHiddenSequences().getSize(), 1); // delete a sequence which is not hidden, check hiddenSequences are not // affected a.deleteSequence(10); assertEquals(a.getAbsoluteHeight(), height - 2); assertEquals(a.getHiddenSequences().getSize(), 1); } @Test( groups = "Functional", expectedExceptions = { IllegalArgumentException.class }) public void testSetDataset_selfReference() { SequenceI seq = new Sequence("a", "a"); AlignmentI alignment = new Alignment(new SequenceI[] { seq }); alignment.setDataset(alignment); } @Test(groups = "Functional") public void testAppend() { SequenceI seq = new Sequence("seq1", "FRMLPSRT-A--L-"); AlignmentI alignment = new Alignment(new SequenceI[] { seq }); alignment.setGapCharacter('-'); SequenceI seq2 = new Sequence("seq1", "KP..L.FQII."); AlignmentI alignment2 = new Alignment(new SequenceI[] { seq2 }); alignment2.setGapCharacter('.'); alignment.append(alignment2); assertEquals('-', alignment.getGapCharacter()); assertSame(seq, alignment.getSequenceAt(0)); assertEquals("KP--L-FQII-", alignment.getSequenceAt(1).getSequenceAsString()); // todo test coverage for annotations, mappings, groups, // hidden sequences, properties } /** * test that calcId == null on findOrCreate doesn't raise an NPE, and yields * an annotation with a null calcId * */ @Test(groups = "Functional") public void testFindOrCreateForNullCalcId() { SequenceI seq = new Sequence("seq1", "FRMLPSRT-A--L-"); AlignmentI alignment = new Alignment(new SequenceI[] { seq }); AlignmentAnnotation ala = alignment.findOrCreateAnnotation( "Temperature Factor", null, false, seq, null); assertNotNull(ala); assertEquals(seq, ala.sequenceRef); assertEquals("", ala.calcId); } @Test(groups = "Functional") public void testPropagateInsertions() { // create an alignment with no gaps - this will be the profile seq and other // JPRED seqs AlignmentGenerator gen = new AlignmentGenerator(false); AlignmentI al = gen.generate(25, 10, 1234, 0, 0); // get the profileseq SequenceI profileseq = al.getSequenceAt(0); SequenceI gappedseq = new Sequence(profileseq); gappedseq.insertCharAt(5, al.getGapCharacter()); gappedseq.insertCharAt(6, al.getGapCharacter()); gappedseq.insertCharAt(7, al.getGapCharacter()); gappedseq.insertCharAt(8, al.getGapCharacter()); // force different kinds of padding al.getSequenceAt(3).deleteChars(2, 23); al.getSequenceAt(4).deleteChars(2, 27); al.getSequenceAt(5).deleteChars(10, 27); // create an alignment view with the gapped sequence SequenceI[] seqs = new SequenceI[1]; seqs[0] = gappedseq; AlignmentI newal = new Alignment(seqs); HiddenColumns hidden = new HiddenColumns(); hidden.hideColumns(15, 17); AlignmentView view = new AlignmentView(newal, hidden, null, true, false, false); // confirm that original contigs are as expected Iterator visible = hidden.getVisContigsIterator(0, 25, false); int[] region = visible.next(); assertEquals("[0, 14]", Arrays.toString(region)); region = visible.next(); assertEquals("[18, 24]", Arrays.toString(region)); // propagate insertions HiddenColumns result = al.propagateInsertions(profileseq, view); // confirm that the contigs have changed to account for the gaps visible = result.getVisContigsIterator(0, 25, false); region = visible.next(); assertEquals("[0, 10]", Arrays.toString(region)); region = visible.next(); assertEquals("[14, 24]", Arrays.toString(region)); // confirm the alignment has been changed so that the other sequences have // gaps inserted where the columns are hidden assertFalse(Comparison.isGap(al.getSequenceAt(1).getSequence()[10])); assertTrue(Comparison.isGap(al.getSequenceAt(1).getSequence()[11])); assertTrue(Comparison.isGap(al.getSequenceAt(1).getSequence()[12])); assertTrue(Comparison.isGap(al.getSequenceAt(1).getSequence()[13])); assertFalse(Comparison.isGap(al.getSequenceAt(1).getSequence()[14])); } @Test(groups = "Functional") public void testPropagateInsertionsOverlap() { // test propagateInsertions where gaps and hiddenColumns overlap // create an alignment with no gaps - this will be the profile seq and other // JPRED seqs AlignmentGenerator gen = new AlignmentGenerator(false); AlignmentI al = gen.generate(20, 10, 1234, 0, 0); // get the profileseq SequenceI profileseq = al.getSequenceAt(0); SequenceI gappedseq = new Sequence(profileseq); gappedseq.insertCharAt(5, al.getGapCharacter()); gappedseq.insertCharAt(6, al.getGapCharacter()); gappedseq.insertCharAt(7, al.getGapCharacter()); gappedseq.insertCharAt(8, al.getGapCharacter()); // create an alignment view with the gapped sequence SequenceI[] seqs = new SequenceI[1]; seqs[0] = gappedseq; AlignmentI newal = new Alignment(seqs); // hide columns so that some overlap with the gaps HiddenColumns hidden = new HiddenColumns(); hidden.hideColumns(7, 