X-Git-Url: http://source.jalview.org/gitweb/?a=blobdiff_plain;ds=inline;f=forester%2Fjava%2Fsrc%2Forg%2Fforester%2Ftest%2FTest.java;h=de8ec6eab73617e7b5bc0b049f8d60d6085336b9;hb=4a71774e563925de62c37378a6c32c3275f2e287;hp=d6e508ad1fda987e98d0f48b769271d3adb55395;hpb=10297bd8b8a4b4ab198a17a42fc6ff24ae2ed49b;p=jalview.git diff --git a/forester/java/src/org/forester/test/Test.java b/forester/java/src/org/forester/test/Test.java index d6e508a..de8ec6e 100644 --- a/forester/java/src/org/forester/test/Test.java +++ b/forester/java/src/org/forester/test/Test.java @@ -40,6 +40,9 @@ import java.util.Locale; import java.util.Set; import java.util.SortedSet; +import javax.net.ssl.HttpsURLConnection; +import javax.net.ssl.SSLContext; + import org.forester.application.support_transfer; import org.forester.archaeopteryx.AptxUtil; import org.forester.archaeopteryx.TreePanelUtil; @@ -125,10 +128,7 @@ import org.forester.util.SequenceAccessionTools; import org.forester.ws.seqdb.SequenceDatabaseEntry; import org.forester.ws.seqdb.SequenceDbWsTools; import org.forester.ws.seqdb.UniProtTaxonomy; -import org.forester.ws.wabi.TxSearch; -import org.forester.ws.wabi.TxSearch.RANKS; -import org.forester.ws.wabi.TxSearch.TAX_NAME_CLASS; -import org.forester.ws.wabi.TxSearch.TAX_RANK; + @SuppressWarnings( "unused") public final class Test { @@ -139,7 +139,7 @@ public final class Test { private final static String PATH_TO_TEST_DATA = System.getProperty( "user.dir" ) + ForesterUtil.getFileSeparator() + "test_data" + ForesterUtil.getFileSeparator(); - private final static boolean PERFORM_DB_TESTS = false; + private final static boolean PERFORM_DB_TESTS = true; private static final boolean PERFORM_WEB_TREE_ACCESS = true; private static final String PHYLOXML_LOCAL_XSD = PATH_TO_RESOURCES + "phyloxml_schema/" + ForesterConstants.PHYLO_XML_VERSION + "/" @@ -150,7 +150,7 @@ public final class Test { private final static boolean USE_LOCAL_PHYLOXML_SCHEMA = true; private final static double ZERO_DIFF = 1.0E-9; - public static boolean isEqual( final double a, final double b ) { + private static boolean isEqual( final double a, final double b ) { return ( ( Math.abs( a - b ) ) < Test.ZERO_DIFF ); } @@ -181,15 +181,7 @@ public final class Test { System.exit( -1 ); } final long start_time = new Date().getTime(); - System.out.print( "MSA entropy: " ); - if ( Test.testMsaEntropy() ) { - System.out.println( "OK." ); - succeeded++; - } - else { - System.out.println( "failed." ); - failed++; - } + System.out.print( "Basic node methods: " ); if ( Test.testBasicNodeMethods() ) { System.out.println( "OK." ); @@ -352,6 +344,15 @@ public final class Test { System.out.println( "failed." ); failed++; } + System.out.print( "Node construction and parsing of NHX (node level): " ); + if ( Test.testNHXNodeParsing2() ) { + System.out.println( "OK." ); + succeeded++; + } + else { + System.out.println( "failed." ); + failed++; + } System.out.print( "NHX parsing iterating: " ); if ( Test.testNHParsingIter() ) { System.out.println( "OK." ); @@ -370,6 +371,15 @@ public final class Test { System.out.println( "failed." ); failed++; } + System.out.print( "NH parsing - special chars: " ); + if ( Test.testNHParsingSpecialChars() ) { + System.out.println( "OK." ); + succeeded++; + } + else { + System.out.println( "failed." ); + failed++; + } System.out.print( "Conversion to NHX (node level): " ); if ( Test.testNHXconversion() ) { System.out.println( "OK." ); @@ -469,6 +479,15 @@ public final class Test { System.out.println( "failed." ); failed++; } + System.out.print( "phyloXML parsing (validating against schema): " ); + if ( testPhyloXMLparsingValidating() ) { + System.out.println( "OK." ); + succeeded++; + } + else { + System.out.println( "failed." ); + failed++; + } System.out.print( "Roundtrip phyloXML parsing (validating against schema): " ); if ( Test.testBasicPhyloXMLparsingRoundtrip() ) { System.out.println( "OK." ); @@ -496,6 +515,15 @@ public final class Test { System.out.println( "failed." ); failed++; } + System.out.print( "UTF-8 parsing from file: " ); + if ( Test.testUTF8ParsingFromFile() ) { + System.out.println( "OK." ); + succeeded++; + } + else { + System.out.println( "failed." ); + failed++; + } System.out.print( "Copying of node data: " ); if ( Test.testCopyOfNodeData() ) { System.out.println( "OK." ); @@ -931,6 +959,15 @@ public final class Test { System.out.println( "failed." ); failed++; } + System.out.print( "MSA entropy: " ); + if ( Test.testMsaEntropy() ) { + System.out.println( "OK." ); + succeeded++; + } + else { + System.out.println( "failed." ); + failed++; + } if ( PERFORM_DB_TESTS ) { System.out.print( "Uniprot Entry Retrieval: " ); if ( Test.testUniprotEntryRetrieval() ) { @@ -971,8 +1008,8 @@ public final class Test { } } if ( PERFORM_WEB_TREE_ACCESS ) { - System.out.print( "NHX parsing from URL: " ); - if ( Test.testNHXparsingFromURL() ) { + System.out.print( "TreeBase acccess: " ); + if ( Test.testTreeBaseReading() ) { System.out.println( "OK." ); succeeded++; } @@ -980,8 +1017,8 @@ public final class Test { System.out.println( "failed." ); failed++; } - System.out.print( "NHX parsing from URL 2: " ); - if ( Test.testNHXparsingFromURL2() ) { + System.out.print( "ToL access: " ); + if ( Test.testToLReading() ) { System.out.println( "OK." ); succeeded++; } @@ -989,8 +1026,8 @@ public final class Test { System.out.println( "failed." ); failed++; } - System.out.print( "phyloXML parsing from URL: " ); - if ( Test.testPhyloXMLparsingFromURL() ) { + System.out.print( "NHX parsing from URL: " ); + if ( Test.testNHXparsingFromURL() ) { System.out.println( "OK." ); succeeded++; } @@ -998,8 +1035,8 @@ public final class Test { System.out.println( "failed." ); failed++; } - System.out.print( "TreeBase acccess: " ); - if ( Test.testTreeBaseReading() ) { + System.out.print( "NHX parsing from URL 2: " ); + if ( Test.testNHXparsingFromURL2() ) { System.out.println( "OK." ); succeeded++; } @@ -1007,9 +1044,8 @@ public final class Test { System.out.println( "failed." ); failed++; } - // - System.out.print( "ToL access: " ); - if ( Test.testToLReading() ) { + System.out.print( "phyloXML parsing from URL: " ); + if ( Test.testPhyloXMLparsingFromURL() ) { System.out.println( "OK." ); succeeded++; } @@ -1017,7 +1053,6 @@ public final class Test { System.out.println( "failed." ); failed++; } - // System.out.print( "TreeFam access: " ); if ( Test.testTreeFamReading() ) { System.out.println( "OK." ); @@ -1027,8 +1062,6 @@ public final class Test { System.out.println( "failed." ); failed++; } - // - // System.out.print( "Pfam tree access: " ); if ( Test.testPfamTreeReading() ) { System.out.println( "OK." ); @@ -1057,7 +1090,7 @@ public final class Test { } } - public static boolean testEngulfingOverlapRemoval() { + private static boolean testEngulfingOverlapRemoval() { try { final Domain d0 = new BasicDomain( "d0", 0, 8, ( short ) 1, ( short ) 1, 0.1, 1 ); final Domain d1 = new BasicDomain( "d1", 0, 1, ( short ) 1, ( short ) 1, 0.1, 1 ); @@ -1156,7 +1189,7 @@ public final class Test { return true; } - public static final boolean testNHXparsingFromURL2() { + private static final boolean testNHXparsingFromURL2() { try { final String s = "https://sites.google.com/site/cmzmasek/home/software/archaeopteryx/examples/simple/simple_1.nh"; final Phylogeny phys[] = AptxUtil.readPhylogeniesFromUrl( new URL( s ), @@ -1223,7 +1256,7 @@ public final class Test { return true; } - public static final boolean testNHXparsingFromURL() { + private static final boolean testNHXparsingFromURL() { try { final String s = "https://sites.google.com/site/cmzmasek/home/software/archaeopteryx/examples/simple/simple_1.nh"; final URL u = new URL( s ); @@ -1291,7 +1324,7 @@ public final class Test { return true; } - public static boolean testOverlapRemoval() { + private static boolean testOverlapRemoval() { try { final Domain d0 = new BasicDomain( "d0", ( short ) 2, ( short ) 5, ( short ) 1, ( short ) 1, 0.1, 1 ); final Domain d1 = new BasicDomain( "d1", ( short ) 7, ( short ) 10, ( short ) 1, ( short ) 1, 0.1, 1 ); @@ -1445,15 +1478,14 @@ public final class Test { return true; } - public static final