/*
* Jalview - A Sequence Alignment Editor and Viewer ($$Version-Rel$$)
* Copyright (C) $$Year-Rel$$ The Jalview Authors
*
* This file is part of Jalview.
*
* Jalview is free software: you can redistribute it and/or
* modify it under the terms of the GNU General Public License
* as published by the Free Software Foundation, either version 3
* of the License, or (at your option) any later version.
*
* Jalview is distributed in the hope that it will be useful, but
* WITHOUT ANY WARRANTY; without even the implied warranty
* of MERCHANTABILITY or FITNESS FOR A PARTICULAR
* PURPOSE. See the GNU General Public License for more details.
*
* You should have received a copy of the GNU General Public License
* along with Jalview. If not, see .
* The Jalview Authors are detailed in the 'AUTHORS' file.
*/
package jalview.ws.sifts;
import static org.testng.Assert.assertEquals;
import static org.testng.Assert.assertTrue;
import jalview.api.DBRefEntryI;
import jalview.bin.Cache;
import jalview.datamodel.DBRefEntry;
import jalview.datamodel.DBRefSource;
import jalview.datamodel.Sequence;
import jalview.datamodel.SequenceI;
import jalview.gui.JvOptionPane;
import jalview.io.DataSourceType;
import jalview.structure.StructureMapping;
import jalview.xml.binding.sifts.Entry.Entity;
import java.io.File;
import java.io.IOException;
import java.util.ArrayList;
import java.util.HashMap;
import org.testng.Assert;
import org.testng.FileAssert;
import org.testng.annotations.AfterTest;
import org.testng.annotations.BeforeClass;
import org.testng.annotations.BeforeTest;
import org.testng.annotations.Test;
import MCview.Atom;
import MCview.PDBfile;
public class SiftsClientTest
{
@BeforeClass(alwaysRun = true)
public void setUpJvOptionPane()
{
JvOptionPane.setInteractiveMode(false);
JvOptionPane.setMockResponse(JvOptionPane.CANCEL_OPTION);
}
public static final String DEFAULT_SIFTS_DOWNLOAD_DIR = System
.getProperty("user.home")
+ File.separatorChar
+ ".sifts_downloads" + File.separatorChar;
private String testPDBId = "1a70";
private SiftsClient siftsClient = null;
SequenceI testSeq = new Sequence(
"P00221",
"MAAT..TTTMMG..MATTFVPKPQAPPMMAALPSNTGR..SLFGLKT.GSR..GGRMTMA"
+ "AYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDD"
+ "QSFLDDDQIDEGWVLTCAAYPVSDVTIETHKEEELTA.", 1, 147);
int u = SiftsClient.UNASSIGNED;
HashMap expectedMapping = new HashMap();
@BeforeTest(alwaysRun = true)
public void populateExpectedMapping() throws SiftsException
{
expectedMapping.put(51, new int[] { 1, 2 });
expectedMapping.put(52, new int[] { 2, 7 });
expectedMapping.put(53, new int[] { 3, 12 });
expectedMapping.put(54, new int[] { 4, 24 });
expectedMapping.put(55, new int[] { 5, 33 });
expectedMapping.put(56, new int[] { 6, 40 });
expectedMapping.put(57, new int[] { 7, 47 });
expectedMapping.put(58, new int[] { 8, 55 });
expectedMapping.put(59, new int[] { 9, 62 });
expectedMapping.put(60, new int[] { 10, 69 });
expectedMapping.put(61, new int[] { 11, 76 });
expectedMapping.put(62, new int[] { 12, 83 });
expectedMapping.put(63, new int[] { 13, 87 });
expectedMapping.put(64, new int[] { 14, 95 });
expectedMapping.put(65, new int[] { 15, 102 });
expectedMapping.put(66, new int[] { 16, 111 });
expectedMapping.put(67, new int[] { 17, 122 });
expectedMapping.put(68, new int[] { 18, 131 });
