X-Git-Url: http://source.jalview.org/gitweb/?a=blobdiff_plain;ds=sidebyside;f=forester%2Fjava%2Fsrc%2Forg%2Fforester%2Ftest%2FTest.java;h=af74f007d928503a7d05c6c0854b5a1ef6426d20;hb=3b40e07c1b3964dee89b5d24209946ac54a5e21f;hp=729d5b83dbf1184d2614646442a3704f25dbd17d;hpb=7359853f540f8d2704930c90e0ea9b6969bde51b;p=jalview.git diff --git a/forester/java/src/org/forester/test/Test.java b/forester/java/src/org/forester/test/Test.java index 729d5b8..af74f00 100644 --- a/forester/java/src/org/forester/test/Test.java +++ b/forester/java/src/org/forester/test/Test.java @@ -2,8 +2,8 @@ // FORESTER -- software libraries and applications // for evolutionary biology research and applications. // -// Copyright (C) 2008-2009 Christian M. Zmasek -// Copyright (C) 2008-2009 Burnham Institute for Medical Research +// Copyright (C) 2014 Christian M. Zmasek +// Copyright (C) 2014 Sanford-Burnham Medical Research Institute // All rights reserved // // This library is free software; you can redistribute it and/or @@ -20,7 +20,6 @@ // License along with this library; if not, write to the Free Software // Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301, USA // -// Contact: phylosoft @ gmail . com // WWW: https://sites.google.com/site/cmzmasek/home/software/forester package org.forester.test; @@ -29,6 +28,8 @@ import java.io.ByteArrayInputStream; import java.io.File; import java.io.FileInputStream; import java.io.IOException; +import java.io.StringWriter; +import java.io.Writer; import java.net.URL; import java.util.ArrayList; import java.util.Date; @@ -40,7 +41,9 @@ import java.util.Set; import java.util.SortedSet; import org.forester.application.support_transfer; +import org.forester.archaeopteryx.AptxUtil; import org.forester.archaeopteryx.TreePanelUtil; +import org.forester.archaeopteryx.webservices.WebserviceUtil; import org.forester.development.DevelopmentTools; import org.forester.evoinference.TestPhylogenyReconstruction; import org.forester.evoinference.matrix.character.CharacterStateMatrix; @@ -61,8 +64,10 @@ import org.forester.io.parsers.util.ParserUtils; import org.forester.io.writers.PhylogenyWriter; import org.forester.io.writers.SequenceWriter; import org.forester.msa.BasicMsa; +import org.forester.msa.DeleteableMsa; import org.forester.msa.Mafft; import org.forester.msa.Msa; +import org.forester.msa.Msa.MSA_FORMAT; import org.forester.msa.MsaInferrer; import org.forester.msa.MsaMethods; import org.forester.pccx.TestPccx; @@ -101,7 +106,7 @@ import org.forester.sdi.SDI; import org.forester.sdi.SDIR; import org.forester.sdi.TestGSDI; import org.forester.sequence.BasicSequence; -import org.forester.sequence.Sequence; +import org.forester.sequence.MolecularSequence; import org.forester.species.BasicSpecies; import org.forester.species.Species; import org.forester.surfacing.TestSurfacing; @@ -129,18 +134,19 @@ import org.forester.ws.wabi.TxSearch.TAX_RANK; public final class Test { private final static String PATH_TO_RESOURCES = System.getProperty( "user.dir" ) - + ForesterUtil.getFileSeparator() + "resources" - + ForesterUtil.getFileSeparator(); + + ForesterUtil.getFileSeparator() + "resources" + + ForesterUtil.getFileSeparator(); private final static String PATH_TO_TEST_DATA = System.getProperty( "user.dir" ) - + ForesterUtil.getFileSeparator() + "test_data" - + ForesterUtil.getFileSeparator(); - private final static boolean PERFORM_DB_TESTS = false; + + ForesterUtil.getFileSeparator() + "test_data" + + ForesterUtil.getFileSeparator(); + private final static boolean PERFORM_DB_TESTS = true; + private static final boolean PERFORM_WEB_TREE_ACCESS = true; private static final String PHYLOXML_LOCAL_XSD = PATH_TO_RESOURCES + "phyloxml_schema/" - + ForesterConstants.PHYLO_XML_VERSION + "/" - + ForesterConstants.PHYLO_XML_XSD; + + ForesterConstants.PHYLO_XML_VERSION + "/" + + ForesterConstants.PHYLO_XML_XSD; private static final String PHYLOXML_REMOTE_XSD = ForesterConstants.PHYLO_XML_LOCATION + "/" - + ForesterConstants.PHYLO_XML_VERSION + "/" - + ForesterConstants.PHYLO_XML_XSD; + + ForesterConstants.PHYLO_XML_VERSION + "/" + + ForesterConstants.PHYLO_XML_XSD; private final static boolean USE_LOCAL_PHYLOXML_SCHEMA = true; private final static double ZERO_DIFF = 1.0E-9; @@ -151,7 +157,7 @@ public final class Test { public static void main( final String[] args ) { System.out.println( "[Java version: " + ForesterUtil.JAVA_VERSION + " " + ForesterUtil.JAVA_VENDOR + "]" ); System.out.println( "[OS: " + ForesterUtil.OS_NAME + " " + ForesterUtil.OS_ARCH + " " + ForesterUtil.OS_VERSION - + "]" ); + + "]" ); Locale.setDefault( Locale.US ); System.out.println( "[Locale: " + Locale.getDefault() + "]" ); int failed = 0; @@ -256,31 +262,6 @@ public final class Test { System.out.println( "failed." ); failed++; } - if ( PERFORM_DB_TESTS ) { - System.out.print( "Ebi Entry Retrieval: " ); - if ( Test.testEbiEntryRetrieval() ) { - System.out.println( "OK." ); - succeeded++; - } - else { - System.out.println( "failed." ); - failed++; - } - } - // System.exit( 0 ); - if ( PERFORM_DB_TESTS ) { - System.out.print( "Sequence DB tools 2: " ); - if ( testSequenceDbWsTools2() ) { - System.out.println( "OK." ); - succeeded++; - } - else { - System.out.println( "failed." ); - failed++; - System.exit( -1 ); - } - } - // System.exit( 0 ); System.out.print( "Hmmscan output parser: " ); if ( testHmmscanOutputParser() ) { System.out.println( "OK." ); @@ -290,7 +271,6 @@ public final class Test { System.out.println( "failed." ); failed++; } - // System.out.print( "Overlap removal: " ); if ( !org.forester.test.Test.testOverlapRemoval() ) { System.out.println( "failed." ); @@ -309,7 +289,15 @@ public final class Test { succeeded++; } System.out.println( "OK." ); - // + System.out.print( "Taxonomy data extraction: " ); + if ( Test.testExtractTaxonomyDataFromNodeName() ) { + System.out.println( "OK." ); + succeeded++; + } + else { + System.out.println( "failed." ); + failed++; + } System.out.print( "Taxonomy code extraction: " ); if ( Test.testExtractTaxonomyCodeFromNodeName() ) { System.out.println( "OK." ); @@ -880,29 +868,6 @@ public final class Test { System.out.println( "failed." ); failed++; } - if ( PERFORM_DB_TESTS ) { - System.out.print( "Uniprot Entry Retrieval: " ); - if ( Test.testUniprotEntryRetrieval() ) { - System.out.println( "OK." ); - succeeded++; - } - else { - System.out.println( "failed." ); - failed++; - } - } - if ( PERFORM_DB_TESTS ) { - System.out.print( "Uniprot Taxonomy Search: " ); - if ( Test.testUniprotTaxonomySearch() ) { - System.out.println( "OK." ); - succeeded++; - } - else { - System.out.println( "failed." ); - failed++; - } - } - //---- String path = ""; final String os = ForesterUtil.OS_NAME.toLowerCase(); if ( ( os.indexOf( "mac" ) >= 0 ) && ( os.indexOf( "os" ) > 0 ) ) { @@ -912,13 +877,13 @@ public final class Test { path = "C:\\Program Files\\mafft-win\\mafft.bat"; } else { - path = "/home/czmasek/bin/mafft"; - } - if ( !MsaInferrer.isInstalled( path ) ) { path = "mafft"; - } - if ( !MsaInferrer.isInstalled( path ) ) { - path = "/usr/local/bin/mafft"; + if ( !MsaInferrer.isInstalled( path ) ) { + path = "/usr/bin/mafft"; + } + if ( !MsaInferrer.isInstalled( path ) ) { + path = "/usr/local/bin/mafft"; + } } if ( MsaInferrer.isInstalled( path ) ) { System.out.print( "MAFFT (external program): " ); @@ -930,7 +895,6 @@ public final class Test { System.out.println( "failed [will not count towards failed tests]" ); } } - //---- System.out.print( "Next nodes with collapsed: " ); if ( Test.testNextNodeWithCollapsing() ) { System.out.println( "OK." ); @@ -949,8 +913,8 @@ public final class Test { System.out.println( "failed." ); failed++; } - System.out.print( "NHX parsing from URL: " ); - if ( Test.testNHXparsingFromURL() ) { + System.out.print( "Deleteable MSA: " ); + if ( Test.testDeleteableMsa() ) { System.out.println( "OK." ); succeeded++; } @@ -958,8 +922,8 @@ public final class Test { System.out.println( "failed." ); failed++; } - System.out.print( "phyloXML parsing from URL: " ); - if ( Test.testPhyloXMLparsingFromURL() ) { + System.out.print( "MSA entropy: " ); + if ( Test.testMsaEntropy() ) { System.out.println( "OK." ); succeeded++; } @@ -967,6 +931,114 @@ public final class Test { System.out.println( "failed." ); failed++; } + if ( PERFORM_DB_TESTS ) { + System.out.print( "Uniprot Entry Retrieval: " ); + if ( Test.testUniprotEntryRetrieval() ) { + System.out.println( "OK." ); + succeeded++; + } + else { + System.out.println( "failed." ); + failed++; + } + System.out.print( "Ebi Entry Retrieval: " ); + if ( Test.testEbiEntryRetrieval() ) { + System.out.println( "OK." ); + succeeded++; + } + else { + System.out.println( "failed." ); + failed++; + } + System.out.print( "Sequence DB tools 2: " ); + if ( testSequenceDbWsTools2() ) { + System.out.println( "OK." ); + succeeded++; + } + else { + System.out.println( "failed." ); + failed++; + System.exit( -1 ); + } + System.out.print( "Uniprot