10); AlignmentView view = new AlignmentView(newal, hidden, null, true, false, false); // confirm that original contigs are as expected Iterator visible = hidden.getVisContigsIterator(0, 20, false); int[] region = visible.next(); assertEquals("[0, 6]", Arrays.toString(region)); region = visible.next(); assertEquals("[11, 19]", Arrays.toString(region)); assertFalse(visible.hasNext()); // propagate insertions HiddenColumns result = al.propagateInsertions(profileseq, view); // confirm that the contigs have changed to account for the gaps visible = result.getVisContigsIterator(0, 20, false); region = visible.next(); assertEquals("[0, 4]", Arrays.toString(region)); region = visible.next(); assertEquals("[7, 19]", Arrays.toString(region)); assertFalse(visible.hasNext()); // confirm the alignment has been changed so that the other sequences have // gaps inserted where the columns are hidden assertFalse(Comparison.isGap(al.getSequenceAt(1).getSequence()[4])); assertTrue(Comparison.isGap(al.getSequenceAt(1).getSequence()[5])); assertTrue(Comparison.isGap(al.getSequenceAt(1).getSequence()[6])); assertFalse(Comparison.isGap(al.getSequenceAt(1).getSequence()[7])); } @Test(groups = { "Functional" }) public void testPadGaps() { SequenceI seq1 = new Sequence("seq1", "ABCDEF--"); SequenceI seq2 = new Sequence("seq2", "-JKLMNO--"); SequenceI seq3 = new Sequence("seq2", "-PQR"); AlignmentI a = new Alignment(new SequenceI[] { seq1, seq2, seq3 }); a.setGapCharacter('.'); // this replaces existing gaps assertEquals("ABCDEF..", seq1.getSequenceAsString()); a.padGaps(); // trailing gaps are pruned, short sequences padded with gap character assertEquals("ABCDEF.", seq1.getSequenceAsString()); assertEquals(".JKLMNO", seq2.getSequenceAsString()); assertEquals(".PQR...", seq3.getSequenceAsString()); } /** * Test for setHiddenColumns, to check it returns true if the hidden columns * have changed, else false */ @Test(groups = { "Functional" }) public void testSetHiddenColumns() { AlignmentI al = new Alignment(new SequenceI[] {}); assertFalse(al.getHiddenColumns().hasHiddenColumns()); HiddenColumns hc = new HiddenColumns(); assertFalse(al.setHiddenColumns(hc)); // no change assertSame(hc, al.getHiddenColumns()); hc.hideColumns(2, 4); assertTrue(al.getHiddenColumns().hasHiddenColumns()); /* * set a different object but with the same columns hidden */ HiddenColumns hc2 = new HiddenColumns(); hc2.hideColumns(2, 4); assertFalse(al.setHiddenColumns(hc2)); // no change assertSame(hc2, al.getHiddenColumns()); assertTrue(al.setHiddenColumns(null)); assertNull(al.getHiddenColumns()); assertTrue(al.setHiddenColumns(hc)); assertSame(hc, al.getHiddenColumns()); al.getHiddenColumns().hideColumns(10, 12); hc2.hideColumns(10, 12); assertFalse(al.setHiddenColumns(hc2)); // no change /* * hide columns 15-16 then 17-18 in hc * hide columns 15-18 in hc2 * these are not now 'equal' objects even though they * represent the same set of columns */ assertSame(hc2, al.getHiddenColumns()); hc.hideColumns(15, 16); hc.hideColumns(17, 18); hc2.hideColumns(15, 18); assertFalse(hc.equals(hc2)); assertTrue(al.setHiddenColumns(hc)); // 'changed' } @Test(groups = { "Functional" }) public void testGetWidth() { SequenceI seq1 = new Sequence("seq1", "ABCDEF--"); SequenceI seq2 = new Sequence("seq2", "-JKLMNO--"); SequenceI seq3 = new Sequence("seq2", "-PQR"); AlignmentI a = new Alignment(new SequenceI[] { seq1, seq2, seq3 }); assertEquals(9, a.getWidth()); // width includes hidden columns a.getHiddenColumns().hideColumns(2, 5); assertEquals(9, a.getWidth()); } @Test(groups = { "Functional" }) public void testGetVisibleWidth() { SequenceI seq1 = new Sequence("seq1", "ABCDEF--"); SequenceI seq2 = new Sequence("seq2", "-JKLMNO--"); SequenceI seq3 = new Sequence("seq2", "-PQR"); AlignmentI a = new Alignment(new SequenceI[] { seq1, seq2, seq3 }); assertEquals(9, a.getVisibleWidth()); // width excludes hidden columns a.getHiddenColumns().hideColumns(2, 5); assertEquals(5, a.getVisibleWidth()); } @Test(groups = { "Functional" }) public void testGetContactMap() { // TODO // 1. test adding/removing/manipulating contact maps with/without associated // sequence(s) or groups // 2. For sequence associated - ensure that inserting a gap in sequence // results in the contact map being relocated accordingly // 3. RENDERER QUESTION - should contact maps reflect gaps in the alignment // ? } @Test(groups = { "Functional" }) public void testEquals() { SequenceI seq1 = new Sequence("seq1", "ABCDEF--"); SequenceI seq2 = new Sequence("seq2", "-JKLMNO--"); SequenceI seq3 = new Sequence("seq2", "-PQR"); AlignmentI a = new Alignment(new SequenceI[] { seq1, seq2, seq3 }); a.setDataset(null); assertEquals(a.getDataset(), a.getDataset()); } }