expectedMapping.put(69, new int[] { 19, 137 });
expectedMapping.put(70, new int[] { 20, 144 });
expectedMapping.put(71, new int[] { 21, 152 });
expectedMapping.put(72, new int[] { 22, 160 });
expectedMapping.put(73, new int[] { 23, 167 });
expectedMapping.put(74, new int[] { 24, 179 });
expectedMapping.put(75, new int[] { 25, 187 });
expectedMapping.put(76, new int[] { 26, 195 });
expectedMapping.put(77, new int[] { 27, 203 });
expectedMapping.put(78, new int[] { 28, 208 });
expectedMapping.put(79, new int[] { 29, 213 });
expectedMapping.put(80, new int[] { 30, 222 });
expectedMapping.put(81, new int[] { 31, 231 });
expectedMapping.put(82, new int[] { 32, 240 });
expectedMapping.put(83, new int[] { 33, 244 });
expectedMapping.put(84, new int[] { 34, 252 });
expectedMapping.put(85, new int[] { 35, 260 });
expectedMapping.put(86, new int[] { 36, 268 });
expectedMapping.put(87, new int[] { 37, 275 });
expectedMapping.put(88, new int[] { 38, 287 });
expectedMapping.put(89, new int[] { 39, 293 });
expectedMapping.put(90, new int[] { 40, 299 });
expectedMapping.put(91, new int[] { 41, 310 });
expectedMapping.put(92, new int[] { 42, 315 });
expectedMapping.put(93, new int[] { 43, 319 });
expectedMapping.put(94, new int[] { 44, 325 });
expectedMapping.put(95, new int[] { 45, 331 });
expectedMapping.put(96, new int[] { 46, 337 });
expectedMapping.put(97, new int[] { 47, 343 });
expectedMapping.put(98, new int[] { 48, 349 });
expectedMapping.put(99, new int[] { 49, 354 });
expectedMapping.put(100, new int[] { 50, 358 });
expectedMapping.put(101, new int[] { 51, 367 });
expectedMapping.put(102, new int[] { 52, 375 });
expectedMapping.put(103, new int[] { 53, 384 });
expectedMapping.put(104, new int[] { 54, 391 });
expectedMapping.put(105, new int[] { 55, 395 });
expectedMapping.put(106, new int[] { 56, 401 });
expectedMapping.put(107, new int[] { 57, 409 });
expectedMapping.put(108, new int[] { 58, 417 });
expectedMapping.put(109, new int[] { 59, 426 });
expectedMapping.put(110, new int[] { 60, 434 });
expectedMapping.put(111, new int[] { 61, 442 });
expectedMapping.put(112, new int[] { 62, 451 });
expectedMapping.put(113, new int[] { 63, 457 });
expectedMapping.put(114, new int[] { 64, 468 });
expectedMapping.put(115, new int[] { 65, 476 });
expectedMapping.put(116, new int[] { 66, 484 });
expectedMapping.put(117, new int[] { 67, 492 });
expectedMapping.put(118, new int[] { 68, 500 });
expectedMapping.put(119, new int[] { 69, 509 });
expectedMapping.put(120, new int[] { 70, 517 });
expectedMapping.put(121, new int[] { 71, 525 });
expectedMapping.put(122, new int[] { 72, 534 });
expectedMapping.put(123, new int[] { 73, 538 });
expectedMapping.put(124, new int[] { 74, 552 });
expectedMapping.put(125, new int[] { 75, 559 });
expectedMapping.put(126, new int[] { 76, 567 });
expectedMapping.put(127, new int[] { 77, 574 });
expectedMapping.put(128, new int[] { 78, 580 });
expectedMapping.put(129, new int[] { 79, 585 });
expectedMapping.put(130, new int[] { 80, 590 });
expectedMapping.put(131, new int[] { 81, 602 });
expectedMapping.put(132, new int[] { 82, 609 });
expectedMapping.put(133, new int[] { 83, 616 });
expectedMapping.put(134, new int[] { 84, 622 });
expectedMapping.put(135, new int[] { 85, 630 });