Taxonomy Search: " ); + if ( Test.testUniprotTaxonomySearch() ) { + System.out.println( "OK." ); + succeeded++; + } + else { + System.out.println( "failed." ); + failed++; + } + } + if ( PERFORM_WEB_TREE_ACCESS ) { + System.out.print( "NHX parsing from URL: " ); + if ( Test.testNHXparsingFromURL() ) { + System.out.println( "OK." ); + succeeded++; + } + else { + System.out.println( "failed." ); + failed++; + } + System.out.print( "NHX parsing from URL 2: " ); + if ( Test.testNHXparsingFromURL2() ) { + System.out.println( "OK." ); + succeeded++; + } + else { + System.out.println( "failed." ); + failed++; + } + System.out.print( "phyloXML parsing from URL: " ); + if ( Test.testPhyloXMLparsingFromURL() ) { + System.out.println( "OK." ); + succeeded++; + } + else { + System.out.println( "failed." ); + failed++; + } + System.out.print( "TreeBase acccess: " ); + if ( Test.testTreeBaseReading() ) { + System.out.println( "OK." ); + succeeded++; + } + else { + System.out.println( "failed." ); + failed++; + } + // + System.out.print( "ToL access: " ); + if ( Test.testToLReading() ) { + System.out.println( "OK." ); + succeeded++; + } + else { + System.out.println( "failed." ); + failed++; + } + // + System.out.print( "TreeFam access: " ); + if ( Test.testTreeFamReading() ) { + System.out.println( "OK." ); + succeeded++; + } + else { + System.out.println( "failed." ); + failed++; + } + // + // + System.out.print( "Pfam tree access: " ); + if ( Test.testPfamTreeReading() ) { + System.out.println( "OK." ); + succeeded++; + } + else { + System.out.println( "failed." ); + failed++; + } + } System.out.println(); final Runtime rt = java.lang.Runtime.getRuntime(); final long free_memory = rt.freeMemory() / 1000000; @@ -1084,18 +1156,69 @@ public final class Test { return true; } - public static final boolean testPhyloXMLparsingFromURL() { + public static final boolean testNHXparsingFromURL2() { try { - final String s = "https://sites.google.com/site/cmzmasek/home/software/archaeopteryx/examples/archaeopteryx_a/apaf_bcl2.xml"; - final URL u = new URL( s ); - final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance(); - final Phylogeny[] phys = factory.create( u.openStream(), PhyloXmlParser.createPhyloXmlParser() ); - if ( ( phys == null ) || ( phys.length != 2 ) ) { + final String s = "https://sites.google.com/site/cmzmasek/home/software/archaeopteryx/examples/simple/simple_1.nh"; + final Phylogeny phys[] = AptxUtil.readPhylogeniesFromUrl( new URL( s ), + false, + false, + false, + TAXONOMY_EXTRACTION.NO, + false ); + if ( ( phys == null ) || ( phys.length != 5 ) ) { + return false; + } + if ( !phys[ 0 ].toNewHampshire().equals( "((((A,B),C),D),(E,F));" ) ) { + System.out.println( phys[ 0 ].toNewHampshire() ); + return false; + } + if ( !phys[ 1 ].toNewHampshire().equals( "((1,2,3),(4,5,6),(7,8,9));" ) ) { + System.out.println( phys[ 1 ].toNewHampshire() ); + return false; + } + final Phylogeny phys2[] = AptxUtil.readPhylogeniesFromUrl( new URL( s ), + false, + false, + false, + TAXONOMY_EXTRACTION.NO, + false ); + if ( ( phys2 == null ) || ( phys2.length != 5 ) ) { + return false; + } + if ( !phys2[ 0 ].toNewHampshire().equals( "((((A,B),C),D),(E,F));" ) ) { + System.out.println( phys2[ 0 ].toNewHampshire() ); + return false; + } + if ( !phys2[ 1 ].toNewHampshire().equals( "((1,2,3),(4,5,6),(7,8,9));" ) ) { + System.out.println( phys2[ 1 ].toNewHampshire() ); + return false; + } + final Phylogeny phys3[] = AptxUtil.readPhylogeniesFromUrl( new URL( "http://swisstree.vital-it.ch:80/" + + "SwissTree/ST001/consensus_tree.nhx" ), false, false, false, TAXONOMY_EXTRACTION.NO, false ); + if ( ( phys3 == null ) || ( phys3.length != 1 ) ) { + return false; + } + if ( !phys3[ 0 ] + .toNewHampshire() + .equals( "((((POP23a_CIOIN_ENSCING00000016202,POP23b_CIOIN_ENSCING00000016169),POP23_CIOSA_ENSCSAVG00000000248),((POP23a_BRAFL_C3ZMF1,POP23b_BRAFL_121417),(((POP3_ORYLA_ENSORLG00000019669,POP3_GASAC_ENSGACG00000014023,POP3_DANRE_Q6JWW1),(POP3_XENTR_B1H1F6,(POP3_CHICK_Q9DG25,(POP3_ORNAN_ENSOANG00000004179,POP3_MONDO_ENSMODG00000018033,((POP3_MOUSE_Q9ES81,POP3_RAT_Q3BCU3),POP3_RABIT_ENSOCUG00000025973,POP3_MACMU_ENSMMUG00000014473,POP3_HUMAN_Q9HBV1))))),(((POP2_GASAC_ENSGACG00000001420,POP2_ORYLA_ENSORLG00000008627,POP2_TAKRU_ENSTRUG00000015933),POP2_DANRE_ENSDARG00000069922),POP2_XENTR_ENSXETG00000018064,(((POP2_TAEGU_ENSTGUG00000013383,POP2_CHICK_Q6T9Z5),POP2_ANOCA_ENSACAG00000003557),((POP2_MACEU_ENSMEUG00000015825,POP2_MONDO_ENSMODG00000018205),((POP2_RABIT_ENSOCUG00000009515,(POP2_RAT_Q6P722,POP2_MOUSE_Q9ES82)),(POP2_MACMU_ENSMMUG00000000905,POP2_HUMAN_Q9HBU9)))))))),((POP1_CIOSA_ENSCSAVG00000000247,POP1_CIOIN_ENSCING00000000496),((POP1_DANRE_Q5PQZ7,(POP1_ORYLA_ENSORLG00000019663,POP1_GASAC_ENSGACG00000014015,POP1_TAKRU_ENSORLG00000019663)),(POP1_XENTR_B1H1G2,(POP1_ANOCA_ENSACAG00000003910,(POP1_TAEGU_ENSTGUG00000012218,POP1_CHICK_Q9DG23)),POP1_ORNAN_ENSOANG00000004180,POP1_MONDO_ENSMODG00000018034,(POP1_RABIT_ENSOCUG00000016944,(POP1_RAT_Q3BCU4,POP1_MOUSE_Q9ES83),(POP1_HUMAN_Q8NE79,POP1_MACMU_ENSMMUG00000014471))))));" ) ) { + System.out.println( phys3[ 0 ].toNewHampshire() ); + return false; + } + final Phylogeny phys4[] = AptxUtil.readPhylogeniesFromUrl( new URL( "http://swisstree.vital-it.ch:80/" + + "SwissTree/ST001/consensus_tree.nhx" ), false, false, false, TAXONOMY_EXTRACTION.NO, false ); + if ( ( phys4 == null ) || ( phys4.length != 1 ) ) { + return false; + } + if ( !phys4[ 0 ] + .toNewHampshire() + .equals( "((((POP23a_CIOIN_ENSCING00000016202,POP23b_CIOIN_ENSCING00000016169),POP23_CIOSA_ENSCSAVG00000000248),((POP23a_BRAFL_C3ZMF1,POP23b_BRAFL_121417),(((POP3_ORYLA_ENSORLG00000019669,POP3_GASAC_ENSGACG00000014023,POP3_DANRE_Q6JWW1),(POP3_XENTR_B1H1F6,(POP3_CHICK_Q9DG25,(POP3_ORNAN_ENSOANG00000004179,POP3_MONDO_ENSMODG00000018033,((POP3_MOUSE_Q9ES81,POP3_RAT_Q3BCU3),POP3_RABIT_ENSOCUG00000025973,POP3_MACMU_ENSMMUG00000014473,POP3_HUMAN_Q9HBV1))))),(((POP2_GASAC_ENSGACG00000001420,POP2_ORYLA_ENSORLG00000008627,POP2_TAKRU_ENSTRUG00000015933),POP2_DANRE_ENSDARG00000069922),POP2_XENTR_ENSXETG00000018064,(((POP2_TAEGU_ENSTGUG00000013383,POP2_CHICK_Q6T9Z5),POP2_ANOCA_ENSACAG00000003557),((POP2_MACEU_ENSMEUG00000015825,POP2_MONDO_ENSMODG00000018205),((POP2_RABIT_ENSOCUG00000009515,(POP2_RAT_Q6P722,POP2_MOUSE_Q9ES82)),(POP2_MACMU_ENSMMUG00000000905,POP2_HUMAN_Q9HBU9)))))))),((POP1_CIOSA_ENSCSAVG00000000247,POP1_CIOIN_ENSCING00000000496),((POP1_DANRE_Q5PQZ7,(POP1_ORYLA_ENSORLG00000019663,POP1_GASAC_ENSGACG00000014015,POP1_TAKRU_ENSORLG00000019663)),(POP1_XENTR_B1H1G2,(POP1_ANOCA_ENSACAG00000003910,(POP1_TAEGU_ENSTGUG00000012218,POP1_CHICK_Q9DG23)),POP1_ORNAN_ENSOANG00000004180,POP1_MONDO_ENSMODG00000018034,(POP1_RABIT_ENSOCUG00000016944,(POP1_RAT_Q3BCU4,POP1_MOUSE_Q9ES83),(POP1_HUMAN_Q8NE79,POP1_MACMU_ENSMMUG00000014471))))));" ) ) { + System.out.println( phys4[ 0 ].toNewHampshire() ); return false; } } catch ( final Exception e ) { e.printStackTrace(); + return false; } return true; } @@ -1106,69 +1229,64 @@ public final class Test { final URL u = new URL( s ); final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance(); final Phylogeny[] phys = factory.create( u, new NHXParser() ); - if ( ( phys == null ) || ( phys.length != 1 ) ) { + if ( ( phys == null ) || ( phys.length != 5 ) ) { return false; } - if ( !phys[ 0 ].toNewHampshire().equals( "((a,b),c);" ) ) { + if ( !phys[ 0 ].toNewHampshire().equals( "((((A,B),C),D),(E,F));" ) ) { System.out.println( phys[ 0 ].toNewHampshire() ); return false; } - final Phylogeny[] phys2 = factory.create( u.openStream(), new NHXParser() ); - if ( ( phys2 == null ) || ( phys2.length != 1 ) ) { + if ( !phys[ 1 ].toNewHampshire().equals( "((1,2,3),(4,5,6),(7,8,9));" ) ) { + System.out.println( phys[ 1 ].toNewHampshire() ); + return false; + } + final URL u2 = new URL( s ); + final Phylogeny[] phys2 = factory.create( u2.openStream(), new NHXParser() ); + if ( ( phys2 == null ) || ( phys2.length != 5 ) ) { return false; } - if ( !phys2[ 0 ].toNewHampshire().equals( "((a,b),c);" ) ) { + if ( !phys2[ 0 ].toNewHampshire().equals( "((((A,B),C),D),(E,F));" ) ) { System.out.println( phys2[ 0 ].toNewHampshire() ); return false; } final PhylogenyFactory factory2 = ParserBasedPhylogenyFactory.getInstance(); final NHXParser p = new NHXParser(); - final URL u2 = new URL( s ); - p.setSource( u2 ); + final URL u3 = new URL( s ); + p.setSource( u3 ); if ( !p.hasNext() ) { return false; } - if ( !p.next().toNewHampshire().equals( "((a,b),c);" ) ) { - return false; - } - if ( p.hasNext() ) { - return false; - } - if ( p.next() != null ) { - return false; - } - if ( p.hasNext() ) { + if ( !p.next().toNewHampshire().equals( "((((A,B),C),D),(E,F));" ) ) { return false; } - if ( p.next() != null ) { + if ( !p.hasNext() ) { return false; } p.reset(); if ( !p.hasNext() ) { return false; } - if ( !p.next().toNewHampshire().equals( "((a,b),c);" ) ) { + if ( !p.next().toNewHampshire().equals( "((((A,B),C),D),(E,F));" ) ) { return false; } - if ( p.hasNext() ) { - return false; - } - if ( p.next() != null ) { + if ( !p.next().toNewHampshire().equals( "((1,2,3),(4,5,6),(7,8,9));" ) ) { return false; } - if ( p.hasNext() ) { + p.reset(); + if ( !p.hasNext() ) { return false; } - if ( p.next() != null ) { + if ( !p.next().toNewHampshire().equals( "((((A,B),C),D),(E,F));" ) ) { return false; } - p.reset(); - if ( !p.hasNext() ) { + if ( !p.next().toNewHampshire().equals( "((1,2,3),(4,5,6),(7,8,9));" ) ) { return false; } } catch ( final Exception e ) { + System.out.println( e.toString() ); e.printStackTrace(); + return false; } return true; } @@ -1327,54 +1445,163 @@ public final class Test { return true; } - private final static Phylogeny createPhylogeny( final String nhx ) throws IOException { - final Phylogeny p = ParserBasedPhylogenyFactory.getInstance().create( nhx, new NHXParser() )[ 0 ]; - return p; - } - - private final static Event getEvent( final Phylogeny p, final String n1, final String n2 ) { - return PhylogenyMethods.calculateLCA( p.getNode( n1 ), p.getNode( n2 ) ).getNodeData().getEvent(); - } - - private static boolean testAminoAcidSequence() { + public static final boolean testPfamTreeReading() { try { - final Sequence aa1 = BasicSequence.createAaSequence( "aa1", "aAklm-?xX*z$#" ); - if ( aa1.getLength() != 13 ) { + final URL u = new URL( WebserviceUtil.PFAM_SERVER + "/family/PF" + "01849" + "/tree/download" ); + final NHXParser parser = new NHXParser(); + parser.setTaxonomyExtraction( NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT ); + parser.setReplaceUnderscores( false ); + parser.setGuessRootedness( true ); + final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance(); + final Phylogeny[] phys = factory.create( u.openStream(), parser ); + if ( ( phys == null ) || ( phys.length != 1 ) ) { return false; } - if ( aa1.getResidueAt( 0 ) != 'A' ) { + if ( phys[ 0 ].getNumberOfExternalNodes() < 10 ) { return false; } - if ( aa1.getResidueAt( 2 ) != 'K' ) { + } + catch ( final Exception e ) { + e.printStackTrace(); + } + return true; + } + + public static final boolean testPhyloXMLparsingFromURL() { + try { + final String s = "https://sites.google.com/site/cmzmasek/home/software/archaeopteryx/examples/archaeopteryx_a/apaf_bcl2.xml"; + final URL u = new URL( s ); + final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance(); + final Phylogeny[] phys = factory.create( u.openStream(), PhyloXmlParser.createPhyloXmlParser() ); + if ( ( phys == null ) || ( phys.length != 2 ) ) { return false; } - if ( !new String( aa1.getMolecularSequence() ).equals( "AAKLM-XXX*ZXX" ) ) { + } + catch ( final Exception e ) { + e.printStackTrace(); + } + return true; + } + + public static final boolean testToLReading() { + try { + final URL u = new URL( WebserviceUtil.TOL_URL_BASE + "15079" ); + final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance(); + final Phylogeny[] phys = factory.create( u.openStream(), new TolParser() ); + if ( ( phys == null ) || ( phys.length != 1 ) ) { return false; } - final Sequence aa2 = BasicSequence.createAaSequence( "aa3", "ARNDCQEGHILKMFPSTWYVX*-BZOJU" ); - if ( !new String( aa2.getMolecularSequence() ).equals( "ARNDCQEGHILKMFPSTWYVX*-BZXXU" ) ) { + if ( !phys[ 0 ].getRoot().getNodeData().getTaxonomy().getIdentifier().getValue().equals( "15079" ) ) { return false; } - final Sequence dna1 = BasicSequence.createDnaSequence( "dna1", "ACGTUX*-?RYMKWSN" ); - if ( !new String( dna1.getMolecularSequence() ).equals( "ACGTNN*-NRYMKWSN" ) ) { + if ( !phys[ 0 ].getRoot().getNodeData().getTaxonomy().getScientificName().equals( "Protacanthopterygii" ) ) { return false; } - final Sequence rna1 = BasicSequence.createRnaSequence( "rna1", "..ACGUTX*-?RYMKWSN" ); - if ( !new String( rna1.getMolecularSequence() ).equals( "--ACGUNN*-NRYMKWSN" ) ) { + if ( phys[ 0 ].getNumberOfExternalNodes() < 5 ) { return false; } } catch ( final Exception e ) { e.printStackTrace(); - return false; } return true; } - private static boolean testBasicDomain() { + public static final boolean testTreeBaseReading() { try { - final Domain pd = new BasicDomain( "id", 23, 25, ( short ) 1, ( short ) 4, 0.1, -12 ); - if ( !pd.getDomainId().equals( "id" ) ) { + final URL u = new URL( WebserviceUtil.TREEBASE_PHYLOWS_TREE_URL_BASE + "825?format=nexus" ); + final NexusPhylogeniesParser parser = new NexusPhylogeniesParser(); + parser.setReplaceUnderscores( true ); + final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance(); + final Phylogeny[] phys = factory.create( u.openStream(), parser ); + if ( ( phys == null ) || ( phys.length != 1 ) ) { + return false; + } + final URL u2 = new URL( WebserviceUtil.TREEBASE_PHYLOWS_STUDY_URL_BASE + "15613?format=nexus" ); + final NexusPhylogeniesParser parser2 = new NexusPhylogeniesParser(); + parser2.setReplaceUnderscores( true ); + final PhylogenyFactory factory2 = ParserBasedPhylogenyFactory.getInstance(); + final Phylogeny[] phys2 = factory2.create( u2.openStream(), parser2 ); + if ( ( phys2 == null ) || ( phys2.length != 9 ) ) { + return false; + } + } + catch ( final Exception e ) { + e.printStackTrace(); + } + return true; + } + + public static final boolean testTreeFamReading() { + try { + final URL u = new URL( WebserviceUtil.TREE_FAM_URL_BASE + "101004" + "/tree/newick" ); + final NHXParser parser = new NHXParser(); + parser.setTaxonomyExtraction( NHXParser.TAXONOMY_EXTRACTION.NO ); + parser.setReplaceUnderscores( false ); + parser.setGuessRootedness( true ); + final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance(); + final Phylogeny[] phys = factory.create( u.openStream(), parser ); + if ( ( phys == null ) || ( phys.length != 1 ) ) { + return false; + } + if ( phys[ 0 ].getNumberOfExternalNodes() < 10 ) { + return false; + } + } + catch ( final Exception e ) { + e.printStackTrace(); + } + return true; + } + + private final static Phylogeny createPhylogeny( final String nhx ) throws IOException { + final Phylogeny p = ParserBasedPhylogenyFactory.getInstance().create( nhx, new NHXParser() )[ 0 ]; + return p; + } + + private final static Event getEvent( final Phylogeny p, final String n1, final String n2 ) { + return PhylogenyMethods.calculateLCA( p.getNode( n1 ), p.getNode( n2 ) ).getNodeData().getEvent(); + } + + private static boolean testAminoAcidSequence() { + try { + final MolecularSequence aa1 = BasicSequence.createAaSequence( "aa1", "aAklm-?xX*z$#" ); + if ( aa1.getLength() != 13 ) { + return false; + } + if ( aa1.getResidueAt( 0 ) != 'A' ) { + return false; + } + if ( aa1.getResidueAt( 2 ) != 'K' ) { + return false; + } + if ( !new String( aa1.getMolecularSequence() ).equals( "AAKLM-XXX*ZXX" ) ) { + return false; + } + final MolecularSequence aa2 = BasicSequence.createAaSequence( "aa3", "ARNDCQEGHILKMFPSTWYVX*-BZOJU" ); + if ( !new String( aa2.getMolecularSequence() ).equals( "ARNDCQEGHILKMFPSTWYVX*-BZOXU" ) ) { + return false; + } + final MolecularSequence dna1 = BasicSequence.createDnaSequence( "dna1", "ACGTUX*-?RYMKWSN" ); + if ( !new String( dna1.getMolecularSequence() ).equals( "ACGTNN*-NRYMKWSN" ) ) { + return false; + } + final MolecularSequence rna1 = BasicSequence.createRnaSequence( "rna1", "..ACGUTX*-?RYMKWSN" ); + if ( !new String( rna1.getMolecularSequence() ).equals( "--ACGUNN*-NRYMKWSN" ) ) { + return false; + } + } + catch ( final Exception e ) { + e.printStackTrace(); + return false; + } + return true; + } + + private static boolean testBasicDomain() { + try { + final Domain pd = new BasicDomain( "id", 23, 25, ( short ) 1, ( short ) 4, 0.1, -12 ); + if ( !pd.getDomainId().equals( "id" ) ) { return false; } if ( pd.getNumber() != 1 ) { @@ -1549,6 +1776,21 @@ public final class Test { if ( !t3.getIdentifier().getProvider().equals( "treebank" ) ) { return false; } + if ( !t3.getNode( "root node" ).isDuplication() ) { + return false; + } + if ( !t3.getNode( "node a" ).isDuplication() ) { + return false; + } + if ( t3.getNode( "node a" ).isSpeciation() ) { + return false; + } + if ( t3.getNode( "node bc" ).isDuplication() ) { + return false; + } + if ( !t3.getNode( "node bc" ).isSpeciation() ) { + return false; + } if ( !t3.getNode( "root node" ).getNodeData().getSequence().getType().equals( "protein" ) ) { return false; } @@ -1876,7 +2118,7 @@ public final class Test { return false; } if ( t3_rt.getNode( "node bc" ).getNodeData().getSequence().getDomainArchitecture().getDomain( 0 ) - .getConfidence() != 2144 ) { + .getConfidence() != 0 ) { return false; } if ( !t3_rt.getNode( "node bc" ).getNodeData().getSequence().getDomainArchitecture().getDomain( 0 ).getId() @@ -1957,7 +2199,6 @@ public final class Test { if ( !t3_rt.getNode( "node b" ).getNodeData().getBinaryCharacters().getType().equals( "characters" ) ) { return false; } - // if ( !t3_rt.getNode( "node ba" ).getNodeData().getDate().getDesc().equals( "Silurian" ) ) { return false; } @@ -2831,7 +3072,6 @@ public final class Test { if ( !isEqual( t_bx.getNode( "acd" ).getBranchData().getConfidence( 0 ).getValue(), 1 ) ) { return false; } - // final Phylogeny[] t2 = factory .create( "((((a,b),c),d),e);(((a,b),c),(d,e));(((((a,b),c),d),e),f);((((a,b),c),(d,e)),f);(((a,b),c),d,e);((a,b,c),d,e);", new NHXParser() ); @@ -2841,7 +3081,6 @@ public final class Test { for( final Phylogeny target : t2 ) { ConfidenceAssessor.evaluate( "bootstrap", ev2, target, false, 1 ); } - // final Phylogeny t4 = factory.create( "((((((A,B)ab,C)abc,D)abcd,E)abcde,F)abcdef,G)abcdefg", new NHXParser() )[ 0 ]; final Phylogeny[] ev4 = factory.create( "(((A,B),C),(X,Y));((F,G),((A,B,C),(D,E)))", new NHXParser() ); @@ -3350,7 +3589,7 @@ public final class Test { if ( t4.getNumberOfExternalNodes() != 5 ) { return false; } - String s = w.toNewHampshire( t4, false, true ).toString(); + String s = w.toNewHampshire( t4, true ).toString(); if ( !s.equals( "((A,(B11,B12)),(C,D));" ) ) { return false; } @@ -3371,7 +3610,7 @@ public final class Test { if ( !n.getName().equals( "D" ) ) { return false; } - s = w.toNewHampshire( t4, false, true ).toString(); + s = w.toNewHampshire( t4, true ).toString(); if ( !s.equals( "((A,B12),D);" ) ) { return false; } @@ -3380,7 +3619,7 @@ public final class Test { if ( t5.getNumberOfExternalNodes() != 5 ) { return false; } - s = w.toNewHampshire( t5, false, true ).toString(); + s = w.toNewHampshire( t5, true ).toString(); if ( !s.equals( "(((B11,B12),B2),(C,D));" ) ) { return false; } @@ -3389,7 +3628,7 @@ public final class Test { if ( t6.getNumberOfExternalNodes() != 5 ) { return false; } - s = w.toNewHampshire( t6, false, false ).toString(); + s = w.toNewHampshire( t6, false ).toString(); if ( !s.equals( "((A,(B12,B2)),(C,D));" ) ) { return false; } @@ -3398,7 +3637,7 @@ public final class Test { if ( t7.getNumberOfExternalNodes() != 5 ) { return false; } - s = w.toNewHampshire( t7, false, true ).toString(); + s = w.toNewHampshire( t7, true ).toString(); if ( !s.equals( "((A,(B11,B2)),(C,D));" ) ) { return false; } @@ -3407,7 +3646,7 @@ public final class Test { if ( t8.getNumberOfExternalNodes() != 5 ) { return false; } - s = w.toNewHampshire( t8, false, false ).toString(); + s = w.toNewHampshire( t8, false ).toString(); if ( !s.equals( "((A,(B11,B12)),(C,D));" ) ) { return false; } @@ -3416,7 +3655,7 @@ public final class Test { if ( t9.getNumberOfExternalNodes() != 5 ) { return false; } - s = w.toNewHampshire( t9, false, true ).toString(); + s = w.toNewHampshire( t9, true ).toString(); if ( !s.equals( "((A,((B11,B12),B2)),D);" ) ) { return false; } @@ -3425,7 +3664,7 @@ public final class Test { if ( t10.getNumberOfExternalNodes() != 5 ) { return false; } - s = w.toNewHampshire( t10, false, true ).toString(); + s = w.toNewHampshire( t10, true ).toString(); if ( !s.equals( "((A,((B11,B12),B2)),C);" ) ) { return false; } @@ -3434,7 +3673,7 @@ public final class Test { if ( t11.getNumberOfExternalNodes() != 2 ) { return false; } - s = w.toNewHampshire( t11, false, true ).toString(); + s = w.toNewHampshire( t11, true ).toString(); if ( !s.equals( "(B,C);" ) ) { return false; } @@ -3442,7 +3681,7 @@ public final class Test { if ( t11.getNumberOfExternalNodes() != 1 ) { return false; } - s = w.toNewHampshire( t11, false, false ).toString(); + s = w.toNewHampshire( t11, false ).toString(); if ( !s.equals( "B;" ) ) { return false; } @@ -3451,7 +3690,7 @@ public final class Test { if ( t12.getNumberOfExternalNodes() != 8 ) { return false; } - s = w.toNewHampshire( t12, false, true ).toString(); + s = w.toNewHampshire( t12, true ).toString(); if ( !s.equals( "((A1,A2,A3),(B1,B3),(C1,C2,C3));" ) ) { return false; } @@ -3459,7 +3698,7 @@ public final class Test { if ( t12.getNumberOfExternalNodes() != 7 ) { return false; } - s = w.toNewHampshire( t12, false, true ).toString(); + s = w.toNewHampshire( t12, true ).toString(); if ( !s.equals( "((A1,A2,A3),B1,(C1,C2,C3));" ) ) { return false; } @@ -3467,7 +3706,7 @@ public final class Test { if ( t12.getNumberOfExternalNodes() != 6 ) { return false; } - s = w.toNewHampshire( t12, false, true ).toString(); + s = w.toNewHampshire( t12, true ).toString(); if ( !s.equals( "((A1,A2,A3),B1,(C1,C2));" ) ) { return false; } @@ -3475,7 +3714,7 @@ public final class Test { if ( t12.getNumberOfExternalNodes() != 5 ) { return false; } - s = w.toNewHampshire( t12, false, true ).toString(); + s = w.toNewHampshire( t12, true ).toString(); if ( !s.equals( "((A2,A3),B1,(C1,C2));" ) ) { return false; } @@ -3483,7 +3722,7 @@ public final class Test { if ( t12.getNumberOfExternalNodes() != 4 ) { return false; } - s = w.toNewHampshire( t12, false, true ).toString(); + s = w.toNewHampshire( t12, true ).toString(); if ( !s.equals( "((A2,A3),(C1,C2));" ) ) { return false; } @@ -3491,7 +3730,7 @@ public final class Test { if ( t12.getNumberOfExternalNodes() != 3 ) { return false; } - s = w.toNewHampshire( t12, false, true ).toString(); + s = w.toNewHampshire( t12, true ).toString(); if ( !s.equals( "(A2,(C1,C2));" ) ) { return false; } @@ -3499,7 +3738,7 @@ public final class Test { if ( t12.getNumberOfExternalNodes() != 2 ) { return false; } - s = w.toNewHampshire( t12, false, true ).toString(); + s = w.toNewHampshire( t12, true ).toString(); if ( !s.equals( "(C1,C2);" ) ) { return false; } @@ -3508,7 +3747,7 @@ public final class Test { if ( t13.getNumberOfExternalNodes() != 4 ) { return false; } - s = w.toNewHampshire( t13, false, true ).toString(); + s = w.toNewHampshire( t13, true ).toString(); if ( !s.equals( "(A,B,C,E:5.0);" ) ) { return false; } @@ -3517,7 +3756,7 @@ public final class Test { if ( t14.getNumberOfExternalNodes() != 5 ) { return false; } - s = w.toNewHampshire( t14, false, true ).toString(); + s = w.toNewHampshire( t14, true ).toString(); if ( !s.equals( "((A,B,C,D:1.1),F);" ) ) { return false; } @@ -3776,10 +4015,6 @@ public final class Test { System.out.println( entry.getSequenceName() ); return false; } - // if ( !entry.getSequenceSymbol().equals( "" ) ) { - // System.out.println( entry.getSequenceSymbol() ); - // return false; - // } if ( !entry.getGeneName().equals( "treX-like" ) ) { System.out.println( entry.getGeneName() ); return false; @@ -3799,7 +4034,6 @@ public final class Test { if ( entry.getCrossReferences().size() != 5 ) { return false; } - // final SequenceDatabaseEntry entry1 = SequenceDbWsTools.obtainEntry( "ABJ16409" ); if ( !entry1.getAccession().equals( "ABJ16409" ) ) { return false; @@ -3823,7 +4057,6 @@ public final class Test { if ( entry1.getCrossReferences().size() != 6 ) { return false; } - // final SequenceDatabaseEntry entry2 = SequenceDbWsTools.obtainEntry( "NM_184234" ); if ( !entry2.getAccession().equals( "NM_184234" ) ) { return false; @@ -3837,213 +4070,453 @@ public final class Test { System.out.println( entry2.getSequenceName() ); return false; } - if ( !entry2.getTaxonomyIdentifier().equals( "9606" ) ) { - System.out.println( entry2.getTaxonomyIdentifier() ); + if ( !entry2.getTaxonomyIdentifier().equals( "9606" ) ) { + System.out.println( entry2.getTaxonomyIdentifier() ); + return false; + } + if ( !entry2.getGeneName().equals( "RBM39" ) ) { + System.out.println( entry2.getGeneName() ); + return false; + } + if ( entry2.getCrossReferences().size() != 3 ) { + return false; + } + // + final SequenceDatabaseEntry entry3 = SequenceDbWsTools.obtainEntry( "HM043801" ); + if ( !entry3.getAccession().equals( "HM043801" ) ) { + return false; + } + if ( !entry3.getTaxonomyScientificName().equals( "Bursaphelenchus xylophilus" ) ) { + System.out.println( entry3.getTaxonomyScientificName() ); + return false; + } + if ( !entry3.getSequenceName().equals( "Bursaphelenchus xylophilus RAF gene, complete cds" ) ) { + System.out.println( entry3.getSequenceName() ); + return false; + } + if ( !entry3.getTaxonomyIdentifier().equals( "6326" ) ) { + System.out.println( entry3.getTaxonomyIdentifier() ); + return false; + } + if ( !entry3.getSequenceSymbol().equals( "RAF" ) ) { + System.out.println( entry3.getSequenceSymbol() ); + return false; + } + if ( !ForesterUtil.isEmpty( entry3.getGeneName() ) ) { + return false; + } + if ( entry3.getCrossReferences().size() < 7 ) { + return false; + } + final SequenceDatabaseEntry entry4 = SequenceDbWsTools.obtainEntry( "AAA36557.1" ); + if ( !entry4.getAccession().equals( "AAA36557" ) ) { + return false; + } + if ( !entry4.getTaxonomyScientificName().equals( "Homo sapiens" ) ) { + System.out.println( entry4.getTaxonomyScientificName() ); + return false; + } + if ( !entry4.getSequenceName().equals( "Homo sapiens (human) ras protein" ) ) { + System.out.println( entry4.getSequenceName() ); + return false; + } + if ( !entry4.getTaxonomyIdentifier().equals( "9606" ) ) { + System.out.println( entry4.getTaxonomyIdentifier() ); + return false; + } + if ( !entry4.getGeneName().equals( "ras" ) ) { + System.out.println( entry4.getGeneName() ); + return false; + } + // if ( !entry4.getChromosome().equals( "ras" ) ) { + // System.out.println( entry4.getChromosome() ); + // return false; + // } + // if ( !entry4.getMap().equals( "ras" ) ) { + // System.out.println( entry4.getMap() ); + // return false; + // } + //TODO FIXME gi... + // + //TODO fails: + // final SequenceDatabaseEntry entry5 = SequenceDbWsTools.obtainEntry( "M30539" ); + // if ( !entry5.getAccession().equals( "HM043801" ) ) { + // return false; + // } + final SequenceDatabaseEntry entry5 = SequenceDbWsTools.obtainEntry( "AAZ45343.1" ); + if ( !entry5.getAccession().equals( "AAZ45343" ) ) { + return false; + } + if ( !entry5.getTaxonomyScientificName().equals( "Dechloromonas aromatica RCB" ) ) { + System.out.println( entry5.getTaxonomyScientificName() ); + return false; + } + if ( !entry5.getSequenceName().equals( "Dechloromonas aromatica RCB 1,4-alpha-glucan branching enzyme" ) ) { + System.out.println( entry5.getSequenceName() ); + return false; + } + if ( !entry5.getTaxonomyIdentifier().equals( "159087" ) ) { + System.out.println( entry5.getTaxonomyIdentifier() ); + return false; + } + } + catch ( final IOException e ) { + System.out.println(); + System.out.println( "the following might be due to absence internet connection:" ); + e.printStackTrace( System.out ); + return true; + } + catch ( final Exception e ) { + e.printStackTrace(); + return false; + } + return true; + } + + private static boolean testExternalNodeRelatedMethods() { + try { + final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance(); + final Phylogeny t1 = factory.create( "((A,B),(C,D))", new NHXParser() )[ 0 ]; + PhylogenyNode n = t1.getNode( "A" ); + n = n.getNextExternalNode(); + if ( !n.getName().equals( "B" ) ) { + return false; + } + n = n.getNextExternalNode(); + if ( !n.getName().equals( "C" ) ) { + return false; + } + n = n.getNextExternalNode(); + if ( !n.getName().equals( "D" ) ) { + return false; + } + n = t1.getNode( "B" ); + while ( !n.isLastExternalNode() ) { + n = n.getNextExternalNode(); + } + final Phylogeny t2 = factory.create( "(((A,B),C),D)", new NHXParser() )[ 0 ]; + n = t2.getNode( "A" ); + n = n.getNextExternalNode(); + if ( !n.getName().equals( "B" ) ) { + return false; + } + n = n.getNextExternalNode(); + if ( !n.getName().equals( "C" ) ) { + return false; + } + n = n.getNextExternalNode(); + if ( !n.getName().equals( "D" ) ) { + return false; + } + n = t2.getNode( "B" ); + while ( !n.isLastExternalNode() ) { + n = n.getNextExternalNode(); + } + final Phylogeny t3 = factory.create( "(((A,B),(C,D)),((E,F),(G,H)))", new NHXParser() )[ 0 ]; + n = t3.getNode( "A" ); + n = n.getNextExternalNode(); + if ( !n.getName().equals( "B" ) ) { + return false; + } + n = n.getNextExternalNode(); + if ( !n.getName().equals( "C" ) ) { + return false; + } + n = n.getNextExternalNode(); + if ( !n.getName().equals( "D" ) ) { + return false; + } + n = n.getNextExternalNode(); + if ( !n.getName().equals( "E" ) ) { + return false; + } + n = n.getNextExternalNode(); + if ( !n.getName().equals( "F" ) ) { + return false; + } + n = n.getNextExternalNode(); + if ( !n.getName().equals( "G" ) ) { + return false; + } + n = n.getNextExternalNode(); + if ( !n.getName().equals( "H" ) ) { + return false; + } + n = t3.getNode( "B" ); + while ( !n.isLastExternalNode() ) { + n = n.getNextExternalNode(); + } + final Phylogeny t4 = factory.create( "((A,B),(C,D))", new NHXParser() )[ 0 ]; + for( final PhylogenyNodeIterator iter = t4.iteratorExternalForward(); iter.hasNext(); ) { + final PhylogenyNode node = iter.next(); + } + final Phylogeny t5 = factory.create( "(((A,B),(C,D)),((E,F),(G,H)))", new NHXParser() )[ 0 ]; + for( final PhylogenyNodeIterator iter = t5.iteratorExternalForward(); iter.hasNext(); ) { + final PhylogenyNode node = iter.next(); + } + final Phylogeny t6 = factory.create( "((((((A))),(((B))),((C)),((((D)))),E)),((F)))", new NHXParser() )[ 0 ]; + final PhylogenyNodeIterator iter = t6.iteratorExternalForward(); + if ( !iter.next().getName().equals( "A" ) ) { + return false; + } + if ( !iter.next().getName().equals( "B" ) ) { + return false; + } + if ( !iter.next().getName().equals( "C" ) ) { + return false; + } + if ( !iter.next().getName().equals( "D" ) ) { + return false; + } + if ( !iter.next().getName().equals( "E" ) ) { + return false; + } + if ( !iter.next().getName().equals( "F" ) ) { + return false; + } + if ( iter.hasNext() ) { + return false; + } + } + catch ( final Exception e ) { + e.printStackTrace( System.out ); + return false; + } + return true; + } + + private static boolean testExtractSNFromNodeName() { + try { + if ( !ParserUtils.extractScientificNameFromNodeName( "BCDO2_Mus_musculus" ).equals( "Mus musculus" ) ) { + return false; + } + if ( !ParserUtils.extractScientificNameFromNodeName( "BCDO2 Mus musculus" ).equals( "Mus musculus" ) ) { + return false; + } + if ( !ParserUtils.extractScientificNameFromNodeName( "Mus_musculus_BCDO2" ).equals( "Mus musculus" ) ) { + return false; + } + if ( !ParserUtils.extractScientificNameFromNodeName( "Mus musculus musculus BCDO2" ) + .equals( "Mus musculus musculus" ) ) { + return false; + } + if ( !ParserUtils.extractScientificNameFromNodeName( "Mus_musculus_musculus_BCDO2" ) + .equals( "Mus musculus musculus" ) ) { + return false; + } + if ( !ParserUtils.extractScientificNameFromNodeName( "BCDO2 Mus musculus musculus" ) + .equals( "Mus musculus musculus" ) ) { + return false; + } + if ( !ParserUtils.extractScientificNameFromNodeName( "Bcl Mus musculus musculus" ) + .equals( "Mus musculus musculus" ) ) { + return false; + } + if ( ParserUtils.extractScientificNameFromNodeName( "vcl Mus musculus musculus" ) != null ) { + return false; + } + if ( !ParserUtils.extractScientificNameFromNodeName( "could_be_anything_Mus_musculus_musculus_BCDO2" ) + .equals( "Mus musculus musculus" ) ) { + return false; + } + if ( !ParserUtils.extractScientificNameFromNodeName( "could_be_anything_Mus_musculus_musculus_Musculus" ) + .equals( "Mus musculus musculus" ) ) { + return false; + } + if ( ParserUtils.extractScientificNameFromNodeName( "could_be_anything_Mus_musculus_musculus_musculus" ) != null ) { + return false; + } + if ( ParserUtils.extractScientificNameFromNodeName( "musculus" ) != null ) { + return false; + } + if ( ParserUtils.extractScientificNameFromNodeName( "mus_musculus" ) != null ) { + return false; + } + if ( ParserUtils.extractScientificNameFromNodeName( "mus_musculus_musculus" ) != null ) { + return false; + } + if ( !ParserUtils.extractScientificNameFromNodeName( "Mus_musculus_musculus_1" ) + .equals( "Mus musculus musculus" ) ) { + return false; + } + if ( !ParserUtils.extractScientificNameFromNodeName( "Mus_musculus_1" ).equals( "Mus musculus" ) ) { + return false; + } + if ( ParserUtils.extractScientificNameFromNodeName( "Mus_musculus_bcl" ) != null ) { + return false; + } + if ( !ParserUtils.extractScientificNameFromNodeName( "Mus_musculus_BCL" ).equals( "Mus musculus" ) ) { + return false; + } + if ( ParserUtils.extractScientificNameFromNodeName( "Mus musculus bcl" ) != null ) { return false; } - if ( !entry2.getGeneName().equals( "RBM39" ) ) { - System.out.println( entry2.getGeneName() ); + if ( !ParserUtils.extractScientificNameFromNodeName( "Mus musculus BCL" ).equals( "Mus musculus" ) ) { return false; } - if ( entry2.getCrossReferences().size() != 3 ) { + if ( !ParserUtils.extractScientificNameFromNodeName( "Mus musculus xBCL" ).equals( "Mus musculus" ) ) { return false; } - // - final SequenceDatabaseEntry entry3 = SequenceDbWsTools.obtainEntry( "HM043801" ); - if ( !entry3.getAccession().equals( "HM043801" ) ) { + if ( !ParserUtils.extractScientificNameFromNodeName( "Mus musculus x1" ).equals( "Mus musculus" ) ) { return false; } - if ( !entry3.getTaxonomyScientificName().equals( "Bursaphelenchus xylophilus" ) ) { - System.out.println( entry3.getTaxonomyScientificName() ); + if ( !ParserUtils.extractScientificNameFromNodeName( " -XS12_Mus_musculus_12" ).equals( "Mus musculus" ) ) { return false; } - if ( !entry3.getSequenceName().equals( "Bursaphelenchus xylophilus RAF gene, complete cds" ) ) { - System.out.println( entry3.getSequenceName() ); + if ( !ParserUtils.extractScientificNameFromNodeName( " -1234_Mus_musculus_12 affrre e" ) + .equals( "Mus musculus" ) ) { return false; } - if ( !entry3.getTaxonomyIdentifier().equals( "6326" ) ) { - System.out.println( entry3.getTaxonomyIdentifier() ); + if ( !ParserUtils.extractScientificNameFromNodeName( " -1234_Mus_musculus_12_affrre_e" ) + .equals( "Mus musculus" ) ) { return false; } - if ( !entry3.getSequenceSymbol().equals( "RAF" ) ) { - System.out.println( entry3.getSequenceSymbol() ); + if ( !ParserUtils.extractScientificNameFromNodeName( "Mus_musculus" ).equals( "Mus musculus" ) ) { return false; } - if ( !ForesterUtil.isEmpty( entry3.getGeneName() ) ) { + if ( !ParserUtils.extractScientificNameFromNodeName( "Mus_musculus_musculus_2bcl2" ) + .equals( "Mus musculus musculus" ) ) { return false; } - if ( entry3.getCrossReferences().size() != 8 ) { + if ( !ParserUtils.extractScientificNameFromNodeName( "Mus_musculus_musculus_2bcl2" ) + .equals( "Mus musculus musculus" ) ) { return false; } - // - // - final SequenceDatabaseEntry entry4 = SequenceDbWsTools.obtainEntry( "AAA36557.1" ); - if ( !entry4.getAccession().equals( "AAA36557" ) ) { + if ( !ParserUtils.extractScientificNameFromNodeName( "Mus_musculus_musculus_bcl2" ) + .equals( "Mus musculus musculus" ) ) { return false; } - if ( !entry4.getTaxonomyScientificName().equals( "Homo sapiens" ) ) { - System.out.println( entry4.getTaxonomyScientificName() ); + if ( !ParserUtils.extractScientificNameFromNodeName( "Mus_musculus_123" ).equals( "Mus musculus" ) ) { return false; } - if ( !entry4.getSequenceName().equals( "Homo sapiens (human) ras protein" ) ) { - System.out.println( entry4.getSequenceName() ); + if ( !ParserUtils.extractScientificNameFromNodeName( "Pilostyles mexicana Mexico Breedlove 27233" ) + .equals( "Pilostyles mexicana" ) ) { return false; } - if ( !entry4.getTaxonomyIdentifier().equals( "9606" ) ) { - System.out.println( entry4.getTaxonomyIdentifier() ); + if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia_coli_strain_K12/DH10B" ) + .equals( "Escherichia coli strain K12/DH10B" ) ) { return false; } - if ( !entry4.getGeneName().equals( "ras" ) ) { - System.out.println( entry4.getGeneName() ); + if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia_coli_str_K12/DH10B" ) + .equals( "Escherichia coli str. K12/DH10B" ) ) { return false; } - // if ( !entry4.getChromosome().equals( "ras" ) ) { - // System.out.println( entry4.getChromosome() ); - // return false; - // } - // if ( !entry4.getMap().equals( "ras" ) ) { - // System.out.println( entry4.getMap() ); - // return false; - // } - //TODO FIXME gi... - // - //TODO fails: - // final SequenceDatabaseEntry entry5 = SequenceDbWsTools.obtainEntry( "M30539" ); - // if ( !entry5.getAccession().equals( "HM043801" ) ) { - // return false; - // } - final SequenceDatabaseEntry entry5 = SequenceDbWsTools.obtainEntry( "AAZ45343.1" ); - if ( !entry5.getAccession().equals( "AAZ45343" ) ) { + if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia coli str. K12/DH10B" ) + .equals( "Escherichia coli str. K12/DH10B" ) ) { return false; } - if ( !entry5.getTaxonomyScientificName().equals( "Dechloromonas aromatica RCB" ) ) { - System.out.println( entry5.getTaxonomyScientificName() ); + if ( !ParserUtils.extractScientificNameFromNodeName( "Arabidopsis_lyrata_subsp_lyrata" ) + .equals( "Arabidopsis lyrata subsp. lyrata" ) ) { return false; } - if ( !entry5.getSequenceName().equals( "Dechloromonas aromatica RCB 1,4-alpha-glucan branching enzyme" ) ) { - System.out.println( entry5.getSequenceName() ); + if ( !ParserUtils.extractScientificNameFromNodeName( "Arabidopsis lyrata subsp. lyrata" ) + .equals( "Arabidopsis lyrata subsp. lyrata" ) ) { return false; } - if ( !entry5.getTaxonomyIdentifier().equals( "159087" ) ) { - System.out.println( entry5.getTaxonomyIdentifier() ); + if ( !ParserUtils.extractScientificNameFromNodeName( "Arabidopsis lyrata subsp. lyrata 395" ) + .equals( "Arabidopsis lyrata subsp. lyrata" ) ) { return false; } - } - catch ( final IOException e ) { - System.out.println(); - System.out.println( "the following might be due to absence internet connection:" ); - e.printStackTrace( System.out ); - return true; - } - catch ( final Exception e ) { - e.printStackTrace(); - return false; - } - return true; - } - - private static boolean testExternalNodeRelatedMethods() { - try { - final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance(); - final Phylogeny t1 = factory.create( "((A,B),(C,D))", new NHXParser() )[ 0 ]; - PhylogenyNode n = t1.getNode( "A" ); - n = n.getNextExternalNode(); - if ( !n.getName().equals( "B" ) ) { + if ( !ParserUtils.extractScientificNameFromNodeName( "Arabidopsis lyrata subsp. lyrata bcl2" ) + .equals( "Arabidopsis lyrata subsp. lyrata" ) ) { return false; } - n = n.getNextExternalNode(); - if ( !n.getName().equals( "C" ) ) { + if ( !ParserUtils.extractScientificNameFromNodeName( "Arabidopsis lyrata subsp lyrata bcl2" ) + .equals( "Arabidopsis lyrata subsp. lyrata" ) ) { return false; } - n = n.getNextExternalNode(); - if ( !n.getName().equals( "D" ) ) { + if ( !ParserUtils.extractScientificNameFromNodeName( "Arabidopsis lyrata subspecies lyrata bcl2" ) + .equals( "Arabidopsis lyrata subspecies lyrata" ) ) { return false; } - n = t1.getNode( "B" ); - while ( !n.isLastExternalNode() ) { - n = n.getNextExternalNode(); + if ( !ParserUtils.extractScientificNameFromNodeName( "Verbascum sinuatum var. adenosepalum bcl2" ) + .equals( "Verbascum sinuatum var. adenosepalum" ) ) { + return false; } - final Phylogeny t2 = factory.create( "(((A,B),C),D)", new NHXParser() )[ 0 ]; - n = t2.getNode( "A" ); - n = n.getNextExternalNode(); - if ( !n.getName().equals( "B" ) ) { + if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia coli (strain K12)" ) + .equals( "Escherichia coli (strain K12)" ) ) { return false; } - n = n.getNextExternalNode(); - if ( !n.getName().equals( "C" ) ) { + if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia coli (strain K12) bcl2" ) + .equals( "Escherichia coli (strain K12)" ) ) { return false; } - n = n.getNextExternalNode(); - if ( !n.getName().equals( "D" ) ) { + if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia coli (str. K12)" ) + .equals( "Escherichia coli (str. K12)" ) ) { return false; } - n = t2.getNode( "B" ); - while ( !n.isLastExternalNode() ) { - n = n.getNextExternalNode(); + if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia coli (str K12)" ) + .equals( "Escherichia coli (str. K12)" ) ) { + return false; } - final Phylogeny t3 = factory.create( "(((A,B),(C,D)),((E,F),(G,H)))", new NHXParser() )[ 0 ]; - n = t3.getNode( "A" ); - n = n.getNextExternalNode(); - if ( !n.getName().equals( "B" ) ) { + if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia coli (str. K12) bcl2" ) + .equals( "Escherichia coli (str. K12)" ) ) { return false; } - n = n.getNextExternalNode(); - if ( !n.getName().equals( "C" ) ) { + if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia coli (var K12) bcl2" ) + .equals( "Escherichia coli (var. K12)" ) ) { return false; } - n = n.getNextExternalNode(); - if ( !n.getName().equals( "D" ) ) { + if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia coli str. K-12 substr. MG1655star" ) + .equals( "Escherichia coli str. K-12 substr. MG1655star" ) ) { return false; } - n = n.getNextExternalNode(); - if ( !n.getName().equals( "E" ) ) { + if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia coli str K-12 substr MG1655star" ) + .equals( "Escherichia coli str. K-12 substr. MG1655star" ) ) { return false; } - n = n.getNextExternalNode(); - if ( !n.getName().equals( "F" ) ) { + if ( !ParserUtils + .extractScientificNameFromNodeName( "could be anything Escherichia coli str K-12 substr MG1655star" ) + .equals( "Escherichia coli str. K-12 substr. MG1655star" ) ) { return false; } - n = n.getNextExternalNode(); - if ( !n.getName().equals( "G" ) ) { + if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia coli str K-12 substr MG1655star gene1" ) + .equals( "Escherichia coli str. K-12 substr. MG1655star" ) ) { return false; } - n = n.getNextExternalNode(); - if ( !n.getName().equals( "H" ) ) { + if ( !ParserUtils + .extractScientificNameFromNodeName( "could be anything Escherichia coli str K-12 substr MG1655star GENE1" ) + .equals( "Escherichia coli str. K-12 substr. MG1655star" ) ) { return false; } - n = t3.getNode( "B" ); - while ( !n.isLastExternalNode() ) { - n = n.getNextExternalNode(); + if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia_coli_str_K-12_substr_MG1655star" ) + .equals( "Escherichia coli str. K-12 substr. MG1655star" ) ) { + return false; } - final Phylogeny t4 = factory.create( "((A,B),(C,D))", new NHXParser() )[ 0 ]; - for( final PhylogenyNodeIterator iter = t4.iteratorExternalForward(); iter.hasNext(); ) { - final PhylogenyNode node = iter.next(); + if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia_coli_str_K-12_substr_MG1655star" ) + .equals( "Escherichia coli str. K-12 substr. MG1655star" ) ) { + return false; } - final Phylogeny t5 = factory.create( "(((A,B),(C,D)),((E,F),(G,H)))", new NHXParser() )[ 0 ]; - for( final PhylogenyNodeIterator iter = t5.iteratorExternalForward(); iter.hasNext(); ) { - final PhylogenyNode node = iter.next(); + if ( !ParserUtils.extractScientificNameFromNodeName( "Macrocera sp." ).equals( "Macrocera sp." ) ) { + return false; } - final Phylogeny t6 = factory.create( "((((((A))),(((B))),((C)),((((D)))),E)),((F)))", new NHXParser() )[ 0 ]; - final PhylogenyNodeIterator iter = t6.iteratorExternalForward(); - if ( !iter.next().getName().equals( "A" ) ) { + if ( !ParserUtils.extractScientificNameFromNodeName( "Macrocera sp. 123" ).equals( "Macrocera sp." ) ) { return false; } - if ( !iter.next().getName().equals( "B" ) ) { + if ( !ParserUtils.extractScientificNameFromNodeName( "Macrocera sp. K12" ).equals( "Macrocera sp." ) ) { return false; } - if ( !iter.next().getName().equals( "C" ) ) { + if ( !ParserUtils.extractScientificNameFromNodeName( "something Macrocera sp. K12" ) + .equals( "Macrocera sp." ) ) { return false; } - if ( !iter.next().getName().equals( "D" ) ) { + if ( !ParserUtils.extractScientificNameFromNodeName( "Macrocera sp" ).equals( "Macrocera sp." ) ) { return false; } - if ( !iter.next().getName().equals( "E" ) ) { + if ( !ParserUtils.extractScientificNameFromNodeName( "Sesamum rigidum ssp merenskyanum 07 48" ) + .equals( "Sesamum rigidum subsp. merenskyanum" ) ) { return false; } - if ( !iter.next().getName().equals( "F" ) ) { + if ( !ParserUtils.extractScientificNameFromNodeName( "Sesamum rigidum ssp. merenskyanum" ) + .equals( "Sesamum rigidum subsp. merenskyanum" ) ) { return false; } - if ( iter.hasNext() ) { + if ( !ParserUtils.extractScientificNameFromNodeName( "Sesamum rigidum (ssp. merenskyanum)" ) + .equals( "Sesamum rigidum (subsp. merenskyanum)" ) ) { + return false; + } + if ( !ParserUtils.extractScientificNameFromNodeName( "Sesamum rigidum (ssp merenskyanum)" ) + .equals( "Sesamum rigidum (subsp. merenskyanum)" ) ) { return false; } } @@ -4054,24 +4527,34 @@ public final class Test { return true; } - private static boolean testExtractSNFromNodeName() { + private static boolean testExtractTaxonomyDataFromNodeName() { try { - if ( !ParserUtils.extractScientificNameFromNodeName( "BCDO2_Mus_musculus" ).equals( "Mus musculus" ) ) { + PhylogenyNode n = new PhylogenyNode( "tr|B1AM49|B1AM49_HUMAN" ); + if ( !ParserUtils.extractTaxonomyDataFromNodeName( n, TAXONOMY_EXTRACTION.AGGRESSIVE ).equals( "HUMAN" ) ) { return false; } - if ( !ParserUtils.extractScientificNameFromNodeName( "BCDO2_Mus_musculus_musculus" ) - .equals( "Mus musculus musculus" ) ) { + n = new PhylogenyNode( "tr|B1AM49|B1AM49_HUMAN~1-2" ); + if ( !ParserUtils.extractTaxonomyDataFromNodeName( n, TAXONOMY_EXTRACTION.AGGRESSIVE ).equals( "HUMAN" ) ) { return false; } - if ( !ParserUtils.extractScientificNameFromNodeName( "BCDO2_Mus_musculus_musculus-12" ) - .equals( "Mus musculus musculus" ) ) { + n = new PhylogenyNode( "tr|B1AM49|HNRPR_HUMAN" ); + if ( !ParserUtils.extractTaxonomyDataFromNodeName( n, TAXONOMY_EXTRACTION.AGGRESSIVE ).equals( "HUMAN" ) ) { return false; } - if ( !ParserUtils.extractScientificNameFromNodeName( " -XS12_Mus_musculus-12" ).equals( "Mus musculus" ) ) { + n = new PhylogenyNode( "tr|B1AM49|HNRPR_HUMAN|" ); + if ( !ParserUtils.extractTaxonomyDataFromNodeName( n, TAXONOMY_EXTRACTION.AGGRESSIVE ).equals( "HUMAN" ) ) { return false; } - if ( !ParserUtils.extractScientificNameFromNodeName( " -1234_Mus_musculus-12 affrre e" ) - .equals( "Mus musculus" ) ) { + n = new PhylogenyNode( "tr|B1AM49|HNRPR_HUMAN~12" ); + if ( !ParserUtils.extractTaxonomyDataFromNodeName( n, TAXONOMY_EXTRACTION.AGGRESSIVE ).equals( "HUMAN" ) ) { + return false; + } + n = new PhylogenyNode( "HNRPR_HUMAN" ); + if ( !ParserUtils.extractTaxonomyDataFromNodeName( n, TAXONOMY_EXTRACTION.AGGRESSIVE ).equals( "HUMAN" ) ) { + return false; + } + n = new PhylogenyNode( "HNRPR_HUMAN_X" ); + if ( !ParserUtils.extractTaxonomyDataFromNodeName( n, TAXONOMY_EXTRACTION.AGGRESSIVE ).equals( "HUMAN" ) ) { return false; } } @@ -4157,17 +4640,17 @@ public final class Test { } if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "BCL2_MOUSE function = 23445", TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ) - .equals( "MOUSE" ) ) { + .equals( "MOUSE" ) ) { return false; } if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "BCL2_MOUSE+function = 23445", TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ) - .equals( "MOUSE" ) ) { + .equals( "MOUSE" ) ) { return false; } if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "BCL2_MOUSE|function = 23445", TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ) - .equals( "MOUSE" ) ) { + .equals( "MOUSE" ) ) { return false; } if ( ParserUtils.extractTaxonomyCodeFromNodeName( "BCL2_MOUSEfunction = 23445", @@ -4418,7 +4901,7 @@ public final class Test { if ( !msa_0.getSequenceAsString( 1 ).toString().equalsIgnoreCase( "DKXASDFXSFXFKFKSXDFKSLX" ) ) { return false; } - if ( !msa_0.getSequenceAsString( 2 ).toString().equalsIgnoreCase( "SXDFKSXLFSFPWEXPRXWXERR" ) ) { + if ( !msa_0.getSequenceAsString( 2 ).toString().equalsIgnoreCase( "SXDFKSXLFSFPWEXPROWXERR" ) ) { return false; } if ( !msa_0.getSequenceAsString( 3 ).toString().equalsIgnoreCase( "AAAAAAAAAAAAAAAAAAAAAAA" ) ) { @@ -5338,10 +5821,10 @@ public final class Test { final String test_dir = Test.PATH_TO_TEST_DATA; try { final HmmscanPerDomainTableParser parser1 = new HmmscanPerDomainTableParser( new File( test_dir - + ForesterUtil.getFileSeparator() + "hmmscan30b3_output_1" ), "MONBR", INDIVIDUAL_SCORE_CUTOFF.NONE ); + + ForesterUtil.getFileSeparator() + "hmmscan30b3_output_1" ), "MONBR", INDIVIDUAL_SCORE_CUTOFF.NONE ); parser1.parse(); final HmmscanPerDomainTableParser parser2 = new HmmscanPerDomainTableParser( new File( test_dir - + ForesterUtil.getFileSeparator() + "hmmscan30b3_output_2" ), "MONBR", INDIVIDUAL_SCORE_CUTOFF.NONE ); + + ForesterUtil.getFileSeparator() + "hmmscan30b3_output_2" ), "MONBR", INDIVIDUAL_SCORE_CUTOFF.NONE ); final List proteins = parser2.parse(); if ( parser2.getProteinsEncountered() != 4 ) { return false; @@ -5672,60 +6155,292 @@ public final class Test { if ( !isEqual( t1.getNode( "CD" ).getDistanceToParent(), 1 ) ) { return false; } - if ( !isEqual( t1.getNode( "AB" ).getDistanceToParent(), 3 ) ) { + if ( !isEqual( t1.getNode( "AB" ).getDistanceToParent(), 3 ) ) { + return false; + } + t1.reRoot( t1.getNode( "A" ) ); + PhylogenyMethods.midpointRoot( t1 ); + if ( !isEqual( t1.getNode( "A" ).getDistanceToParent(), 1 ) ) { + return false; + } + if ( !isEqual( t1.getNode( "B" ).getDistanceToParent(), 2 ) ) { + return false; + } + if ( !isEqual( t1.getNode( "C" ).getDistanceToParent(), 3 ) ) { + return false; + } + if ( !isEqual( t1.getNode( "D" ).getDistanceToParent(), 4 ) ) { + return false; + } + if ( !isEqual( t1.getNode( "CD" ).getDistanceToParent(), 1 ) ) { + System.exit( -1 ); + return false; + } + if ( !isEqual( t1.getNode( "AB" ).getDistanceToParent(), 3 ) ) { + return false; + } + } + catch ( final Exception e ) { + e.printStackTrace( System.out ); + return false; + } + return true; + } + + private static boolean testMsaQualityMethod() { + try { + final MolecularSequence s0 = BasicSequence.createAaSequence( "a", "ABAXEFGHIJJE-" ); + final MolecularSequence s1 = BasicSequence.createAaSequence( "b", "ABBXEFGHIJJBB" ); + final MolecularSequence s2 = BasicSequence.createAaSequence( "c", "AXCXEFGHIJJ--" ); + final MolecularSequence s3 = BasicSequence.createAaSequence( "d", "AXDDEFGHIJ---" ); + final List l = new ArrayList(); + l.add( s0 ); + l.add( s1 ); + l.add( s2 ); + l.add( s3 ); + final Msa msa = BasicMsa.createInstance( l ); + if ( !isEqual( 1, MsaMethods.calculateIdentityRatio( msa, 0 ) ) ) { + return false; + } + if ( !isEqual( 0.5, MsaMethods.calculateIdentityRatio( msa, 1 ) ) ) { + return false; + } + if ( !isEqual( 0.25, MsaMethods.calculateIdentityRatio( msa, 2 ) ) ) { + return false; + } + if ( !isEqual( 0.75, MsaMethods.calculateIdentityRatio( msa, 3 ) ) ) { + return false; + } + if ( !isEqual( 0.75, MsaMethods.calculateIdentityRatio( msa, 10 ) ) ) { + return false; + } + if ( !isEqual( 0.25, MsaMethods.calculateIdentityRatio( msa, 11 ) ) ) { + return false; + } + if ( !isEqual( 0.25, MsaMethods.calculateIdentityRatio( msa, 12 ) ) ) { + return false; + } + } + catch ( final Exception e ) { + e.printStackTrace( System.out ); + return false; + } + return true; + } + + private static boolean testMsaEntropy() { + try { + final MolecularSequence s0 = BasicSequence.createAaSequence( "a", "AAAAAAA" ); + final MolecularSequence s1 = BasicSequence.createAaSequence( "b", "AAAIACC" ); + final MolecularSequence s2 = BasicSequence.createAaSequence( "c", "AAIIIIF" ); + final MolecularSequence s3 = BasicSequence.createAaSequence( "d", "AIIIVVW" ); + final List l = new ArrayList(); + l.add( s0 ); + l.add( s1 ); + l.add( s2 ); + l.add( s3 ); + final Msa msa = BasicMsa.createInstance( l ); + //TODO need to DO the tests!