boolean testPfamTreeReading() { + private static final boolean testPfamTreeReading() { try { final URL u = new URL( WebserviceUtil.PFAM_SERVER + "/family/PF" + "01849" + "/tree/download" ); final NHXParser parser = new NHXParser(); parser.setTaxonomyExtraction( NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT ); parser.setReplaceUnderscores( false ); parser.setGuessRootedness( true ); - final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance(); - final Phylogeny[] phys = factory.create( u.openStream(), parser ); + final Phylogeny[] phys = ForesterUtil.readPhylogeniesFromUrl( u, parser); if ( ( phys == null ) || ( phys.length != 1 ) ) { return false; } @@ -1463,31 +1495,37 @@ public final class Test { } catch ( final Exception e ) { e.printStackTrace(); + return false; } return true; } - public static final boolean testPhyloXMLparsingFromURL() { + private static final boolean testPhyloXMLparsingFromURL() { try { final String s = "https://sites.google.com/site/cmzmasek/home/software/archaeopteryx/examples/archaeopteryx_a/apaf_bcl2.xml"; final URL u = new URL( s ); - final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance(); - final Phylogeny[] phys = factory.create( u.openStream(), PhyloXmlParser.createPhyloXmlParser() ); + final Phylogeny[] phys = ForesterUtil.readPhylogeniesFromUrl( u, PhyloXmlParser.createPhyloXmlParser() ); + if ( ( phys == null ) || ( phys.length != 2 ) ) { return false; } + final Phylogeny[] phys2 = ForesterUtil.readPhylogeniesFromUrl( u, PhyloXmlParser.createPhyloXmlParser() ); + + if ( ( phys2 == null ) || ( phys2.length != 2 ) ) { + return false; + } } catch ( final Exception e ) { e.printStackTrace(); + return false; } return true; } - public static final boolean testToLReading() { + private static final boolean testToLReading() { try { final URL u = new URL( WebserviceUtil.TOL_URL_BASE + "15079" ); - final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance(); - final Phylogeny[] phys = factory.create( u.openStream(), new TolParser() ); + final Phylogeny[] phys = ForesterUtil.readPhylogeniesFromUrl( u, new TolParser() ); if ( ( phys == null ) || ( phys.length != 1 ) ) { return false; } @@ -1500,47 +1538,138 @@ public final class Test { if ( phys[ 0 ].getNumberOfExternalNodes() < 5 ) { return false; } + // + final URL u2 = new URL( WebserviceUtil.TOL_URL_BASE + "17706" ); + final Phylogeny[] phys2 = ForesterUtil.readPhylogeniesFromUrl( u2, new TolParser() ); + if ( ( phys2 == null ) || ( phys2.length != 1 ) ) { + return false; + } + if ( !phys2[ 0 ].getRoot().getNodeData().getTaxonomy().getIdentifier().getValue().equals( "17706" ) ) { + return false; + } + if ( phys2[ 0 ].getNumberOfExternalNodes() < 5 ) { + return false; + } } catch ( final Exception e ) { e.printStackTrace(); + return false; } return true; } - public static final boolean testTreeBaseReading() { + private static final boolean testTreeBaseReading() { try { - final URL u = new URL( WebserviceUtil.TREEBASE_PHYLOWS_TREE_URL_BASE + "825?format=nexus" ); + final URL u = new URL( WebserviceUtil.TREEBASE_PHYLOWS_TREE_URL_BASE + "72557?format=nexus" ); final NexusPhylogeniesParser parser = new NexusPhylogeniesParser(); parser.setReplaceUnderscores( true ); - final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance(); - final Phylogeny[] phys = factory.create( u.openStream(), parser ); + final Phylogeny[] phys = ForesterUtil.readPhylogeniesFromUrl( u, parser ); if ( ( phys == null ) || ( phys.length != 1 ) ) { return false; } + final URL u_1 = new URL( WebserviceUtil.TREEBASE_PHYLOWS_TREE_URL_BASE + "2406?format=nexus" ); + final NexusPhylogeniesParser parser_1 = new NexusPhylogeniesParser(); + final Phylogeny[] phys_1 = ForesterUtil.readPhylogeniesFromUrl( u_1, parser_1 ); + if ( ( phys_1 == null ) || ( phys_1.length != 1 ) ) { + return false; + } + final URL u_2 = new URL( WebserviceUtil.TREEBASE_PHYLOWS_TREE_URL_BASE + "422?format=nexus" ); + final NexusPhylogeniesParser parser_2 = new NexusPhylogeniesParser(); + final Phylogeny[] phys_2 = ForesterUtil.readPhylogeniesFromUrl( u_2, parser_2 ); + if ( ( phys_2 == null ) || ( phys_2.length != 1 ) ) { + return false; + } + final URL u_3 = new URL( WebserviceUtil.TREEBASE_PHYLOWS_TREE_URL_BASE + "2654?format=nexus" ); + final NexusPhylogeniesParser parser_3 = new NexusPhylogeniesParser(); + final Phylogeny[] phys_3 = ForesterUtil.readPhylogeniesFromUrl( u_3, parser_3 ); + if ( ( phys_3 == null ) || ( phys_3.length != 1 ) ) { + return false; + } + final URL u_4 = new URL( WebserviceUtil.TREEBASE_PHYLOWS_TREE_URL_BASE + "825?format=nexus" ); + final NexusPhylogeniesParser parser_4 = new NexusPhylogeniesParser(); + final Phylogeny[] phys_4 = ForesterUtil.readPhylogeniesFromUrl( u_4, parser_4 ); + if ( ( phys_4 == null ) || ( phys_4.length != 1 ) ) { + return false; + } final URL u2 = new URL( WebserviceUtil.TREEBASE_PHYLOWS_STUDY_URL_BASE + "15613?format=nexus" ); final NexusPhylogeniesParser parser2 = new NexusPhylogeniesParser(); parser2.setReplaceUnderscores( true ); - final PhylogenyFactory factory2 = ParserBasedPhylogenyFactory.getInstance(); - final Phylogeny[] phys2 = factory2.create( u2.openStream(), parser2 ); + final Phylogeny[] phys2 = ForesterUtil.readPhylogeniesFromUrl( u2, parser2 ); if ( ( phys2 == null ) || ( phys2.length != 9 ) ) { return false; } + final URL u3 = new URL( WebserviceUtil.TREEBASE_PHYLOWS_STUDY_URL_BASE + "14909?format=nexus" ); + final NexusPhylogeniesParser parser3 = new NexusPhylogeniesParser(); + final Phylogeny[] phys3 = ForesterUtil.readPhylogeniesFromUrl( u3, parser3 ); + if ( ( phys3 == null ) || ( phys3.length != 2 ) ) { + return false; + } + final Phylogeny[] phys4 = ForesterUtil.readPhylogeniesFromUrl( new URL( WebserviceUtil.TREEBASE_PHYLOWS_STUDY_URL_BASE + "14525?format=nexus" ), + new NexusPhylogeniesParser() ); + if ( ( phys4 == null ) || ( phys4.length != 1 ) ) { + return false; + } + final Phylogeny[] phys5 = ForesterUtil.readPhylogeniesFromUrl( new URL( WebserviceUtil.TREEBASE_PHYLOWS_STUDY_URL_BASE + "15632?format=nexus" ) , + new NexusPhylogeniesParser() ); + if ( ( phys5 == null ) || ( phys5.length != 1 ) ) { + return false; + } + final Phylogeny[] phys6 = ForesterUtil.readPhylogeniesFromUrl( new URL( WebserviceUtil.TREEBASE_PHYLOWS_STUDY_URL_BASE + "10190?format=nexus" ) , + new NexusPhylogeniesParser() ); + if ( ( phys6 == null ) || ( phys6.length != 1 ) ) { + return false; + } + final Phylogeny[] phys7 = ForesterUtil.readPhylogeniesFromUrl( new URL( WebserviceUtil.TREEBASE_PHYLOWS_STUDY_URL_BASE + "13246?format=nexus" ) , + new NexusPhylogeniesParser() ); + if ( ( phys7 == null ) || ( phys7.length != 2 ) ) { + return false; + } + final Phylogeny[] phys8 = ForesterUtil.readPhylogeniesFromUrl( new URL( WebserviceUtil.TREEBASE_PHYLOWS_STUDY_URL_BASE + "11662?format=nexus" ) , + new NexusPhylogeniesParser() ); + if ( ( phys8 == null ) || ( phys8.length != 2 ) ) { + return false; + } + final Phylogeny[] phys9 = ForesterUtil.readPhylogeniesFromUrl( new URL( WebserviceUtil.TREEBASE_PHYLOWS_STUDY_URL_BASE + "562?format=nexus" ) , + new NexusPhylogeniesParser() ); + if ( ( phys9 == null ) || ( phys9.length != 4 ) ) { + return false; + } + final Phylogeny[] phys16424 = ForesterUtil.readPhylogeniesFromUrl( new URL( WebserviceUtil.TREEBASE_PHYLOWS_STUDY_URL_BASE + "16424?format=nexus" ) , + new NexusPhylogeniesParser() ); + if ( ( phys16424 == null ) || ( phys16424.length != 1 ) ) { + return false; + } + final Phylogeny[] phys17878 = ForesterUtil.readPhylogeniesFromUrl( new URL( WebserviceUtil.TREEBASE_PHYLOWS_STUDY_URL_BASE + "17878?format=nexus" ) , + new NexusPhylogeniesParser() ); + if ( ( phys17878 == null ) || ( phys17878.length != 17 ) ) { + return false; + } + final Phylogeny[] phys18804 = ForesterUtil.readPhylogeniesFromUrl( new URL( WebserviceUtil.TREEBASE_PHYLOWS_STUDY_URL_BASE + "18804?format=nexus" ) , + new NexusPhylogeniesParser() ); + if ( ( phys18804 == null ) || ( phys18804.length != 2 ) ) { + return false; + } + final Phylogeny[] phys346 = ForesterUtil.readPhylogeniesFromUrl( new URL( WebserviceUtil.TREEBASE_PHYLOWS_STUDY_URL_BASE + "346?format=nexus" ) , + new NexusPhylogeniesParser() ); + if ( ( phys346 == null ) || ( phys346.length != 1 ) ) { + return false; + } } catch ( final Exception e ) { e.printStackTrace(); + return false; } return true; } - public static final boolean testTreeFamReading() { + private static final boolean testTreeFamReading() { try { final URL u = new URL( WebserviceUtil.TREE_FAM_URL_BASE + "101004" + "/tree/newick" ); final NHXParser parser = new NHXParser(); parser.setTaxonomyExtraction( NHXParser.TAXONOMY_EXTRACTION.NO ); parser.setReplaceUnderscores( false ); parser.setGuessRootedness( true ); - final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance(); - final Phylogeny[] phys = factory.create( u.openStream(), parser ); + final Phylogeny[] phys = ForesterUtil.readPhylogeniesFromUrl( u, parser ); if ( ( phys == null ) || ( phys.length != 1 ) ) { return false; } @@ -1550,6 +1679,7 @@ public final class Test { } catch ( final Exception e ) { e.printStackTrace(); + return false; } return true; } @@ -1696,12 +1826,258 @@ public final class Test { } return true; } + + private static boolean testUTF8ParsingFromFile() { + try { + final PhyloXmlParser xml_parser = PhyloXmlParser.createPhyloXmlParser(); + final Phylogeny[] phylogenies_xml = ParserBasedPhylogenyFactory.getInstance().create( new File( Test.PATH_TO_TEST_DATA + "chars.xml" ), + xml_parser ); + if ( xml_parser.getErrorCount() > 0 ) { + System.out.println( xml_parser.getErrorMessages().toString() ); + return false; + } + if ( phylogenies_xml.length != 1 ) { + return false; + } + + final Phylogeny[] phylogenies_xml2 = ParserBasedPhylogenyFactory.getInstance().create( new StringBuffer( phylogenies_xml[0].toPhyloXML( 0 )), + xml_parser ); + + final Phylogeny[] phylogenies_nh = ParserBasedPhylogenyFactory.getInstance().create( new File( Test.PATH_TO_TEST_DATA + "chars.nh" ), new NHXParser() ); + if ( phylogenies_nh.length != 1 ) { + return false; + } + + final Phylogeny[] phylogenies_nex = ParserBasedPhylogenyFactory.getInstance().create( new File( Test.PATH_TO_TEST_DATA + "chars.nex" ), new NexusPhylogeniesParser() ); + if ( phylogenies_nex.length != 1 ) { + return false; + } + + final String[] xml_n = phylogenies_xml[0].getAllExternalNodeNames(); + final String[] xml_n2 = phylogenies_xml2[0].getAllExternalNodeNames(); + final String[] nh_n = phylogenies_nh[0].getAllExternalNodeNames(); + final String[] nex_n = phylogenies_nex[0].getAllExternalNodeNames(); + final String n0 = "AQ~!@#$%^&*()_+-=\\{}|;:\"<>?,./"; + final String n1 = "€‚ƒ„…†‡ˆ‰Š‹ŒŽ‘’“”•–—˜˜˜™š›œžŸ¡¢£¤¥¦§¨©ª«¬®¯°±¹²³´µ¶·¸º»¼¿À÷þÿ"; + final String n2 = "漢字ひらがなカタカナ"; + final String n3 = "อักษรไทย"; + final String n4 = "繁體字"; + final String n5 = "한글"; + final String n6 = "देवनागरी"; + + final String n7 = "chữ Quốc ngữ"; + final String n8 = "ру́сский язы́к"; + final String n9 = "អក្សរខ្មែរ"; + + if ( !xml_n[0].equals( n0 ) ) { + System.out.println( xml_n[0] ); + System.out.println( n0 ); + return false; + } + if ( !xml_n2[0].equals( n0 ) ) { + System.out.println( xml_n2[0] ); + System.out.println( n0 ); + return false; + } + if ( !nh_n[0].equals( n0 ) ) { + System.out.println( nh_n[0] ); + System.out.println( n0 ); + return false; + } + if ( !nex_n[0].equals( n0 ) ) { + System.out.println( nex_n[0] ); + System.out.println( n0 ); + return false; + } + + if ( !xml_n[1].equals( n1 ) ) { + System.out.println( xml_n[1] ); + System.out.println( n1 ); + return false; + } + if ( !xml_n2[1].equals( n1 ) ) { + System.out.println( xml_n2[1] ); + System.out.println( n1 ); + return false; + } + if ( !nh_n[1].equals( n1 ) ) { + System.out.println( nh_n[1] ); + System.out.println( n1 ); + return false; + } + if ( !nex_n[1].equals( n1 ) ) { + System.out.println( nex_n[1] ); + System.out.println( n1 ); + return false; + } + + if ( !xml_n[2].equals( n2 ) ) { + System.out.println( xml_n[2] ); + System.out.println( n2 ); + return false; + } + if ( !xml_n2[2].equals( n2 ) ) { + System.out.println( xml_n2[2] ); + System.out.println( n2 ); + return false; + } + if ( !nh_n[2].equals( n2 ) ) { + System.out.println( nh_n[2] ); + System.out.println( n2 ); + return false; + } + if ( !nex_n[2].equals( n2 ) ) { + System.out.println( nex_n[2] ); + System.out.println( n2 ); + return false; + } + // + if ( !xml_n[3].equals( n3 ) ) { + System.out.println( xml_n[3] ); + System.out.println( n3 ); + return false; + } + if ( !xml_n2[3].equals( n3 ) ) { + System.out.println( xml_n2[3] ); + System.out.println( n3 ); + return false; + } + if ( !nh_n[3].equals( n3 ) ) { + System.out.println( nh_n[3] ); + System.out.println( n3 ); + return false; + } + if ( !nex_n[3].equals( n3 ) ) { + System.out.println( nex_n[3] ); + System.out.println( n3 ); + return false; + } + // + if ( !xml_n[4].equals( n4 ) ) { + System.out.println( xml_n[4] ); + System.out.println( n4 ); + return false; + } + if ( !nh_n[4].equals( n4 ) ) { + System.out.println( nh_n[4] ); + System.out.println( n4 ); + return false; + } + if ( !nex_n[4].equals( n4 ) ) { + System.out.println( nex_n[4] ); + System.out.println( n4 ); + return false; + } + // + if ( !xml_n[5].equals( n5 ) ) { + System.out.println( xml_n[5] ); + System.out.println( n5 ); + return false; + } + if ( !nh_n[5].equals( n5 ) ) { + System.out.println( nh_n[5] ); + System.out.println( n5 ); + return false; + } + if ( !nex_n[5].equals( n5 ) ) { + System.out.println( nex_n[5] ); + System.out.println( n5 ); + return false; + } + // + if ( !xml_n[6].equals( n6 ) ) { + System.out.println( xml_n[6] ); + System.out.println( n6 ); + return false; + } + if ( !nh_n[6].equals( n6 ) ) { + System.out.println( nh_n[6] ); + System.out.println( n6 ); + return false; + } + if ( !nex_n[6].equals( n6 ) ) { + System.out.println( nex_n[6] ); + System.out.println( n6 ); + return false; + } + // + if ( !xml_n[7].equals( n7 ) ) { + System.out.println( xml_n[7] ); + System.out.println( n7 ); + return false; + } + if ( !nh_n[7].equals( n7 ) ) { + System.out.println( nh_n[7] ); + System.out.println( n7 ); + return false; + } + if ( !nex_n[7].equals( n7 ) ) { + System.out.println( nex_n[7] ); + System.out.println( n7 ); + return false; + } + if ( !xml_n[8].equals( n8 ) ) { + System.out.println( xml_n[8] ); + System.out.println( n8 ); + return false; + } + if ( !nh_n[8].equals( n8 ) ) { + System.out.println( nh_n[8] ); + System.out.println( n8 ); + return false; + } + if ( !nex_n[8].equals( n8 ) ) { + System.out.println( nex_n[8] ); + System.out.println( n8 ); + return false; + } + if ( !xml_n[9].equals( n9 ) ) { + System.out.println( xml_n[9] ); + System.out.println( n9 ); + return false; + } + if ( !xml_n2[9].equals( n9 ) ) { + System.out.println( xml_n2[9] ); + System.out.println( n9 ); + return false; + } + if ( !nh_n[9].equals( n9 ) ) { + System.out.println( nh_n[9] ); + System.out.println( n9 ); + return false; + } + if ( !nex_n[9].equals( n9 ) ) { + System.out.println( nex_n[9] ); + System.out.println( n9 ); + return false; + } + if (!phylogenies_xml[0].toNewHampshire().equals( + phylogenies_nh[0].toNewHampshire() ) ) { + System.out.println( phylogenies_xml[0].toNewHampshire() ); + System.out.println( phylogenies_nh[0].toNewHampshire() ); + return false; + } + if (!phylogenies_xml[0].toNewHampshire().equals( + phylogenies_nex[0].toNewHampshire() ) ) { + System.out.println( phylogenies_xml[0].toNewHampshire() ); + System.out.println( phylogenies_nex[0].toNewHampshire() ); + return false; + } + } + catch ( final Exception e ) { + e.printStackTrace( System.out ); + return false; + } + return true; + } + + private static boolean testBasicPhyloXMLparsing() { try { final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance(); final PhyloXmlParser xml_parser = PhyloXmlParser.createPhyloXmlParser(); - final Phylogeny[] phylogenies_0 = factory.create( Test.PATH_TO_TEST_DATA + "phyloxml_test_t1.xml", + final Phylogeny[] phylogenies_0 = factory.create( new File( Test.PATH_TO_TEST_DATA + "phyloxml_test_t1.xml" ), xml_parser ); if ( xml_parser.getErrorCount() > 0 ) { System.out.println( xml_parser.getErrorMessages().toString() ); @@ -1776,6 +2152,21 @@ public final class Test { if ( !t3.getIdentifier().getProvider().equals( "treebank" ) ) { return false; } + if ( !t3.getNode( "root node" ).isDuplication() ) { + return false; + } + if ( !t3.getNode( "node a" ).isDuplication() ) { + return false; + } + if ( t3.getNode( "node a" ).isSpeciation() ) { + return false; + } + if ( t3.getNode( "node bc" ).isDuplication() ) { + return false; + } + if ( !t3.getNode( "node bc" ).isSpeciation() ) { + return false; + } if ( !t3.getNode( "root node" ).getNodeData().getSequence().getType().equals( "protein" ) ) { return false; } @@ -1900,7 +2291,7 @@ public final class Test { else { xml_parser.setValidateAgainstSchema( PHYLOXML_REMOTE_XSD ); } - final Phylogeny[] phylogenies_0 = factory.create( Test.PATH_TO_TEST_DATA + "phyloxml_test_t1.xml", + final Phylogeny[] phylogenies_0 = factory.create( new File( Test.PATH_TO_TEST_DATA + "phyloxml_test_t1.xml" ), xml_parser ); if ( xml_parser.getErrorCount() > 0 ) { System.out.println( xml_parser.getErrorMessages().toString() ); @@ -2066,6 +2457,7 @@ public final class Test { } if ( !