/* * Jalview - A Sequence Alignment Editor and Viewer ($$Version-Rel$$) * Copyright (C) $$Year-Rel$$ The Jalview Authors * * This file is part of Jalview. * * Jalview is free software: you can redistribute it and/or * modify it under the terms of the GNU General Public License * as published by the Free Software Foundation, either version 3 * of the License, or (at your option) any later version. * * Jalview is distributed in the hope that it will be useful, but * WITHOUT ANY WARRANTY; without even the implied warranty * of MERCHANTABILITY or FITNESS FOR A PARTICULAR * PURPOSE. See the GNU General Public License for more details. * * You should have received a copy of the GNU General Public License * along with Jalview. If not, see . * The Jalview Authors are detailed in the 'AUTHORS' file. */ package jalview.ws.dbsources; import static org.testng.Assert.assertFalse; import static org.testng.AssertJUnit.assertEquals; import static org.testng.AssertJUnit.assertNotNull; import static org.testng.AssertJUnit.assertNull; import static org.testng.AssertJUnit.assertTrue; import java.io.ByteArrayInputStream; import java.io.InputStream; import java.io.UnsupportedEncodingException; import java.math.BigInteger; import java.util.List; import org.testng.Assert; import org.testng.annotations.BeforeClass; import org.testng.annotations.DataProvider; import org.testng.annotations.Test; import jalview.datamodel.DBRefEntry; import jalview.datamodel.DBRefSource; import jalview.datamodel.SequenceFeature; import jalview.datamodel.SequenceI; import jalview.gui.JvOptionPane; import jalview.util.DBRefUtils; import jalview.xml.binding.uniprot.DbReferenceType; import jalview.xml.binding.uniprot.Entry; import jalview.xml.binding.uniprot.FeatureType; import jalview.xml.binding.uniprot.LocationType; import jalview.xml.binding.uniprot.PositionType; public class UniprotTest { @BeforeClass(alwaysRun = true) public void setUpJvOptionPane() { JvOptionPane.setInteractiveMode(false); JvOptionPane.setMockResponse(JvOptionPane.CANCEL_OPTION); } // adapted from http://www.uniprot.org/uniprot/A9CKP4.xml private static final String UNIPROT_XML = "" + "" + "" + "A9CKP4" + "A9CKP5" + "A9CKP4_AGRT5" + "A9CKP4_AGRT6" + "Mitogen-activated protein kinase 13" + "" + "" + "" + "" + "" + "" + "ML" + "ML" + "M" + "LLMVM" + "LLLMVML" + "LLLMVKMLML" + "MHAPL VSKDL" + ""; /** * Test the method that unmarshals XML to a Uniprot model * * @throws UnsupportedEncodingException */ @Test(groups = { "Functional" }) public void testGetUniprotEntries() throws UnsupportedEncodingException { Uniprot u = new Uniprot(); InputStream is = new ByteArrayInputStream(UNIPROT_XML.getBytes()); List entries = u.getUniprotEntries(is); assertEquals(1, entries.size()); Entry entry = entries.get(0); assertEquals(2, entry.getName().size()); assertEquals("A9CKP4_AGRT5", entry.getName().get(0)); assertEquals("A9CKP4_AGRT6", entry.getName().get(1)); assertEquals(2, entry.getAccession().size()); assertEquals("A9CKP4", entry.getAccession().get(0)); assertEquals("A9CKP5", entry.getAccession().get(1)); assertEquals("MHAPL VSKDL", entry.getSequence().getValue()); assertEquals("Mitogen-activated protein kinase 13", entry.getProtein() .getRecommendedName().getFullName().getValue()); /* * Check sequence features */ List features = entry.getFeature(); assertEquals(9, features.size()); FeatureType sf = features.get(0); assertEquals("signal