expectedMapping.put(136, new int[] { 86, 637 });
expectedMapping.put(137, new int[] { 87, 644 });
expectedMapping.put(138, new int[] { 88, 652 });
expectedMapping.put(139, new int[] { 89, 661 });
expectedMapping.put(140, new int[] { 90, 668 });
expectedMapping.put(141, new int[] { 91, 678 });
expectedMapping.put(142, new int[] { 92, 687 });
expectedMapping.put(143, new int[] { 93, 696 });
expectedMapping.put(144, new int[] { 94, 705 });
expectedMapping.put(145, new int[] { 95, 714 });
expectedMapping.put(146, new int[] { 96, 722 });
expectedMapping.put(147, new int[] { 97, 729 });
}
@BeforeTest(alwaysRun = true)
public void setUpSiftsClient() throws SiftsException, IOException
{
// read test props before manipulating config
Cache.loadProperties("test/jalview/io/testProps.jvprops");
// SIFTs entries are updated weekly - so use saved SIFTs file to enforce
// test reproducibility
new SiftsSettings();
SiftsSettings.setSiftDownloadDirectory(jalview.bin.Cache.getDefault(
"sifts_download_dir", DEFAULT_SIFTS_DOWNLOAD_DIR));
SiftsSettings.setMapWithSifts(true);
SiftsSettings.setCacheThresholdInDays("2");
SiftsSettings.setFailSafePIDThreshold("70");
PDBfile pdbFile;
pdbFile = new PDBfile(false, false, false, "test/jalview/io/"
+ testPDBId + ".pdb", DataSourceType.FILE);
siftsClient = new SiftsClient(pdbFile);
}
@AfterTest(alwaysRun = true)
public void cleanUpSiftsClient()
{
siftsClient = null;
}
@Test(groups = { "Network" })
public void getSIFTsFileTest() throws SiftsException, IOException
{
File siftsFile;
siftsFile = SiftsClient.downloadSiftsFile(testPDBId);
FileAssert.assertFile(siftsFile);
long t1 = siftsFile.lastModified();
// re-read file should be returned from cache
siftsFile = SiftsClient.downloadSiftsFile(testPDBId);
FileAssert.assertFile(siftsFile);
long t2 = siftsFile.lastModified();
assertEquals(t1, t2);
/*
* force fetch by having 0 expiry of cache
* also wait one second, because file timestamp does not
* give millisecond resolution :-(
*/
synchronized (this)
{
try
{
wait(1000);
} catch (InterruptedException e)
{
}
}
SiftsSettings.setCacheThresholdInDays("0");
siftsFile = SiftsClient.getSiftsFile(testPDBId);
FileAssert.assertFile(siftsFile);
long t3 = siftsFile.lastModified();
assertTrue(t3 > t2, "file timestamp unchanged at " + t3);
SiftsSettings.setCacheThresholdInDays("2");
}
@Test(groups = { "Network" })
public void downloadSiftsFileTest() throws SiftsException, IOException
{
// Assert that file isn't yet downloaded - if already downloaded, assert it
// is deleted
Assert.assertTrue(SiftsClient.deleteSiftsFileByPDBId(testPDBId));
File siftsFile;
siftsFile = SiftsClient.downloadSiftsFile(testPDBId);
FileAssert.assertFile(siftsFile);
SiftsClient.downloadSiftsFile(testPDBId);
}
@Test(groups = { "Network" })
public void getAllMappingAccessionTest()
{
Assert.assertNotNull(siftsClient);
Assert.assertNotNull(siftsClient.getAllMappingAccession());
Assert.assertTrue(siftsClient.getAllMappingAccession().size() > 1);
}
@Test(groups = { "Network" })
public void getGreedyMappingTest()
{
Assert.assertNotNull(siftsClient);
Assert.assertNotNull(testSeq);
Assert.assertNotNull(expectedMapping);
// TODO delete when auto-fetching of DBRefEntry is implemented
DBRefEntry dbRef = new DBRefEntry("uniprot", "", "P00221");
testSeq.addDBRef(dbRef);