( t3_rt.getNode( "root node" ).getNodeData().getReference().getDescription() .equals( "Aguinaldo, A. M. A.; J. M. Turbeville, L. S. Linford, M. C. Rivera, J. R. Garey, R. A. Raff, & J. A. Lake (1997). \"Evidence for a clade of nematodes, arthropods and other moulting animals\". Nature 387 (6632): 489–493." ) ) ) { + System.out.println( t3_rt.getNode( "root node" ).getNodeData().getReference().getDescription() ); return false; } if ( !t3_rt.getNode( "root node" ).getNodeData().getTaxonomy().getTaxonomyCode().equals( "ECDYS" ) ) { @@ -2103,7 +2495,7 @@ public final class Test { return false; } if ( t3_rt.getNode( "node bc" ).getNodeData().getSequence().getDomainArchitecture().getDomain( 0 ) - .getConfidence() != 2144 ) { + .getConfidence() != 0 ) { return false; } if ( !t3_rt.getNode( "node bc" ).getNodeData().getSequence().getDomainArchitecture().getDomain( 0 ).getId() @@ -2252,7 +2644,7 @@ public final class Test { xml_parser.setValidateAgainstSchema( PHYLOXML_REMOTE_XSD ); } } - final Phylogeny[] phylogenies_0 = factory.create( Test.PATH_TO_TEST_DATA + "phyloxml_test_t1.xml", + final Phylogeny[] phylogenies_0 = factory.create( new File( Test.PATH_TO_TEST_DATA + "phyloxml_test_t1.xml" ), xml_parser ); if ( xml_parser.getErrorCount() > 0 ) { System.out.println( xml_parser.getErrorMessages().toString() ); @@ -2287,7 +2679,7 @@ public final class Test { return false; } final String x2 = Test.PATH_TO_TEST_DATA + "phyloxml_test_t1.xml"; - final Phylogeny[] phylogenies_1 = factory.create( x2, xml_parser ); + final Phylogeny[] phylogenies_1 = factory.create( new File( x2 ), xml_parser ); if ( xml_parser.getErrorCount() > 0 ) { System.out.println( "errors:" ); System.out.println( xml_parser.getErrorMessages().toString() ); @@ -2296,7 +2688,7 @@ public final class Test { if ( phylogenies_1.length != 4 ) { return false; } - final Phylogeny[] phylogenies_2 = factory.create( Test.PATH_TO_TEST_DATA + "phyloxml_test_t3.xml", + final Phylogeny[] phylogenies_2 = factory.create( new File(Test.PATH_TO_TEST_DATA + "phyloxml_test_t3.xml" ), xml_parser ); if ( xml_parser.getErrorCount() > 0 ) { System.out.println( "errors:" ); @@ -2309,7 +2701,7 @@ public final class Test { if ( phylogenies_2[ 0 ].getNumberOfExternalNodes() != 2 ) { return false; } - final Phylogeny[] phylogenies_3 = factory.create( Test.PATH_TO_TEST_DATA + "phyloxml_test_t4.xml", + final Phylogeny[] phylogenies_3 = factory.create( new File( Test.PATH_TO_TEST_DATA + "phyloxml_test_t4.xml" ), xml_parser ); if ( xml_parser.getErrorCount() > 0 ) { System.out.println( xml_parser.getErrorMessages().toString() ); @@ -2331,7 +2723,7 @@ public final class Test { if ( !a.getNode( "node b1" ).getNodeData().getTaxonomy().getCommonName().equals( "b1 species" ) ) { return false; } - final Phylogeny[] phylogenies_4 = factory.create( Test.PATH_TO_TEST_DATA + "special_characters.xml", + final Phylogeny[] phylogenies_4 = factory.create( new File( Test.PATH_TO_TEST_DATA + "special_characters.xml") , xml_parser ); if ( xml_parser.getErrorCount() > 0 ) { System.out.println( xml_parser.getErrorMessages().toString() ); @@ -2357,6 +2749,42 @@ public final class Test { } return true; } + + private static boolean testPhyloXMLparsingValidating() { + try { + final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance(); + PhyloXmlParser xml_parser = null; + try { + xml_parser = PhyloXmlParser.createPhyloXmlParserXsdValidating(); + } + catch ( final Exception e ) { + // Do nothing -- means were not running from jar. + } + if ( xml_parser == null ) { + xml_parser = PhyloXmlParser.createPhyloXmlParser(); + if ( USE_LOCAL_PHYLOXML_SCHEMA ) { + xml_parser.setValidateAgainstSchema( PHYLOXML_LOCAL_XSD ); + } + else { + xml_parser.setValidateAgainstSchema( PHYLOXML_REMOTE_XSD ); + } + } + final Phylogeny[] phylogenies_0 = factory.create( new File( Test.PATH_TO_TEST_DATA + "phyloxml_test_1.xml" ), + xml_parser ); + if ( xml_parser.getErrorCount() > 0 ) { + System.out.println( xml_parser.getErrorMessages().toString() ); + return false; + } + if ( phylogenies_0.length != 3 ) { + return false; + } + } + catch ( final Exception e ) { + e.printStackTrace( System.out ); + return false; + } + return true; + } private static boolean testBasicProtein() { try { @@ -2924,7 +3352,7 @@ public final class Test { if ( t2.getNumberOfExternalNodes() != 4 ) { return false; } - if ( t2.getHeight() != 8.5 ) { + if ( t2.calculateHeight(false) != 8.5 ) { return false; } if ( !t2.isCompletelyBinary() ) { @@ -2937,7 +3365,7 @@ public final class Test { if ( t3.getNumberOfExternalNodes() != 5 ) { return false; } - if ( t3.getHeight() != 11 ) { + if ( t3.calculateHeight(true) != 11 ) { return false; } if ( t3.isCompletelyBinary() ) { @@ -2948,46 +3376,46 @@ public final class Test { if ( t4.getNumberOfExternalNodes() != 9 ) { return false; } - if ( t4.getHeight() != 11 ) { + if ( t4.calculateHeight(false) != 11 ) { return false; } if ( t4.isCompletelyBinary() ) { return false; } final StringBuffer sb5 = new StringBuffer( "(((A11:2)A1:2,(A21:1,A22:2,A23)A2:11,A3:2)A:2,B:10,C:3,D:8)" ); - final Phylogeny t5 = factory.create( sb5, new NHXParser() )[ 0 ]; + final Phylogeny t5 = factory.create( sb5.toString(), new NHXParser() )[ 0 ]; if ( t5.getNumberOfExternalNodes() != 8 ) { return false; } - if ( t5.getHeight() != 15 ) { + if ( t5.calculateHeight(false) != 15 ) { return false; } final StringBuffer sb6 = new StringBuffer( "(X,Y,Z,(((A111)A11:2)A1:2,(X,Y,Z,A21:1,A22:2,A23)A2:11,A3:2)A:2,B:10,C:3,D:8)" ); - final Phylogeny t6 = factory.create( sb6, new NHXParser() )[ 0 ]; - if ( t6.getHeight() != 15 ) { + final Phylogeny t6 = factory.create( sb6.toString(), new NHXParser() )[ 0 ]; + if ( t6.calculateHeight(true) != 15 ) { return false; } final StringBuffer sb7 = new StringBuffer( "(((A11:2)A1:2,(A21:1,A22:2,A23)A2:11,A3:2)A:2,B:10,C:15,D:8)" ); - final Phylogeny t7 = factory.create( sb7, new NHXParser() )[ 0 ]; - if ( t7.getHeight() != 15 ) { + final Phylogeny t7 = factory.create( sb7.toString(), new NHXParser() )[ 0 ]; + if ( t7.calculateHeight(true) != 15 ) { return false; } final StringBuffer sb8 = new StringBuffer( "(((A11:11)A1:2,(A21:2,A22:2,A23,A24,AA:)A2:11,A3:2)A:2,B:15,C:15,D:15)" ); - final Phylogeny t8 = factory.create( sb8, new NHXParser() )[ 0 ]; + final Phylogeny t8 = factory.create( sb8.toString(), new NHXParser() )[ 0 ]; if ( t8.getNumberOfExternalNodes() != 10 ) { return false; } - if ( t8.getHeight() != 15 ) { + if ( t8.calculateHeight(true) != 15 ) { return false; } final char[] a9 = new char[] { 'a' }; final Phylogeny t9 = factory.create( a9, new NHXParser() )[ 0 ]; - if ( t9.getHeight() != 0 ) { + if ( t9.calculateHeight(true) != 0 ) { return false; } final char[] a10 = new char[] { 'a', ':', '6' }; final Phylogeny t10 = factory.create( a10, new NHXParser() )[ 0 ]; - if ( t10.getHeight() != 6 ) { + if ( t10.calculateHeight(true) != 6 ) { return false; } } @@ -4016,7 +4444,7 @@ public final class Test { System.out.println( entry.getAnnotations().first().getRefSource() ); return false; } - if ( entry.getCrossReferences().size() != 5 ) { + if ( entry.getCrossReferences().size() < 1 ) { return false; } final SequenceDatabaseEntry entry1 = SequenceDbWsTools.obtainEntry( "ABJ16409" ); @@ -4039,7 +4467,7 @@ public final class Test { System.out.println( entry1.getGeneName() ); return false; } - if ( entry1.getCrossReferences().size() != 6 ) { + if ( entry1.getCrossReferences().size() < 1 ) { return false; } final SequenceDatabaseEntry entry2 = SequenceDbWsTools.obtainEntry( "NM_184234" ); @@ -4063,10 +4491,15 @@ public final class Test { System.out.println( entry2.getGeneName() ); return false; } - if ( entry2.getCrossReferences().size() != 3 ) { + if ( entry2.getCrossReferences().size() < 1 ) { + return false; + } + if ( !entry2.getChromosome().equals( "20" ) ) { + return false; + } + if ( !entry2.getMap().equals( "20q11.22" ) ) { return false; } - // final SequenceDatabaseEntry entry3 = SequenceDbWsTools.obtainEntry( "HM043801" ); if ( !entry3.getAccession().equals( "HM043801" ) ) { return false; @@ -4090,7 +4523,7 @@ public final class Test { if ( !ForesterUtil.isEmpty( entry3.getGeneName() ) ) { return false; } - if ( entry3.getCrossReferences().size() < 7 ) { + if ( entry3.getCrossReferences().size() < 1 ) { return false; } final SequenceDatabaseEntry entry4 = SequenceDbWsTools.obtainEntry( "AAA36557.1" ); @@ -4113,21 +4546,6 @@ public final class Test { System.out.println( entry4.getGeneName() ); return false; } - // if ( !entry4.getChromosome().equals( "ras" ) ) { - // System.out.println( entry4.getChromosome() ); - // return false; - // } - // if ( !entry4.getMap().equals( "ras" ) ) { - // System.out.println( entry4.getMap() ); - // return false; - // } - //TODO FIXME gi... - // - //TODO fails: - // final SequenceDatabaseEntry entry5 = SequenceDbWsTools.obtainEntry( "M30539" ); - // if ( !entry5.getAccession().equals( "HM043801" ) ) { - // return false; - // } final SequenceDatabaseEntry entry5 = SequenceDbWsTools.obtainEntry( "AAZ45343.1" ); if ( !entry5.getAccession().equals( "AAZ45343" ) ) { return false; @@ -4144,6 +4562,25 @@ public final class Test { System.out.println( entry5.getTaxonomyIdentifier() ); return false; } + final SequenceDatabaseEntry entry6 = SequenceDbWsTools.obtainEntry( "M30539" ); + if ( !entry6.getAccession().equals( "M30539" ) ) { + return false; + } + if ( !entry6.getGeneName().equals( "ras" ) ) { + return false; + } + if ( !entry6.getSequenceName().equals( "Human SK2 c-Ha-ras-1 oncogene-encoded protein gene, exon 1" ) ) { + return false; + } + if ( !entry6.getTaxonomyIdentifier().equals( "9606" ) ) { + return false; + } + if ( !entry6.getTaxonomyScientificName().equals( "Homo sapiens" ) ) { + return false; + } + if ( entry6.getCrossReferences().size() < 1 ) { + return false; + } } catch ( final IOException e ) { System.out.println(); @@ -4870,12 +5307,22 @@ public final class Test { private static boolean testFastaParser() { try { - if ( !FastaParser.isLikelyFasta( new FileInputStream( PATH_TO_TEST_DATA + "fasta_0.fasta" ) ) ) { + FileInputStream fis1 = new FileInputStream( PATH_TO_TEST_DATA + "fasta_0.fasta" ); + if ( !FastaParser.isLikelyFasta( fis1 ) ) { + fis1.close(); return false; } - if ( FastaParser.isLikelyFasta( new FileInputStream( PATH_TO_TEST_DATA + "msa_3.txt" ) ) ) { + else { + fis1.close(); + } + FileInputStream fis2 = new FileInputStream( PATH_TO_TEST_DATA + "msa_3.txt" ); + if ( FastaParser.isLikelyFasta( fis2 ) ) { + fis2.close(); return false; } + else { + fis2.close(); + } final Msa msa_0 = FastaParser.parseMsa( new FileInputStream( PATH_TO_TEST_DATA + "fasta_0.fasta" ) ); if ( !msa_0.getSequenceAsString( 0 ).toString().equalsIgnoreCase( "ACGTGKXFMFDMXEXXXSFMFMF" ) ) { return false; @@ -6225,21 +6672,23 @@ public final class Test { l.add( s2 ); l.add( s3 ); final Msa msa = BasicMsa.createInstance( l ); - System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa, 0 ) ); - System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa, 1 ) ); - System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa, 2 ) ); - System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa, 3 ) ); - System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa, 4 ) ); - System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa, 5 ) ); - System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa, 6 ) ); - System.out.println(); - System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 6, msa, 0 ) ); - System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 6, msa, 1 ) ); - System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 6, msa, 2 ) ); - System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 6, msa, 3 ) ); - System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 6, msa, 4 ) ); - System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 6, msa, 5 ) ); - System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 6, msa, 6 ) ); + //TODO need to DO the tests!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! + //FIXME + // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa, 0 ) ); + // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa, 1 ) ); + // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa, 2 ) ); + // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa, 3 ) ); + // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa, 4 ) ); + // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa, 5 ) ); + // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa, 6 ) ); + // System.out.println(); + // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 6, msa, 0 ) ); + // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 6, msa, 1 ) ); + // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 6, msa, 2 ) ); + // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 6, msa, 3 ) ); + // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 6, msa, 4 ) ); + // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 6, msa, 5 ) ); + // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 6, msa, 6 ) ); final List l2 = new ArrayList(); l2.add( BasicSequence.createAaSequence( "1", "AAAAAAA" ) ); l2.add( BasicSequence.createAaSequence( "2", "AAAIACC" ) ); @@ -6264,10 +6713,10 @@ public final class Test { l2.add( BasicSequence.createAaSequence( "21", "AAIIIIF" ) ); l2.add( BasicSequence.createAaSequence( "22", "AIIIVVW" ) ); final Msa msa2 = BasicMsa.createInstance( l2 ); - System.out.println(); - System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa2, 0 ) ); - System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa2, 1 ) ); - System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa2, 2 ) ); + // System.out.println(); + // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa2, 0 ) ); + // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa2, 1 ) ); + // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa2, 2 ) ); } catch ( final Exception e ) { e.printStackTrace( System.out ); @@ -6440,7 +6889,7 @@ public final class Test { PhylogenyNode n; List ext = new ArrayList(); final StringBuffer sb0 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h))fgh)cdefgh)abcdefgh" ); - final Phylogeny t0 = factory.create( sb0, new NHXParser() )[ 0 ]; + final Phylogeny t0 = factory.create( sb0.toString(), new NHXParser() )[ 0 ]; t0.getNode( "cd" ).setCollapse( true ); t0.getNode( "cde" ).setCollapse( true ); n = t0.getFirstExternalNode(); @@ -6468,7 +6917,7 @@ public final class Test { } ext.clear(); final StringBuffer sb1 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h))fgh)cdefgh)abcdefgh" ); - final Phylogeny t1 = factory.create( sb1, new NHXParser() )[ 0 ]; + final Phylogeny t1 = factory.create( sb1.toString(), new NHXParser() )[ 0 ]; t1.getNode( "ab" ).setCollapse( true ); t1.getNode( "cd" ).setCollapse( true ); t1.getNode( "cde" ).setCollapse( true ); @@ -6495,7 +6944,7 @@ public final class Test { } ext.clear(); final StringBuffer sb2 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h)gh)fgh)cdefgh)abcdefgh" ); - final Phylogeny t2 = factory.create( sb2, new NHXParser() )[ 0 ]; + final Phylogeny t2 = factory.create( sb2.toString(), new NHXParser() )[ 0 ]; t2.getNode( "ab" ).setCollapse( true ); t2.getNode( "cd" ).setCollapse( true ); t2.getNode( "cde" ).setCollapse( true ); @@ -6523,7 +6972,7 @@ public final class Test { } ext.clear(); final StringBuffer sb3 