/*
* Jalview - A Sequence Alignment Editor and Viewer ($$Version-Rel$$)
* Copyright (C) $$Year-Rel$$ The Jalview Authors
*
* This file is part of Jalview.
*
* Jalview is free software: you can redistribute it and/or
* modify it under the terms of the GNU General Public License
* as published by the Free Software Foundation, either version 3
* of the License, or (at your option) any later version.
*
* Jalview is distributed in the hope that it will be useful, but
* WITHOUT ANY WARRANTY; without even the implied warranty
* of MERCHANTABILITY or FITNESS FOR A PARTICULAR
* PURPOSE. See the GNU General Public License for more details.
*
* You should have received a copy of the GNU General Public License
* along with Jalview. If not, see .
* The Jalview Authors are detailed in the 'AUTHORS' file.
*/
package jalview.ws.seqfetcher;
import static org.testng.AssertJUnit.assertEquals;
import static org.testng.AssertJUnit.assertFalse;
import static org.testng.AssertJUnit.assertNotNull;
import static org.testng.AssertJUnit.assertTrue;
import java.util.ArrayList;
import java.util.Arrays;
import java.util.List;
import org.junit.Assert;
import org.testng.annotations.AfterClass;
import org.testng.annotations.BeforeClass;
import org.testng.annotations.Test;
import jalview.analysis.CrossRef;
import jalview.datamodel.AlignmentAnnotation;
import jalview.datamodel.AlignmentI;
import jalview.datamodel.DBRefEntry;
import jalview.datamodel.DBRefSource;
import jalview.datamodel.FeatureProperties;
import jalview.datamodel.Sequence;
import jalview.datamodel.SequenceFeature;
import jalview.datamodel.SequenceI;
import jalview.gui.JvOptionPane;
import jalview.util.DBRefUtils;
import jalview.ws.DBRefFetcher;
import jalview.ws.SequenceFetcher;
import jalview.ws.dbsources.EBIAlfaFold;
import jalview.ws.dbsources.Pdb;
import jalview.ws.dbsources.Uniprot;
/**
* @author jimp
*
*/
public class DbRefFetcherTest
{
@BeforeClass(alwaysRun = true)
public void setUpJvOptionPane()
{
JvOptionPane.setInteractiveMode(false);
JvOptionPane.setMockResponse(JvOptionPane.CANCEL_OPTION);
}
/**
* @throws java.lang.Exception
*/
@BeforeClass(alwaysRun = true)
public static void setUpBeforeClass() throws Exception
{
jalview.bin.Console.initLogger();
}
/**
* @throws java.lang.Exception
*/
@AfterClass(alwaysRun = true)
public static void tearDownAfterClass() throws Exception
{
}
@Test(groups = { "Network" })
public void checkUniprotCanonicalFlagSet()
{
// TODO - mock this - for moment it is a live request.
SequenceI uniprotSeq = new Sequence("FER1_SPIOL",
"MAATTTTMMGMATTFVPKPQAPPMMAALPSNTGRSLFGLKTGSRGGRMTMAAYKVTLVTPTGNVEFQCPDDV"
+ "YILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKEEE"
+ "LTA");
DBRefFetcher dbr = new DBRefFetcher(new SequenceI[] { uniprotSeq });
dbr.fetchDBRefs(true);
List primRefs = uniprotSeq.getPrimaryDBRefs();
assertNotNull(primRefs);
assertTrue(primRefs.size() > 0);
boolean canonicalUp = false;
for (DBRefEntry ref : primRefs)
{
assertEquals(DBRefSource.UNIPROT, ref.getCanonicalSourceName());
canonicalUp |= ref.isCanonical();
}
assertTrue("No Canonical Uniprot reference detected", canonicalUp);
}
/**
* Tests that standard protein database sources include Uniprot (as the first)
* and also PDB. (Additional sources are dependent on availability of DAS
* services.)
*/
@Test(groups = { "Functional" })
public void testStandardProtDbs()
{
List defdb = new ArrayList();
defdb.addAll(Arrays.asList(DBRefSource.PROTEINDBS));
defdb.add(DBRefSource.PDB);
List srces = new ArrayList();
SequenceFetcher sfetcher = new SequenceFetcher();
boolean pdbFound = false;
for (String ddb : defdb)
{
List srcesfordb = sfetcher.getSourceProxy(ddb);
if (srcesfordb != null)
{
// TODO is this right? get duplicate entries
srces.addAll(srcesfordb);
}
}
int i = 0;
int uniprotPos = -1;
for (DbSourceProxy s : srces)
{
if (s instanceof Uniprot && uniprotPos == -1)
{
uniprotPos = i;
}
if (s instanceof Pdb)
{
pdbFound = true;
}
i++;
}
assertTrue("Failed to find Uniprot source as first source amongst "
+ srces.size() + " sources (source was at position "
+ uniprotPos + ")", uniprotPos == 0);
assertTrue("Failed to find PDB source amongst " + srces.size()
+ " sources", pdbFound);
}
/**
* Tests retrieval of one entry from EMBL. Test is dependent on availability
* of network and the EMBL service.