// testSeq.setSourceDBRef(dbRef);
try
{
HashMap actualMapping = siftsClient.getGreedyMapping(
"A", testSeq, null);
Assert.assertEquals(testSeq.getStart(), 1);
Assert.assertEquals(testSeq.getEnd(), 147);
Assert.assertEquals(actualMapping, expectedMapping);
} catch (Exception e)
{
e.printStackTrace();
Assert.fail("Exception thrown while generating mapping...");
}
}
@Test(groups = { "Network" })
private void getAtomIndexTest()
{
ArrayList atoms = new ArrayList();
Atom atom = new Atom(u, u, u);
atom.resNumber = 43;
atom.atomIndex = 7;
atoms.add(atom);
int actualAtomIndex = siftsClient.getAtomIndex(1, atoms);
Assert.assertEquals(actualAtomIndex, -1);
actualAtomIndex = siftsClient.getAtomIndex(43, atoms);
Assert.assertEquals(actualAtomIndex, 7);
}
@Test(
groups = { "Network" },
expectedExceptions = IllegalArgumentException.class)
private void getAtomIndexNullTest()
{
siftsClient.getAtomIndex(1, null);
}
@Test(groups = { "Network" })
private void padWithGapsTest()
{
}
@Test(
groups = { "Network" },
expectedExceptions = SiftsException.class)
private void populateAtomPositionsNullTest1()
throws IllegalArgumentException, SiftsException
{
siftsClient.populateAtomPositions(null, null);
}
@Test(
groups = { "Network" },
expectedExceptions = SiftsException.class)
private void populateAtomPositionsNullTest2()
throws IllegalArgumentException, SiftsException
{
siftsClient.populateAtomPositions("A", null);
}
@Test(groups = { "Network" })
public void getValidSourceDBRefTest() throws SiftsException
{
DBRefEntryI actualValidSrcDBRef = siftsClient
.getValidSourceDBRef(testSeq);
DBRefEntryI expectedDBRef = new DBRefEntry();
expectedDBRef.setSource(DBRefSource.UNIPROT);
expectedDBRef.setAccessionId("P00221");
expectedDBRef.setVersion("");
Assert.assertEquals(actualValidSrcDBRef, expectedDBRef);
}
@Test(
groups = { "Network" },
expectedExceptions = SiftsException.class)
public void getValidSourceDBRefExceptionTest() throws SiftsException
{
SequenceI invalidTestSeq = new Sequence("testSeq", "ABCDEFGH");
siftsClient.getValidSourceDBRef(invalidTestSeq);
}
@Test(
groups = { "Network" },
expectedExceptions = SiftsException.class)
public void getValidSourceDBRefExceptionXTest() throws SiftsException
{
SequenceI invalidTestSeq = new Sequence("testSeq", "ABCDEFGH");
DBRefEntry invalidDBRef = new DBRefEntry();
invalidDBRef.setAccessionId("BLAR");
invalidTestSeq.addDBRef(invalidDBRef);
siftsClient.getValidSourceDBRef(invalidTestSeq);
}
@Test(groups = { "Network" })
public void isValidDBRefEntryTest()
{
DBRefEntryI validDBRef = new DBRefEntry();
validDBRef.setSource(DBRefSource.UNIPROT);
validDBRef.setAccessionId("P00221");
validDBRef.setVersion("");
Assert.assertTrue(siftsClient.isValidDBRefEntry(validDBRef));
}
@Test(groups = { "Network" })
public void getSiftsStructureMappingTest() throws SiftsException
{
Assert.assertTrue(SiftsSettings.isMapWithSifts());
StructureMapping strucMapping = siftsClient.getSiftsStructureMapping(
testSeq, testPDBId, "A");
String expectedMappingOutput = "\nSequence ⟷ Structure mapping details\n"
+ "Method: SIFTS\n\n"
+ "P00221 : 51 - 147 Maps to \n"
+ "1A70|A : 1 - 97\n\n"
+ "P00221 AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLD\n"
+ " |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||\n"