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h)gh)fgh)cdefgh)abcdefgh" ); - final Phylogeny t3 = factory.create( sb3, new NHXParser() )[ 0 ]; + final Phylogeny t3 = factory.create( sb3.toString(), new NHXParser() )[ 0 ]; t3.getNode( "ab" ).setCollapse( true ); t3.getNode( "cd" ).setCollapse( true ); t3.getNode( "cde" ).setCollapse( true ); @@ -6549,7 +6998,7 @@ public final class Test { } ext.clear(); final StringBuffer sb4 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h)gh)fgh)cdefgh)abcdefgh" ); - final Phylogeny t4 = factory.create( sb4, new NHXParser() )[ 0 ]; + final Phylogeny t4 = factory.create( sb4.toString(), new NHXParser() )[ 0 ]; t4.getNode( "ab" ).setCollapse( true ); t4.getNode( "cd" ).setCollapse( true ); t4.getNode( "cde" ).setCollapse( true ); @@ -6564,7 +7013,7 @@ public final class Test { return false; } final StringBuffer sb5 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h))fgh)cdefgh)abcdefgh" ); - final Phylogeny t5 = factory.create( sb5, new NHXParser() )[ 0 ]; + final Phylogeny t5 = factory.create( sb5.toString(), new NHXParser() )[ 0 ]; ext.clear(); n = t5.getFirstExternalNode(); while ( n != null ) { @@ -6599,7 +7048,7 @@ public final class Test { return false; } final StringBuffer sb6 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h))fgh)cdefgh)abcdefgh" ); - final Phylogeny t6 = factory.create( sb6, new NHXParser() )[ 0 ]; + final Phylogeny t6 = factory.create( sb6.toString(), new NHXParser() )[ 0 ]; ext.clear(); t6.getNode( "ab" ).setCollapse( true ); n = t6.getNode( "ab" ); @@ -6632,7 +7081,7 @@ public final class Test { return false; } final StringBuffer sb7 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h))fgh)cdefgh)abcdefgh" ); - final Phylogeny t7 = factory.create( sb7, new NHXParser() )[ 0 ]; + final Phylogeny t7 = factory.create( sb7.toString(), new NHXParser() )[ 0 ]; ext.clear(); t7.getNode( "cd" ).setCollapse( true ); n = t7.getNode( "a" ); @@ -6665,7 +7114,7 @@ public final class Test { return false; } final StringBuffer sb8 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h))fgh)cdefgh)abcdefgh" ); - final Phylogeny t8 = factory.create( sb8, new NHXParser() )[ 0 ]; + final Phylogeny t8 = factory.create( sb8.toString(), new NHXParser() )[ 0 ]; ext.clear(); t8.getNode( "cd" ).setCollapse( true ); t8.getNode( "c" ).setCollapse( true ); @@ -6701,7 +7150,7 @@ public final class Test { return false; } final StringBuffer sb9 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h)gh)fgh)cdefgh)abcdefgh" ); - final Phylogeny t9 = factory.create( sb9, new NHXParser() )[ 0 ]; + final Phylogeny t9 = factory.create( sb9.toString(), new NHXParser() )[ 0 ]; ext.clear(); t9.getNode( "gh" ).setCollapse( true ); n = t9.getNode( "a" ); @@ -6734,7 +7183,7 @@ public final class Test { return false; } final StringBuffer sb10 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h)gh)fgh)cdefgh)abcdefgh" ); - final Phylogeny t10 = factory.create( sb10, new NHXParser() )[ 0 ]; + final Phylogeny t10 = factory.create( sb10.toString(), new NHXParser() )[ 0 ]; ext.clear(); t10.getNode( "gh" ).setCollapse( true ); t10.getNode( "g" ).setCollapse( true ); @@ -6769,7 +7218,7 @@ public final class Test { return false; } final StringBuffer sb11 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h)gh)fgh)cdefgh)abcdefgh" ); - final Phylogeny t11 = factory.create( sb11, new NHXParser() )[ 0 ]; + final Phylogeny t11 = factory.create( sb11.toString(), new NHXParser() )[ 0 ]; ext.clear(); t11.getNode( "gh" ).setCollapse( true ); t11.getNode( "fgh" ).setCollapse( true ); @@ -6800,7 +7249,7 @@ public final class Test { return false; } final StringBuffer sb12 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h)gh)fgh)cdefgh)abcdefgh" ); - final Phylogeny t12 = factory.create( sb12, new NHXParser() )[ 0 ]; + final Phylogeny t12 = factory.create( sb12.toString(), new NHXParser() )[ 0 ]; ext.clear(); t12.getNode( "gh" ).setCollapse( true ); t12.getNode( "fgh" ).setCollapse( true ); @@ -6834,7 +7283,7 @@ public final class Test { return false; } final StringBuffer sb13 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h)gh)fgh)cdefgh)abcdefgh" ); - final Phylogeny t13 = factory.create( sb13, new NHXParser() )[ 0 ]; + final Phylogeny t13 = factory.create( sb13.toString(), new NHXParser() )[ 0 ]; ext.clear(); t13.getNode( "ab" ).setCollapse( true ); t13.getNode( "b" ).setCollapse( true ); @@ -6864,7 +7313,7 @@ public final class Test { return false; } final StringBuffer sb14 = new StringBuffer( "((a,b,0)ab,(((c,d)cd,e)cde,(f,(g,h,1,2)gh,0)fgh)cdefgh)abcdefgh" ); - final Phylogeny t14 = factory.create( sb14, new NHXParser() )[ 0 ]; + final Phylogeny t14 = factory.create( sb14.toString(), new NHXParser() )[ 0 ]; ext.clear(); t14.getNode( "ab" ).setCollapse( true ); t14.getNode( "a" ).setCollapse( true ); @@ -6894,7 +7343,7 @@ public final class Test { return false; } final StringBuffer sb15 = new StringBuffer( "((a,b,0)ab,(((c,d)cd,e)cde,x,(f,(g,h,1,2)gh,0)fgh)cdefgh)abcdefgh" ); - final Phylogeny t15 = factory.create( sb15, new NHXParser() )[ 0 ]; + final Phylogeny t15 = factory.create( sb15.toString(), new NHXParser() )[ 0 ]; ext.clear(); t15.getNode( "ab" ).setCollapse( true ); t15.getNode( "a" ).setCollapse( true ); @@ -6929,7 +7378,7 @@ public final class Test { // // final StringBuffer sb16 = new StringBuffer( "((a,b,0)ab,(((c,d)cd,e)cde,x,(f,(g,h,1,2)gh,0)fgh)cdefgh)abcdefgh" ); - final Phylogeny t16 = factory.create( sb16, new NHXParser() )[ 0 ]; + final Phylogeny t16 = factory.create( sb16.toString(), new NHXParser() )[ 0 ]; ext.clear(); t16.getNode( "ab" ).setCollapse( true ); t16.getNode( "a" ).setCollapse( true ); @@ -8149,10 +8598,10 @@ public final class Test { if ( !p1b.toNewHampshire().equals( "(';A;',';B;1;');" ) ) { return false; } - final Phylogeny p2 = factory.create( new StringBuffer( "(A,B2)" ), new NHXParser() )[ 0 ]; + final Phylogeny p2 = factory.create( new StringBuffer( "(A,B2)" ).toString(), new NHXParser() )[ 0 ]; final Phylogeny p3 = factory.create( new char[] { '(', 'A', ',', 'B', '3', ')' }, new NHXParser() )[ 0 ]; final Phylogeny p4 = factory.create( "(A,B4);", new NHXParser() )[ 0 ]; - final Phylogeny p5 = factory.create( new StringBuffer( "(A,B5);" ), new NHXParser() )[ 0 ]; + final Phylogeny p5 = factory.create( new StringBuffer( "(A,B5);" ).toString(), new NHXParser() )[ 0 ]; final Phylogeny[] p7 = factory.create( "(A,B7);(C,D7)", new NHXParser() ); final Phylogeny[] p8 = factory.create( "(A,B8) (C,D8)", new NHXParser() ); final Phylogeny[] p9 = factory.create( "(A,B9)\n(C,D9)", new NHXParser() ); @@ -8410,21 +8859,21 @@ public final class Test { if ( p46.length != 0 ) { return false; } - final Phylogeny p47 = factory.create( new StringBuffer( "((A,B)ab:2[0.44],C)" ), new NHXParser() )[ 0 ]; + final Phylogeny p47 = factory.create( new StringBuffer( "((A,B)ab:2[0.44],C)" ).toString(), new NHXParser() )[ 0 ]; if ( !isEqual( 0.44, p47.getNode( "ab" ).getBranchData().getConfidence( 0 ).getValue() ) ) { return false; } - final Phylogeny p48 = factory.create( new StringBuffer( "((A,B)ab:2[88],C)" ), new NHXParser() )[ 0 ]; + final Phylogeny p48 = factory.create( new StringBuffer( "((A,B)ab:2[88],C)" ).toString(), new NHXParser() )[ 0 ]; if ( !isEqual( 88, p48.getNode( "ab" ).getBranchData().getConfidence( 0 ).getValue() ) ) { return false; } final Phylogeny p49 = factory - .create( new StringBuffer( "((A,B)a[comment:a,b;(a)]b:2[0.44][comment(a,b,b);],C)" ), + .create( new StringBuffer( "((A,B)a[comment:a,b;(a)]b:2[0.44][comment(a,b,b);],C)" ).toString(), new NHXParser() )[ 0 ]; if ( !isEqual( 0.44, p49.getNode( "ab" ).getBranchData().getConfidence( 0 ).getValue() ) ) { return false; } - final Phylogeny p50 = factory.create( new StringBuffer( "((\"A\",B)ab:2[88],C)" ), new NHXParser() )[ 0 ]; + final Phylogeny p50 = factory.create( new StringBuffer( "((\"A\",B)ab:2[88],C)" ).toString(), new NHXParser() )[ 0 ]; if ( p50.getNode( "A" ) == null ) { return false; } @@ -8439,21 +8888,21 @@ public final class Test { .equals( "((A,B)88:2.0,C);" ) ) { return false; } - final Phylogeny p51 = factory.create( new StringBuffer( "((\"A(A\",B)ab:2[88],C)" ), new NHXParser() )[ 0 ]; + final Phylogeny