peptide", sf.getType()); assertNull(sf.getDescription()); assertNull(sf.getStatus()); assertNull(sf.getLocation().getPosition()); assertEquals(1, sf.getLocation().getBegin().getPosition().intValue()); assertEquals(18, sf.getLocation().getEnd().getPosition().intValue()); sf = features.get(1); assertEquals("propeptide", sf.getType()); assertEquals("Activation peptide", sf.getDescription()); assertNull(sf.getLocation().getPosition()); assertEquals(19, sf.getLocation().getBegin().getPosition().intValue()); assertEquals(20, sf.getLocation().getEnd().getPosition().intValue()); sf = features.get(2); assertEquals("chain", sf.getType()); assertEquals("Granzyme B", sf.getDescription()); assertNull(sf.getLocation().getPosition()); assertEquals(21, sf.getLocation().getBegin().getPosition().intValue()); assertEquals(247, sf.getLocation().getEnd().getPosition().intValue()); sf = features.get(3); assertEquals("sequence variant", sf.getType()); assertNull(sf.getDescription()); assertEquals(41, sf.getLocation().getPosition().getPosition().intValue()); assertNull(sf.getLocation().getBegin()); assertNull(sf.getLocation().getEnd()); sf = features.get(4); assertEquals("sequence variant", sf.getType()); assertEquals("Pathogenic", sf.getDescription()); assertEquals(41, sf.getLocation().getPosition().getPosition().intValue()); assertNull(sf.getLocation().getBegin()); assertNull(sf.getLocation().getEnd()); sf = features.get(5); assertEquals("sequence variant", sf.getType()); assertEquals("Pathogenic", sf.getDescription()); assertEquals(41, sf.getLocation().getPosition().getPosition().intValue()); assertNull(sf.getLocation().getBegin()); assertNull(sf.getLocation().getEnd()); sf = features.get(6); assertEquals("sequence variant", sf.getType()); assertEquals("Foo", sf.getDescription()); assertEquals(42, sf.getLocation().getPosition().getPosition().intValue()); assertNull(sf.getLocation().getBegin()); assertNull(sf.getLocation().getEnd()); Assert.assertEquals(Uniprot.getDescription(sf), "p.Met42Leu" + "
  " + "p.Met42LeuMetVal Foo"); sf = features.get(7); assertNull(sf.getLocation().getPosition()); assertEquals(42, sf.getLocation().getBegin().getPosition().intValue()); assertEquals(43, sf.getLocation().getEnd().getPosition().intValue()); Assert.assertEquals(Uniprot.getDescription(sf), "p.MetLeu42LeuLeu" + "
  " + "p.MetLeu42LeuMetVal Foo"); sf = features.get(8); assertNull(sf.getLocation().getPosition()); assertEquals(42, sf.getLocation().getBegin().getPosition().intValue()); assertEquals(45, sf.getLocation().getEnd().getPosition().intValue()); Assert.assertEquals(Uniprot.getDescription(sf), "p.MLML42LeuLeu" + "
  " + "p.MLML42LMVK Foo Too"); /* * Check cross-references */ List xrefs = entry.getDbReference(); assertEquals(3, xrefs.size()); DbReferenceType xref = xrefs.get(0); assertEquals("2FSQ", xref.getId()); assertEquals("PDB", xref.getType()); assertEquals("X-ray", Uniprot.getProperty(xref.getProperty(), "method")); assertEquals("1.40", Uniprot.getProperty(xref.getProperty(), "resolution")); xref = xrefs.get(1); assertEquals("2FSR", xref.getId()); assertEquals("PDBsum", xref.getType()); assertTrue(xref.getProperty().isEmpty()); xref = xrefs.get(2); assertEquals("AE007869", xref.getId()); assertEquals("EMBL", xref.getType()); assertEquals("AAK85932.1", Uniprot.getProperty(xref.getProperty(), "protein sequence ID")); assertEquals("Genomic_DNA", Uniprot.getProperty(xref.getProperty(), "molecule type")); } @Test(groups = { "Functional" }) public void testGetUniprotSequence() throws UnsupportedEncodingException { InputStream is = new ByteArrayInputStream(UNIPROT_XML.getBytes()); Entry entry = new Uniprot().getUniprotEntries(is).get(0); SequenceI