+ "1A70|A AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLD\n\n"
+ "P00221 DDQIDEGWVLTCAAYPVSDVTIETHKEEELTA\n"
+ " |||||||||||||||||||||||||| |||||\n"
+ "1A70|A DDQIDEGWVLTCAAYPVSDVTIETHKKEELTA\n\n" +
"Length of alignment = 97\n" + "Percentage ID = 98.97\n";
Assert.assertEquals(strucMapping.getMappingDetailsOutput(),
expectedMappingOutput);
Assert.assertEquals(strucMapping.getMapping(), expectedMapping);
}
@Test(groups = { "Network" })
public void getEntityCountTest()
{
int actualEntityCount = siftsClient.getEntityCount();
System.out.println("actual entity count : " + actualEntityCount);
Assert.assertEquals(actualEntityCount, 1);
}
@Test(groups = { "Network" })
public void getDbAccessionIdTest()
{
String actualDbAccId = siftsClient.getDbAccessionId();
System.out.println("Actual Db Accession Id: " + actualDbAccId);
Assert.assertEquals(actualDbAccId, "1a70");
}
@Test(groups = { "Network" })
public void getDbCoordSysTest()
{
String actualDbCoordSys = siftsClient.getDbCoordSys();
System.out.println("Actual DbCoordSys: " + actualDbCoordSys);
Assert.assertEquals(actualDbCoordSys, "PDBe");
}
@Test(groups = { "Network" })
public void getDbSourceTest()
{
String actualDbSource = siftsClient.getDbSource();
System.out.println("Actual DbSource: " + actualDbSource);
Assert.assertEquals(actualDbSource, "PDBe");
}
@Test(groups = { "Network" })
public void getDbVersionTest()
{
String actualDbVersion = siftsClient.getDbVersion();
System.out.println("Actual DbVersion: " + actualDbVersion);
Assert.assertEquals(actualDbVersion, "2.0");
}
@Test(groups = { "Network" })
public void getEntityByMostOptimalMatchedIdTest1() throws IOException,
SiftsException
{
SiftsClient siftsClientX = null;
PDBfile pdbFile;
pdbFile = new PDBfile(false, false, false, "test/jalview/io/2nq2"
+ ".pdb", DataSourceType.FILE);
siftsClientX = new SiftsClient(pdbFile);
Entity entityA = siftsClientX.getEntityByMostOptimalMatchedId("A");
Assert.assertEquals(entityA.getEntityId(), "A");
Entity entityB = siftsClientX.getEntityByMostOptimalMatchedId("B");
Assert.assertEquals(entityB.getEntityId(), "C");
Entity entityC = siftsClientX.getEntityByMostOptimalMatchedId("C");
Assert.assertEquals(entityC.getEntityId(), "B");
Entity entityD = siftsClientX.getEntityByMostOptimalMatchedId("D");
Assert.assertEquals(entityD.getEntityId(), "D");
}
@Test(groups = { "Network" })
public void getEntityByMostOptimalMatchedIdTest2() throws IOException,
SiftsException
{
// This test is for a SIFTS file in which entity A should map to chain P for
// the given PDB Id. All the other chains shouldn't be mapped as there are
// no SIFTS entity records for them.
SiftsClient siftsClientX = null;
PDBfile pdbFile;
pdbFile = new PDBfile(false, false, false, "test/jalview/io/3ucu.cif",
DataSourceType.FILE);
siftsClientX = new SiftsClient(pdbFile);
Entity entityA = siftsClientX.getEntityByMostOptimalMatchedId("P");
Entity entityP = siftsClientX.getEntityByMostOptimalMatchedId("A");
Entity entityR = siftsClientX.getEntityByMostOptimalMatchedId("R");
Assert.assertEquals(entityA.getEntityId(), "A");
Assert.assertNotEquals(entityR, "A");
Assert.assertNotEquals(entityP, "A");
Assert.assertNotEquals(entityR, "R");
Assert.assertNotEquals(entityP, "P");
Assert.assertNull(entityR);
Assert.assertNull(entityP);
}
}