p51 = factory.create( new StringBuffer( "((\"A(A\",B)ab:2[88],C)" ).toString(), new NHXParser() )[ 0 ]; if ( p51.getNode( "A(A" ) == null ) { return false; } - final Phylogeny p52 = factory.create( new StringBuffer( "(('A(A',B)ab:2[88],C)" ), new NHXParser() )[ 0 ]; + final Phylogeny p52 = factory.create( new StringBuffer( "(('A(A',B)ab:2[88],C)" ).toString(), new NHXParser() )[ 0 ]; if ( p52.getNode( "A(A" ) == null ) { return false; } final Phylogeny p53 = factory - .create( new StringBuffer( "(('A(A',\"B (x (a' ,b) f(x);\"[com])[ment]ab:2[88],C)" ), + .create( new StringBuffer( "(('A(A',\"B (x (a' ,b) f(x);\"[com])[ment]ab:2[88],C)" ).toString(), new NHXParser() )[ 0 ]; if ( p53.getNode( "B (x (a' ,b) f(x);" ) == null ) { return false; } - final Phylogeny p54 = factory.create( new StringBuffer( "((A,B):[88],C)" ), new NHXParser() )[ 0 ]; + final Phylogeny p54 = factory.create( new StringBuffer( "((A,B):[88],C)" ).toString(), new NHXParser() )[ 0 ]; if ( p54.getNode( "A" ) == null ) { return false; } @@ -8461,7 +8910,7 @@ public final class Test { return false; } final Phylogeny p55 = factory - .create( new StringBuffer( "((\"lcl|HPV32_L1.:1 s\":0.195593,\"lcl|HPV30_L1.1|;a\":0.114237):0.0359322,\"lcl|HPV56_L1.1|,d\":0.0727412,\"lcl|HPV66_L1.1x\":0.0798012);" ), + .create( new StringBuffer( "((\"lcl|HPV32_L1.:1 s\":0.195593,\"lcl|HPV30_L1.1|;a\":0.114237):0.0359322,\"lcl|HPV56_L1.1|,d\":0.0727412,\"lcl|HPV66_L1.1x\":0.0798012);" ).toString(), new NHXParser() )[ 0 ]; if ( !p55 .toNewHampshire() @@ -8470,7 +8919,7 @@ public final class Test { return false; } final Phylogeny p56 = factory - .create( new StringBuffer( "((\"lcl|HPV32_L1.:1 s\":0.195593,\"lcl|HPV30_L1.1|;a\":0.114\n237):0.0359322,\"lcl|HPV56_L1.1|,d\":0.0727412,\"lcl|HPV66_L1.1:x\":0.0798012);" ), + .create( new StringBuffer( "((\"lcl|HPV32_L1.:1 s\":0.195593,\"lcl|HPV30_L1.1|;a\":0.114\n237):0.0359322,\"lcl|HPV56_L1.1|,d\":0.0727412,\"lcl|HPV66_L1.1:x\":0.0798012);" ).toString(), new NHXParser() )[ 0 ]; if ( !p56 .toNewHampshire() @@ -8479,7 +8928,7 @@ public final class Test { return false; } final Phylogeny p57 = factory - .create( new StringBuffer( "((\"lcl|HPV32_L1.:1 s\":0.195593,\"lcl|HPV30_L1.1|;a\":0.114\n237):0.0359322,\"lcl|HPV56_L1.1|,d\":0.0727412,\"lcl|HPV66_L1.1:x\":0.0798012);" ), + .create( new StringBuffer( "((\"lcl|HPV32_L1.:1 s\":0.195593,\"lcl|HPV30_L1.1|;a\":0.114\n237):0.0359322,\"lcl|HPV56_L1.1|,d\":0.0727412,\"lcl|HPV66_L1.1:x\":0.0798012);" ).toString(), new NHXParser() )[ 0 ]; if ( !p57 .toNewHampshire() @@ -8488,30 +8937,58 @@ public final class Test { return false; } final String s58 = "('Homo \"man\" sapiens:1',\"Homo 'man' sapiens;\")';root \"1_ )';"; - final Phylogeny p58 = factory.create( new StringBuffer( s58 ), new NHXParser() )[ 0 ]; + final Phylogeny p58 = factory.create( s58, new NHXParser() )[ 0 ]; if ( !p58.toNewHampshire().equals( s58 ) ) { System.out.println( p58.toNewHampshire() ); return false; } final String s59 = "('Homo \"man sapiens:1',\"Homo 'man sapiens\")\"root; '1_ )\";"; - final Phylogeny p59 = factory.create( new StringBuffer( s59 ), new NHXParser() )[ 0 ]; + final Phylogeny p59 = factory.create( s59 , new NHXParser() )[ 0 ]; if ( !p59.toNewHampshire().equals( s59 ) ) { System.out.println( p59.toNewHampshire() ); return false; } final String s60 = "('\" ;,:\":\"',\"'abc def' g's_\",'=:0.45+,.:%~`!@#$%^&*()_-+={} | ;,');"; - final Phylogeny p60 = factory.create( new StringBuffer( s60 ), new NHXParser() )[ 0 ]; + final Phylogeny p60 = factory.create( s60, new NHXParser() )[ 0 ]; if ( !p60.toNewHampshire().equals( s60 ) ) { System.out.println( p60.toNewHampshire() ); return false; } final String s61 = "('H[omo] \"man\" sapiens:1',\"H[omo] 'man' sapiens;\",H[omo] sapiens)';root \"1_ )';"; - final Phylogeny p61 = factory.create( new StringBuffer( s61 ), new NHXParser() )[ 0 ]; + final Phylogeny p61 = factory.create( s61, new NHXParser() )[ 0 ]; if ( !p61.toNewHampshire() .equals( "('H{omo} \"man\" sapiens:1',\"H{omo} 'man' sapiens;\",Hsapiens)';root \"1_ )';" ) ) { System.out.println( p61.toNewHampshire() ); return false; } + final String s62 = "(1[&type=\"X\",size=123,subtree=(1,2);]:0.003,2[&type=\"(X,Y:3)\"]:0.004)[&type=\"(X,Y)\"]:0.0;"; + final Phylogeny p62 = factory.create( s62, new NHXParser() )[ 0 ]; + if ( !p62.toNewHampshire() + .equals( "(1:0.003,2:0.004):0.0;" ) ) { + System.out.println( p62.toNewHampshire() ); + return false; + } + final String s63 = "(1:0.003[&type=\"X\",size=123,subtree=(1,2);],2:0.004[&type=\"(X,Y:3)\"]):0.0[&type=\"(X,Y)\"];"; + final Phylogeny p63 = factory.create( s63, new NHXParser() )[ 0 ]; + if ( !p63.toNewHampshire() + .equals( "(1:0.003,2:0.004):0.0;" ) ) { + System.out.println( p63.toNewHampshire() ); + return false; + } + final String s64 = "((1,2):[95.5],3);"; + final Phylogeny p64 = factory.create( s64, new NHXParser() )[ 0 ]; + if ( !p64.toNewHampshireX() + .equals( "((1,2)[&&NHX:B=95.5],3)" ) ) { + System.out.println( p64.toNewHampshireX() ); + return false; + } + final String s65 = "((1:0.1,2:0.2):0.3[10.2],3);"; + final Phylogeny p65 = factory.create( s65, new NHXParser() )[ 0 ]; + if ( !p65.toNewHampshireX() + .equals( "((1:0.1,2:0.2):0.3[&&NHX:B=10.2],3)" ) ) { + System.out.println( p65.toNewHampshireX() ); + return false; + } } catch ( final Exception e ) { e.printStackTrace( System.out ); @@ -8519,7 +8996,36 @@ public final class Test { } return true; } - + + private static boolean testNHParsingSpecialChars() { + try { + final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance(); + final String i0 = "(A!+=~QWERTY!@#$%^&*-,€‚ƒ„…†‡ˆ‰Š‹ŒŽ‘’“”•–—˜˜˜™š›œžŸ¡¢£¤¥¦§¨©ª«¬®¯°±¹²³´µ¶·¸º»¼¿À÷þÿ)"; + final Phylogeny p0 = factory.create( i0, new NHXParser() )[ 0 ]; + if ( !p0.toNewHampshireX().equals( i0 ) ) { + System.out.println(); + System.out.println( p0.toNewHampshireX() ); + System.out.println( i0 ); + return false; + } + final String i1 = "(हिंदी,한글,ไทย,'Tiếng Việt',ひらがなカタカナ漢字,繁體字,русский)"; + final Phylogeny p1 = factory.create( i1, new NHXParser() )[ 0 ]; + if ( !p1.toNewHampshireX().equals( i1 ) ) { + System.out.println(); + System.out.println( p1.toNewHampshireX() ); + System.out.println( i1 ); + return false; + } + } + catch ( final Exception e ) { + e.printStackTrace( System.out ); + return false; + } + return true; + } + + + private static boolean testNHParsingIter() { try { final String p0_str = "(A,B);"; @@ -9381,6 +9887,151 @@ public final class Test { return true; } + + private static boolean testNHXNodeParsing2() { + try { + + final PhylogenyNode n0_0 = PhylogenyNode + .createInstanceFromNhxString( "n0:[ignore me 123]:1E-3", NHXParser.TAXONOMY_EXTRACTION.NO, true, true ); + if ( !n0_0.getName().equals( "n0" ) ) { + return false; + } + if ( !isEqual( n0_0.getDistanceToParent(), 0.001 ) ) { + return false; + } + final PhylogenyNode n0_1 = PhylogenyNode + .createInstanceFromNhxString( "n0[ignore me 123]:1E-3", NHXParser.TAXONOMY_EXTRACTION.NO, true, true ); + if ( !n0_1.getName().equals( "n0" ) ) { + return false; + } + if ( !isEqual( n0_1.getDistanceToParent(), 0.001 ) ) { + return false; + } + final PhylogenyNode n0_2 = PhylogenyNode + .createInstanceFromNhxString( "n0:1E-3[ignore me 123]", NHXParser.TAXONOMY_EXTRACTION.NO, true, true ); + if ( !n0_2.getName().equals( "n0" ) ) { + return false; + } + if ( !isEqual( n0_2.getDistanceToParent(), 0.001 ) ) { + return false; + } + final PhylogenyNode n0_3 = PhylogenyNode + .createInstanceFromNhxString( "n0:1E-3:[ignore me 123]", NHXParser.TAXONOMY_EXTRACTION.NO, true, true ); + if ( !n0_3.getName().equals( "n0" ) ) { + return false; + } + if ( !isEqual( n0_3.getDistanceToParent(), 0.001 ) ) { + return false; + } + final PhylogenyNode n0_4 = PhylogenyNode + .createInstanceFromNhxString( "n0:0.001:[ignore me 123]", NHXParser.TAXONOMY_EXTRACTION.NO, true, true ); + if ( !n0_4.getName().equals( "n0" ) ) { + return false; + } + if ( !isEqual( n0_4.getDistanceToParent(), 0.001 ) ) { + return false; + } + final PhylogenyNode n1_0 = PhylogenyNode + .createInstanceFromNhxString( "xyz|A/American_duck/NH/00321/|Duck|Canada[&!color=#FFFFFF]", NHXParser.TAXONOMY_EXTRACTION.NO, true, true ); + if ( !n1_0.getName().equals( "xyz|A/American duck/NH/00321/|Duck|Canada" ) ) { + return false; + } + if ( n1_0.getBranchData().getBranchColor().getValue().getGreen()!