seq = new Uniprot().uniprotEntryToSequence(entry); assertNotNull(seq); assertEquals(6, seq.getDBRefs().size()); // 2*Uniprot, PDB, PDBsum, 2*EMBL assertEquals(seq.getSequenceAsString(), seq.createDatasetSequence().getSequenceAsString()); assertEquals(2, seq.getPrimaryDBRefs().size()); List res = DBRefUtils.searchRefs(seq.getPrimaryDBRefs(), "A9CKP4"); assertEquals(1, res.size()); assertTrue(res.get(0).isCanonical()); res = DBRefUtils.searchRefsForSource(seq.getDBRefs(), DBRefSource.UNIPROT); assertEquals(2, res.size()); /* * NB this test fragile - relies on ordering being preserved */ assertTrue(res.get(0).isCanonical()); assertFalse(res.get(1).isCanonical()); // check version is preserved for EMBLCDS res = DBRefUtils.searchRefs(seq.getDBRefs(), "AAK85932"); assertEquals(1, res.size()); // Ideally we would expect AAK85932.1 -> AAK85932 // assertTrue("1".equals(res.get(0).getVersion())); // but it also passes through DBrefUtils.ensurePrimaries which adds // (promoted) to the version string // FIXME: Jim needs to specify what (promoted) means !! - or perhaps we just // ignore it ! assertEquals("1 (promoted)", (res.get(0).getVersion())); List features = seq.getFeatures().findFeatures(41, 41, "sequence variant"); // verify single position features are parsed correctly JAL-4347 assertNotNull(features); assertEquals(3, features.size()); } /** * Test the method that formats the sequence id * * @throws UnsupportedEncodingException */ @Test(groups = { "Functional" }) public void testGetUniprotEntryId() throws UnsupportedEncodingException { InputStream is = new ByteArrayInputStream(UNIPROT_XML.getBytes()); Entry entry = new Uniprot().getUniprotEntries(is).get(0); /* * name formatted with Uniprot Entry name */ String expectedName = "A9CKP4_AGRT5|A9CKP4_AGRT6"; assertEquals(expectedName, Uniprot.getUniprotEntryId(entry)); } /** * Test the method that formats the sequence description * * @throws UnsupportedEncodingException */ @Test(groups = { "Functional" }) public void testGetUniprotEntryDescription() throws UnsupportedEncodingException { InputStream is = new ByteArrayInputStream(UNIPROT_XML.getBytes()); Entry entry = new Uniprot().getUniprotEntries(is).get(0); assertEquals("Mitogen-activated protein kinase 13", Uniprot.getUniprotEntryDescription(entry)); } @Test(groups = { "Functional" }) public void testGetDescription() { FeatureType ft = new FeatureType(); assertEquals("", Uniprot.getDescription(ft)); ft.setDescription("Hello"); assertEquals("Hello", Uniprot.getDescription(ft)); ft.setLocation(new LocationType()); ft.getLocation().setPosition(new PositionType()); ft.getLocation().getPosition().setPosition(BigInteger.valueOf(23)); ft.setOriginal("K"); ft.getVariation().add("y"); assertEquals("p.Lys23Tyr Hello", Uniprot.getDescription(ft)); // multiple variants generate an html description over more than one line ft.getVariation().add("W"); assertEquals("p.Lys23Tyr
  p.Lys23Trp Hello", Uniprot.getDescription(ft)); /* * indel cases * up to 3 bases (original or variant) are shown using 3 letter code */ ft.getVariation().clear(); ft.getVariation().add("KWE"); ft.setOriginal("KLS"); assertEquals("p.LysLeuSer23LysTrpGlu Hello", Uniprot.getDescription(ft)); // adding a fourth original base switches to single letter code ft.setOriginal("KLST"); assertEquals("p.KLST23LysTrpGlu Hello", Uniprot.getDescription(ft)); // adding a fourth variant switches to single letter code ft.getVariation().clear(); ft.getVariation().add("KWES"); assertEquals("p.KLST23KWES Hello", Uniprot.getDescription(ft)); ft.getVariation().clear(); ft.getVariation().add("z"); // unknown variant - fails gracefully ft.setOriginal("K"); assertEquals("p.Lys23z Hello", Uniprot.getDescription(ft)); ft.getVariation().clear(); // variant missing - is ignored assertEquals("Hello", Uniprot.getDescription(ft)); } public static String Q29079 = Q29079 = new String( "\n" + "\n" + "Q29079\n" + "Q29017\n" + "PAG2_PIG\n" + "\n" + "\n" + "Pregnancy-associated glycoprotein 2\n" + "PAG 2\n" + "3.4.23.