*
* @throws Exception
*/
@Test(groups = { "External" })
public void testEmblUniprotProductRecovery() throws Exception
{
String retrievalId = "V00488";
DbSourceProxy embl = new SequenceFetcher()
.getSourceProxy(DBRefSource.EMBL).get(0);
assertNotNull("Couldn't find the EMBL retrieval client", embl);
verifyProteinNucleotideXref(retrievalId, embl);
}
/**
* Tests retrieval of one entry from EMBLCDS. Test is dependent on
* availability of network and the EMBLCDS service.
*
* @throws Exception
*/
@Test(groups = { "External" })
public void testEmblCDSUniprotProductRecovery() throws Exception
{
String retrievalId = "AAH29712";
DbSourceProxy embl = new SequenceFetcher()
.getSourceProxy(DBRefSource.EMBLCDS).get(0);
assertNotNull("Couldn't find the EMBL retrieval client", embl);
verifyProteinNucleotideXref(retrievalId, embl);
}
/**
* Helper method to perform database retrieval and verification of results.
*
* @param retrievalId
* @param embl
* @throws Exception
*/
private void verifyProteinNucleotideXref(String retrievalId,
DbSourceProxy embl) throws Exception
{
AlignmentI alsq = embl.getSequenceRecords(retrievalId);
assertNotNull("Couldn't find the EMBL record " + retrievalId, alsq);
assertEquals("Didn't retrieve right number of records", 1,
alsq.getHeight());
SequenceI seq = alsq.getSequenceAt(0);
assertEquals("Wrong sequence name",
embl.getDbSource() + "|" + retrievalId, seq.getName());
List sfs = seq.getSequenceFeatures();
assertFalse("Sequence features missing", sfs.isEmpty());
assertTrue("Feature not CDS", FeatureProperties
.isCodingFeature(embl.getDbSource(), sfs.get(0).getType()));
assertEquals(embl.getDbSource(), sfs.get(0).getFeatureGroup());
List dr = DBRefUtils.selectRefs(seq.getDBRefs(),
new String[]
{ DBRefSource.UNIPROT });
assertNotNull(dr);
assertEquals("Expected a single Uniprot cross reference", 1, dr.size());
assertEquals("Expected cross reference map to be one amino acid",
dr.get(0).getMap().getMappedWidth(), 1);
assertEquals("Expected local reference map to be 3 nucleotides",
dr.get(0).getMap().getWidth(), 3);
AlignmentI sprods = new CrossRef(alsq.getSequencesArray(), alsq)
.findXrefSequences(dr.get(0).getSource(), true);
assertNotNull(
"Couldn't recover cross reference sequence from dataset. Was it ever added ?",
sprods);
assertEquals("Didn't xref right number of records", 1,
sprods.getHeight());
SequenceI proteinSeq = sprods.getSequenceAt(0);
assertEquals(proteinSeq.getSequenceAsString(),
dr.get(0).getMap().getTo().getSequenceAsString());
assertEquals(dr.get(0).getSource() + "|" + dr.get(0).getAccessionId(),
proteinSeq.getName());
}
/**
* Tests retrieval of one entry from EMBLCDS. Test is dependent on
* availability of network and the EMBLCDS service.
*
* @throws Exception
*/
@Test(groups = { "External" })
public void testAlphaFoldClien() throws Exception
{
DbSourceProxy alphafold = new EBIAlfaFold();
AlignmentI resp = alphafold
.getSequenceRecords(alphafold.getTestQuery());
assertNotNull(resp);
assertEquals("One sequence only", resp.getHeight(), 1);
for (AlignmentAnnotation aa : resp.getAlignmentAnnotation())
{
if (aa.graph == AlignmentAnnotation.CONTACT_MAP)
{
assertTrue("Contact map didn't provide valid contact",
resp.getContactListFor(aa, 1).getContactAt(1) != -1d);
// test passes
return;
}
}
Assert.fail("No pAE matrix found for alphafold structure.");
}
}