/* * Jalview - A Sequence Alignment Editor and Viewer ($$Version-Rel$$) * Copyright (C) $$Year-Rel$$ The Jalview Authors * * This file is part of Jalview. * * Jalview is free software: you can redistribute it and/or * modify it under the terms of the GNU General Public License * as published by the Free Software Foundation, either version 3 * of the License, or (at your option) any later version. * * Jalview is distributed in the hope that it will be useful, but * WITHOUT ANY WARRANTY; without even the implied warranty * of MERCHANTABILITY or FITNESS FOR A PARTICULAR * PURPOSE. See the GNU General Public License for more details. * * You should have received a copy of the GNU General Public License * along with Jalview. If not, see . * The Jalview Authors are detailed in the 'AUTHORS' file. */ package jalview.datamodel; import static org.testng.AssertJUnit.assertEquals; import static org.testng.AssertJUnit.assertFalse; import org.testng.annotations.Test; /** * Unit tests for SeqCigar */ public class SeqCigarTest { /* * refactored 'as is' from main method * * TODO: split into separate tests */ @Test(groups = { "Functional" }) public void testSomething() throws Exception { String o_seq = "asdfktryasdtqwrtsaslldddptyipqqwaslchvhttt"; Sequence s = new Sequence("MySeq", o_seq, 39, 80); String orig_gapped = "----asdf------ktryas---dtqwrtsasll----dddptyipqqwa----slchvhttt"; Sequence s_gapped = new Sequence("MySeq", orig_gapped, 39, 80); String ex_cs_gapped = "4I4M6I6M3I11M4I12M4I9M"; s_gapped.setDatasetSequence(s); String sub_gapped_s = "------ktryas---dtqwrtsasll----dddptyipqqwa----slchvh"; Sequence s_subsequence_gapped = new Sequence("MySeq", sub_gapped_s, 43, 77); s_subsequence_gapped.setDatasetSequence(s); SeqCigar c_null = new SeqCigar(s); String cs_null = c_null.getCigarstring(); assertEquals("Failed to recover ungapped sequence cigar operations", "42M", cs_null); testCigar_string(s_gapped, ex_cs_gapped); SeqCigar gen_sgapped = SeqCigar.parseCigar(s, ex_cs_gapped); assertEquals("Failed parseCigar", ex_cs_gapped, gen_sgapped.getCigarstring()); testSeqRecovery(gen_sgapped, s_gapped); /* * Test dataset resolution */ SeqCigar sub_gapped = new SeqCigar(s_subsequence_gapped); testSeqRecovery(sub_gapped, s_subsequence_gapped); /* * Test width functions */ assertEquals("Failed getWidth", sub_gapped_s.length(), sub_gapped.getWidth()); sub_gapped.getFullWidth(); assertFalse("hasDeletedRegions is incorrect", sub_gapped.hasDeletedRegions()); // Test start-end region SeqCigar SeqCigar sub_se_gp = new SeqCigar(s_subsequence_gapped, 8, 48); assertEquals( "SeqCigar(seq, start, end) not properly clipped alignsequence", 41, sub_se_gp.getWidth()); /* * TODO: can we add assertions to the sysouts that follow? */ System.out.println("Original sequence align:\n" + sub_gapped_s + "\nReconstructed window from 8 to 48\n" + "XXXXXXXX" + sub_se_gp.getSequenceString('-') + "..." + "\nCigar String:" + sub_se_gp.getCigarstring() + "\n"); SequenceI ssgp = sub_se_gp.getSeq('-'); System.out.println("\t " + ssgp.getSequenceAsString()); for (int r = 0; r < 10; r++) { sub_se_gp = new SeqCigar(s_subsequence_gapped, 8, 48); int sl = sub_se_gp.getWidth(); int st = sl - 1 - r; for (int rs = 0; rs < 10; rs++) { int e = st + rs; sub_se_gp.deleteRange(st, e); String ssgapedseq = sub_se_gp.getSeq('-').getSequenceAsString(); System.out.println(st + "," + e + "\t:" + ssgapedseq); st -= 3; } } SeqCigar[] set = new SeqCigar[] { new SeqCigar(s), new SeqCigar(s_subsequence_gapped, 8, 48), new SeqCigar(s_gapped) }; Alignment al = new Alignment(set); for (int i = 0; i < al.getHeight(); i++) { System.out.println("" + al.getSequenceAt(i).getName() + "\t" + al.getSequenceAt(i).getStart() + "\t" + al.getSequenceAt(i).getEnd() + "\t" + al.getSequenceAt(i).getSequenceAsString()); } System.out.println("Gapped."); set = new SeqCigar[] { new SeqCigar(s), new SeqCigar(s_subsequence_gapped, 8, 48), new SeqCigar(s_gapped) }; set[0].deleteRange(20, 25); al = new Alignment(set); for (int i = 0; i < al.getHeight(); i++) { System.out.println("" + al.getSequenceAt(i).getName() + "\t" + al.getSequenceAt(i).getStart() + "\t" + al.getSequenceAt(i).getEnd() + "\t" + al.getSequenceAt(i).getSequenceAsString()); } // if (!ssgapedseq.equals("ryas---dtqqwa----slchvh")) // System.err.println("Subseqgaped\n------ktryas---dtqwrtsasll----dddptyipqqwa----slchvhryas---dtqwrtsasll--qwa----slchvh\n"+ssgapedseq+"\n"+sub_se_gp.getCigarstring()); } /** * non rigorous testing * * @param seq * Sequence * @param ex_cs_gapped * String * @return String */ protected void testCigar_string(Sequence seq, String ex_cs_gapped) { SeqCigar c_sgapped = new SeqCigar(seq); String cs_gapped = c_sgapped.getCigarstring(); assertEquals("Failed getCigarstring", ex_cs_gapped, cs_gapped); } protected void testSeqRecovery(SeqCigar gen_sgapped, SequenceI s_gapped) { // this is non-rigorous - start and end recovery is not tested. SequenceI gen_sgapped_s = gen_sgapped.getSeq('-'); // assertEquals("Couldn't reconstruct sequence", s_gapped.getSequence(), // gen_sgapped_s); if (!gen_sgapped_s.getSequence().equals(s_gapped.getSequence())) { // TODO: investigate errors reported here, to allow full conversion to // passing JUnit assertion form System.err.println("Couldn't reconstruct sequence.\n" + gen_sgapped_s.getSequenceAsString() + "\n" + s_gapped.getSequenceAsString()); } } }