=255 ) { + return false; + } + final PhylogenyNode n1_1 = PhylogenyNode + .createInstanceFromNhxString( "xyz|A/American_duck/NH/00321/|Duck|Canada[&!color=#FFFFFF]:0.001", NHXParser.TAXONOMY_EXTRACTION.NO, true, true ); + if ( !n1_1.getName().equals( "xyz|A/American duck/NH/00321/|Duck|Canada" ) ) { + return false; + } + if ( n1_1.getBranchData().getBranchColor().getValue().getGreen()!=255 ) { + return false; + } + if ( !isEqual( n1_1.getDistanceToParent(), 0.001 ) ) { + return false; + } + final PhylogenyNode n1_2 = PhylogenyNode + .createInstanceFromNhxString( "xyz|A/American_duck/NH/00321/|Duck|Canada:0.001[&!color=#FFFFFF]", NHXParser.TAXONOMY_EXTRACTION.NO, true, true ); + if ( !n1_2.getName().equals( "xyz|A/American duck/NH/00321/|Duck|Canada" ) ) { + return false; + } + if ( n1_2.getBranchData().getBranchColor().getValue().getGreen()!=255 ) { + return false; + } + if ( !isEqual( n1_2.getDistanceToParent(), 0.001 ) ) { + return false; + } + final PhylogenyNode n1_3 = PhylogenyNode + .createInstanceFromNhxString( "xyz|A/American_duck/NH/00321/|Duck|Canada:1e-3[&boostrap=69,&!color=#FFFFFF]", NHXParser.TAXONOMY_EXTRACTION.NO, true, true ); + if ( !n1_3.getName().equals( "xyz|A/American duck/NH/00321/|Duck|Canada" ) ) { + return false; + } + if ( n1_3.getBranchData().getBranchColor().getValue().getGreen()!=255 ) { + return false; + } + if ( !isEqual( n1_3.getDistanceToParent(), 0.001 ) ) { + return false; + } + if ( !isEqual( n1_3.getBranchData().getConfidence( 0 ).getValue(), 69 ) ) { + return false; + } + if ( !n1_3.getBranchData().getConfidence( 0 ).getType().equals( "bootstrap" ) ) { + return false; + } + final PhylogenyNode n1_4 = PhylogenyNode + .createInstanceFromNhxString( "xyz|A/American_duck/NH/00321/|Duck|Canada[&bootstrap=69,&!colour=#FFFFFF]:1e-3", NHXParser.TAXONOMY_EXTRACTION.NO, true, true ); + if ( !n1_4.getName().equals( "xyz|A/American duck/NH/00321/|Duck|Canada" ) ) { + return false; + } + if ( n1_4.getBranchData().getBranchColor().getValue().getGreen()!=255 ) { + return false; + } + if ( !isEqual( n1_4.getDistanceToParent(), 0.001 ) ) { + return false; + } + if ( !isEqual( n1_4.getBranchData().getConfidence( 0 ).getValue(), 69 ) ) { + return false; + } + if ( !n1_4.getBranchData().getConfidence( 0 ).getType().equals( "bootstrap" ) ) { + return false; + } + final PhylogenyNode n1_5 = PhylogenyNode + .createInstanceFromNhxString( "xyz|A/American_duck/NH/00321/|Duck|Canada:1e-3[69.0]", NHXParser.TAXONOMY_EXTRACTION.NO, true, true ); + if ( !n1_5.getName().equals( "xyz|A/American duck/NH/00321/|Duck|Canada" ) ) { + return false; + } + if ( !isEqual( n1_5.getDistanceToParent(), 0.001 ) ) { + return false; + } + if ( !isEqual( n1_5.getBranchData().getConfidence( 0 ).getValue(), 69 ) ) { + return false; + } + final PhylogenyNode n1_6 = PhylogenyNode + .createInstanceFromNhxString( "xyz|A/American_duck/NH/00321/|Duck|Canada[&prob=0.9500000000000000e+00,prob_stddev=0.1100000000000000e+00]:1e-3", NHXParser.TAXONOMY_EXTRACTION.NO, true, true ); + if ( !n1_6.getName().equals( "xyz|A/American duck/NH/00321/|Duck|Canada" ) ) { + return false; + } + + if ( !isEqual( n1_6.getDistanceToParent(), 0.001 ) ) { + return false; + } + if ( !isEqual( n1_6.getBranchData().getConfidence( 0 ).getStandardDeviation(), 0.11 ) ) { + return false; + } + if ( !isEqual( n1_6.getBranchData().getConfidence( 0 ).getValue(), 0.95 ) ) { + return false; + } + if ( !n1_6.getBranchData().getConfidence( 0 ).getType().equals( "posterior probability" ) ) { + return false; + } + } + catch ( final Exception e ) { + e.printStackTrace( System.out ); + return false; + } + return true; + } + private static boolean testNHXParsing() { try { final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance(); @@ -9450,6 +10101,11 @@ public final class Test { if ( !p11.toNewHampshireX().equals( "(('A: \"':0.2,B:0.3):0.5[&&NHX:B=91],C:0.1)root:0.1[&&NHX:B=100]" ) ) { return false; } + final Phylogeny p12 = factory.create( "((A:0.2,B:0.3):0.5[&&NHX:B=91],C:0.1)root:0.1[&&NHX:B=100]", + new NHXParser() )[ 0 ]; + if ( !p12.toNewHampshireX().equals( "((A:0.2,B:0.3):0.5[&&NHX:B=91],C:0.1)root:0.1[&&NHX:B=100]" ) ) { + return false; + } } catch ( final Exception e ) { e.printStackTrace( System.out ); @@ -9698,7 +10354,7 @@ public final class Test { xml_parser.setValidateAgainstSchema( PHYLOXML_REMOTE_XSD ); } } - final Phylogeny[] phylogenies_0 = factory.create( Test.PATH_TO_TEST_DATA + "phyloxml_distribution.xml", + final Phylogeny[] phylogenies_0 = factory.create( new File( Test.PATH_TO_TEST_DATA + "phyloxml_distribution.xml" ), xml_parser ); if ( xml_parser.getErrorCount() > 0 ) { System.out.println( xml_parser.getErrorMessages().toString() ); @@ -12655,7 +13311,7 @@ public final class Test { private static boolean testUniprotEntryRetrieval() { try { - final SequenceDatabaseEntry entry = SequenceDbWsTools.obtainUniProtEntry( "P12345", 200 ); + final SequenceDatabaseEntry entry = SequenceDbWsTools.obtainUniProtEntry( "P12345", 5000 ); if ( !entry.getAccession().equals( "P12345" ) ) { return false; } @@ -12674,12 +13330,16 @@ public final class Test { if ( !entry.getTaxonomyIdentifier().equals( "9986" ) ) { return false; } + if ( entry.getMolecularSequence() == null ) { + return false; + } if ( !entry .getMolecularSequence() .getMolecularSequenceAsString() .startsWith( "MALLHSARVLSGVASAFHPGLAAAASARASSWWAHVEMGPPDPILGVTEAYKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKGLDKEYLPIGGLAEFCRASAELALGENSEV" ) || !entry.getMolecularSequence().getMolecularSequenceAsString().endsWith( "LAHAIHQVTK" ) ) { - System.out.println( entry.getMolecularSequence().getMolecularSequenceAsString() ); + System.out.println( "got: " + entry.getMolecularSequence().getMolecularSequenceAsString() ); + System.out.println( "expected something else." ); return false; } } @@ -12689,6 +13349,10 @@ public final class Test { e.printStackTrace( System.out ); return true; } + catch ( final NullPointerException f ) { + f.printStackTrace( System.out ); + return false; + } catch ( final Exception e ) { return false; } @@ -12878,60 +13542,6 @@ public final class Test { } return true; } - - private static boolean testWabiTxSearch() { - try { - String result = ""; - result = TxSearch.searchSimple( "nematostella" ); - result = TxSearch.getTxId( "nematostella" ); - if ( !result.equals( "45350" ) ) { - return false; - } - result = TxSearch.getTxName( "45350" ); - if ( !result.equals( "Nematostella" ) ) { - return false; - } - result = TxSearch.getTxId( "nematostella vectensis" ); - if ( !result.equals( "45351" ) ) { - return false; - } - result = TxSearch.getTxName( "45351" ); - if ( !result.equals( "Nematostella vectensis" ) ) { - return false; - } - result = TxSearch.getTxId( "Bacillus subtilis subsp. subtilis str. N170" ); - if ( !result.equals( "536089" ) ) { - return false; - } - result = TxSearch.getTxName( "536089" ); - if ( !result.equals( "Bacillus subtilis subsp. subtilis str. N170" ) ) { - return false; - } - final List queries = new ArrayList(); - queries.add( "Campylobacter coli" ); - queries.add( "Escherichia coli" ); - queries.add( "Arabidopsis" ); - queries.add( "Trichoplax" ); - queries.add( "Samanea saman" ); - queries.add( "Kluyveromyces marxianus" ); - queries.add( "Bacillus subtilis subsp. subtilis str. N170" ); - queries.add( "Bornavirus parrot/PDD/2008" ); - final List ranks = new ArrayList(); - ranks.add( RANKS.SUPERKINGDOM ); - ranks.add( RANKS.KINGDOM ); - ranks.add( RANKS.FAMILY ); - ranks.add( RANKS.GENUS ); - ranks.add( RANKS.TRIBE ); - result = TxSearch.searchLineage( queries, ranks ); - result = TxSearch.searchParam( "Homo sapiens", TAX_NAME_CLASS.ALL, TAX_RANK.SPECIES, 10, true ); - result = TxSearch.searchParam( "Samanea saman", TAX_NAME_CLASS.SCIENTIFIC_NAME, TAX_RANK.ALL, 10, true ); - } - catch ( final Exception e ) { - System.out.println(); - System.out.println( "the following might be due to absence internet connection:" ); - e.printStackTrace( System.out ); - return false; - } - return true; - } + + }