-\n" + "\n" + "\n" + "\n" + "PAG2\n" + "\n" + "\n" + "Sus scrofa\n" + "Pig\n" + "\n" + "\n" + "Eukaryota\n" + "Metazoa\n" + "Chordata\n" + "Craniata\n" + "Vertebrata\n" + "Euteleostomi\n" + "Mammalia\n" + "Eutheria\n" + "Laurasiatheria\n" + "Artiodactyla\n" + "Suina\n" + "Suidae\n" + "Sus\n" + "\n" + "\n" + "\n" + "\n" + "Porcine pregnancy-associated glycoproteins: new members of the aspartic proteinase gene family expressed in trophectoderm.\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "NUCLEOTIDE SEQUENCE [GENOMIC DNA]\n" + "\n" + "\n" + "\n" + "Gene for porcine pregnancy-associated glycoprotein 2 (poPAG2): its structural organization and analysis of its promoter.\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "NUCLEOTIDE SEQUENCE [GENOMIC DNA]\n" + "\n" + "Placenta\n" + "\n" + "\n" + "\n" + "\n" + "Secreted\n" + "Extracellular space\n" + "\n" + "\n" + "\n" + "Expressed throughout the chorion, with the signal localized exclusively over the trophectoderm.\n" + "\n" + "\n" + "Expression was detected at day 15, coinciding with the beginning of implantation, and continued throughout gestation.\n" + "\n" + "\n" + "Belongs to the peptidase A1 family.\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "Aspartyl protease\n" + "Disulfide bond\n" + "Glycoprotein\n" + "Hydrolase\n" + "Protease\n" + "Reference proteome\n" + "Secreted\n" + "Signal\n" + "Zymogen\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "\n" + "MKWLVILGLVALSDCLVMIPLTKVKSVRESLREKGLLKNFLKEHPYNMIQNLLSKNSSHVQKFSYQPLRNYLDMVYVGNISIGTPPQQFSVVFDTGSSDLWVPSIYCKSKACVTHRSFNPSHSSTFHDRGKSIKLEYGSGKMSGFLGQDTVRIGQLTSTGQAFGLSKEETGKAFEHAIFDGILGLAYPSIAIKGTTTVIDNLKKQDQISEPVFAFYLSSDKEEGSVVMFGGVDKKYYKGDLKWVPLTQTSYWQIALDRITCRGRVIGCPRGCQAIVDTGTSMLHGPSKAVAKIHSLIKHFEKEYVVPCNARKALPDIVFTINNVDYPVPAQAYIRKYVVPCNARKALPDIVFTINNVDYPVPAQAYIRKNANNNRCYSTFEDIMDTLNQREIWILGDVFLRLYFTVYDEGQNRIGLAQAT\n" + "\n" + " Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms Distributed under the Creative Commons Attribution (CC BY 4.0) License \n" + ""); @DataProvider public Object[][] problemEntries() { return new Object[][] { new Object[] { Q29079 } }; } @Test(groups = "Functional", dataProvider = "problemEntries") public SequenceI testimportOfProblemEntries(String entry) { Uniprot u = new Uniprot(); InputStream is = new ByteArrayInputStream(entry.getBytes()); List entries = u.getUniprotEntries(is); assertEquals(1, entries.size()); SequenceI sq = u.uniprotEntryToSequence(entries.get(0)); assertNotNull(sq); return sq; } @Test(groups = "Functional") public void checkIndefiniteSequenceFeatures() { SequenceI upseq = testimportOfProblemEntries(Q29079); List sf = upseq.getFeatures() .getPositionalFeatures("chain"); assertNotNull(sf); assertTrue(sf.size() == 1); SequenceFeature chainFeaure = sf.get(0); assertTrue(chainFeaure.getBegin() == 1); assertTrue(chainFeaure.getEnd() == upseq.getEnd()); assertNotNull(chainFeaure.getValueAsString("start_status")); assertNull(chainFeaure.getValueAsString("end_status")); assertTrue( "unknown".equals(chainFeaure.getValueAsString("start_status"))); } }