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! + //FIXME + // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa, 0 ) ); + // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa, 1 ) ); + // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa, 2 ) ); + // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa, 3 ) ); + // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa, 4 ) ); + // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa, 5 ) ); + // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa, 6 ) ); + // System.out.println(); + // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 6, msa, 0 ) ); + // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 6, msa, 1 ) ); + // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 6, msa, 2 ) ); + // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 6, msa, 3 ) ); + // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 6, msa, 4 ) ); + // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 6, msa, 5 ) ); + // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 6, msa, 6 ) ); + final List l2 = new ArrayList(); + l2.add( BasicSequence.createAaSequence( "1", "AAAAAAA" ) ); + l2.add( BasicSequence.createAaSequence( "2", "AAAIACC" ) ); + l2.add( BasicSequence.createAaSequence( "3", "AAIIIIF" ) ); + l2.add( BasicSequence.createAaSequence( "4", "AIIIVVW" ) ); + l2.add( BasicSequence.createAaSequence( "5", "AAAAAAA" ) ); + l2.add( BasicSequence.createAaSequence( "6", "AAAIACC" ) ); + l2.add( BasicSequence.createAaSequence( "7", "AAIIIIF" ) ); + l2.add( BasicSequence.createAaSequence( "8", "AIIIVVW" ) ); + l2.add( BasicSequence.createAaSequence( "9", "AAAAAAA" ) ); + l2.add( BasicSequence.createAaSequence( "10", "AAAIACC" ) ); + l2.add( BasicSequence.createAaSequence( "11", "AAIIIIF" ) ); + l2.add( BasicSequence.createAaSequence( "12", "AIIIVVW" ) ); + l2.add( BasicSequence.createAaSequence( "13", "AAIIIIF" ) ); + l2.add( BasicSequence.createAaSequence( "14", "AIIIVVW" ) ); + l2.add( BasicSequence.createAaSequence( "15", "AAAAAAA" ) ); + l2.add( BasicSequence.createAaSequence( "16", "AAAIACC" ) ); + l2.add( BasicSequence.createAaSequence( "17", "AAIIIIF" ) ); + l2.add( BasicSequence.createAaSequence( "18", "AIIIVVW" ) ); + l2.add( BasicSequence.createAaSequence( "19", "AAAAAAA" ) ); + l2.add( BasicSequence.createAaSequence( "20", "AAAIACC" ) ); + l2.add( BasicSequence.createAaSequence( "21", "AAIIIIF" ) ); + l2.add( BasicSequence.createAaSequence( "22", "AIIIVVW" ) ); + final Msa msa2 = BasicMsa.createInstance( l2 ); + // System.out.println(); + // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa2, 0 ) ); + // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa2, 1 ) ); + // System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa2, 2 ) ); + } + catch ( final Exception e ) { + e.printStackTrace( System.out ); + return false; + } + return true; + } + + private static boolean testDeleteableMsa() { + try { + final MolecularSequence s0 = BasicSequence.createAaSequence( "a", "AAAA" ); + final MolecularSequence s1 = BasicSequence.createAaSequence( "b", "BAAA" ); + final MolecularSequence s2 = BasicSequence.createAaSequence( "c", "CAAA" ); + final MolecularSequence s3 = BasicSequence.createAaSequence( "d", "DAAA" ); + final MolecularSequence s4 = BasicSequence.createAaSequence( "e", "EAAA" ); + final MolecularSequence s5 = BasicSequence.createAaSequence( "f", "FAAA" ); + final List l0 = new ArrayList(); + l0.add( s0 ); + l0.add( s1 ); + l0.add( s2 ); + l0.add( s3 ); + l0.add( s4 ); + l0.add( s5 ); + final DeleteableMsa dmsa0 = DeleteableMsa.createInstance( l0 ); + dmsa0.deleteRow( "b", false ); + if ( !dmsa0.getIdentifier( 1 ).equals( "c" ) ) { + return false; + } + dmsa0.deleteRow( "e", false ); + dmsa0.deleteRow( "a", false ); + dmsa0.deleteRow( "f", false ); + if ( dmsa0.getLength() != 4 ) { + return false; + } + if ( dmsa0.getNumberOfSequences() != 2 ) { + return false; + } + if ( !dmsa0.getIdentifier( 0 ).equals( "c" ) ) { + return false; + } + if ( !dmsa0.getIdentifier( 1 ).equals( "d" ) ) { + return false; + } + if ( dmsa0.getResidueAt( 0, 0 ) != 'C' ) { + return false; + } + if ( !dmsa0.getSequenceAsString( 0 ).toString().equals( "CAAA" ) ) { + return false; + } + if ( dmsa0.getColumnAt( 0 ).size() != 2 ) { + return false; + } + dmsa0.deleteRow( "c", false ); + dmsa0.deleteRow( "d", false ); + if ( dmsa0.getNumberOfSequences() != 0 ) { + return false; + } + // + final MolecularSequence s_0 = BasicSequence.createAaSequence( "a", "--A---B-C--X----" ); + final MolecularSequence s_1 = BasicSequence.createAaSequence( "b", "--B-----C-------" ); + final MolecularSequence s_2 = BasicSequence.createAaSequence( "c", "--C--AB-C------Z" ); + final MolecularSequence s_3 = BasicSequence.createAaSequence( "d", "--D--AA-C-------" ); + final MolecularSequence s_4 = BasicSequence.createAaSequence( "e", "--E--AA-C-------" ); + final MolecularSequence s_5 = BasicSequence.createAaSequence( "f", "--F--AB-CD--Y---" ); + final List l1 = new ArrayList(); + l1.add( s_0 ); + l1.add( s_1 ); + l1.add( s_2 ); + l1.add( s_3 ); + l1.add( s_4 ); + l1.add( s_5 ); + final DeleteableMsa dmsa1 = DeleteableMsa.createInstance( l1 ); + dmsa1.deleteGapOnlyColumns(); + dmsa1.deleteRow( "a", false ); + dmsa1.deleteRow( "f", false ); + dmsa1.deleteRow( "d", false ); + dmsa1.deleteGapOnlyColumns(); + if ( !dmsa1.getSequenceAsString( 0 ).toString().equals( "B--C-" ) ) { + return false; + } + if ( !dmsa1.getSequenceAsString( 1 ).toString().equals( "CABCZ" ) ) { + return false; + } + if ( !dmsa1.getSequenceAsString( 2 ).toString().equals( "EAAC-" ) ) { + return false; + } + dmsa1.deleteRow( "c", false ); + dmsa1.deleteGapOnlyColumns(); + final Writer w0 = new StringWriter(); + dmsa1.write( w0, MSA_FORMAT.FASTA ); + final Writer w1 = new StringWriter(); + dmsa1.write( w1, MSA_FORMAT.PHYLIP ); + if ( !dmsa1.getSequenceAsString( 0 ).toString().equals( "B--C" ) ) { return false; } - t1.reRoot( t1.getNode( "A" ) ); - PhylogenyMethods.midpointRoot( t1 ); - if ( !isEqual( t1.getNode( "A" ).getDistanceToParent(), 1 ) ) { + if ( !dmsa1.getSequenceAsString( 1 ).toString().equals( "EAAC" ) ) { return false; } - if ( !isEqual( t1.getNode( "B" ).getDistanceToParent(), 2 ) ) { + final MolecularSequence s__0 = BasicSequence.createAaSequence( "a", "A------" ); + final MolecularSequence s__1 = BasicSequence.createAaSequence( "b", "BB-----" ); + final MolecularSequence s__2 = BasicSequence.createAaSequence( "c", "CCC----" ); + final MolecularSequence s__3 = BasicSequence.createAaSequence( "d", "DDDD---" ); + final MolecularSequence s__4 = BasicSequence.createAaSequence( "e", "EEEEE--" ); + final MolecularSequence s__5 = BasicSequence.createAaSequence( "f", "FFFFFF-" ); + final List l2 = new ArrayList(); + l2.add( s__0 ); + l2.add( s__1 ); + l2.add( s__2 ); + l2.add( s__3 ); + l2.add( s__4 ); + l2.add( s__5 ); + final DeleteableMsa dmsa2 = DeleteableMsa.createInstance( l2 ); + dmsa2.deleteGapColumns( 0.5 ); + if ( !dmsa2.getSequenceAsString( 0 ).toString().equals( "A---" ) ) { return false; } - if ( !isEqual( t1.getNode( "C" ).getDistanceToParent(), 3 ) ) { + if ( !dmsa2.getSequenceAsString( 1 ).toString().equals( "BB--" ) ) { return false; } - if ( !isEqual( t1.getNode( "D" ).getDistanceToParent(), 4 ) ) { + if ( !dmsa2.getSequenceAsString( 2 ).toString().equals( "CCC-" ) ) { return false; } - if ( !isEqual( t1.getNode( "CD" ).getDistanceToParent(), 1 ) ) { - System.exit( -1 ); + dmsa2.deleteGapColumns( 0.2 ); + if ( !dmsa2.getSequenceAsString( 0 ).toString().equals( "A-" ) ) { return false; } - if ( !isEqual( t1.getNode( "AB" ).getDistanceToParent(), 3 ) ) { + if ( !dmsa2.getSequenceAsString( 1 ).toString().equals( "BB" ) ) { return false; } - } - catch ( final Exception e ) { - e.printStackTrace( System.out ); - return false; - } - return true; - } - - private static boolean testMsaQualityMethod() { - try { - final Sequence s0 = BasicSequence.createAaSequence( "a", "ABAXEFGHIJ" ); - final Sequence s1 = BasicSequence.createAaSequence( "b", "ABBXEFGHIJ" ); - final Sequence s2 = BasicSequence.createAaSequence( "c", "AXCXEFGHIJ" ); - final Sequence s3 = BasicSequence.createAaSequence( "d", "AXDDEFGHIJ" ); - final List l = new ArrayList(); - l.add( s0 ); - l.add( s1 ); - l.add( s2 ); - l.add( s3 ); - final Msa msa = BasicMsa.createInstance( l ); - if ( !isEqual( 1, MsaMethods.calculateIdentityRatio( msa, 0 ) ) ) { + if ( !dmsa2.getSequenceAsString( 2 ).toString().equals( "CC" ) ) { return false; } - if ( !isEqual( 0.5, MsaMethods.calculateIdentityRatio( msa, 1 ) ) ) { + dmsa2.deleteGapColumns( 0 ); + dmsa2.deleteRow( "a", false ); + dmsa2.deleteRow( "b", false ); + dmsa2.deleteRow( "f", false ); + dmsa2.deleteRow( "e", false ); + dmsa2.setIdentifier( 0, "new_c" ); + dmsa2.setIdentifier( 1, "new_d" ); + dmsa2.setResidueAt( 0, 0, 'x' ); + final MolecularSequence s = dmsa2.deleteRow( "new_d", true ); + if ( !s.getMolecularSequenceAsString().equals( "D" ) ) { return false; } - if ( !isEqual( 0.25, MsaMethods.calculateIdentityRatio( msa, 2 ) ) ) { + final Writer w = new StringWriter(); + dmsa2.write( w, MSA_FORMAT.PHYLIP ); + final String phylip = w.toString(); + if ( !phylip.equals( "1 1" + ForesterUtil.LINE_SEPARATOR + "new_c x" + ForesterUtil.LINE_SEPARATOR ) ) { + System.out.println( phylip ); return false; } - if ( !isEqual( 0.75, MsaMethods.calculateIdentityRatio( msa, 3 ) ) ) { + final Writer w2 = new StringWriter(); + dmsa2.write( w2, MSA_FORMAT.FASTA ); + final String fasta = w2.toString(); + if ( !fasta.equals( ">new_c" + ForesterUtil.LINE_SEPARATOR + "x" + ForesterUtil.LINE_SEPARATOR ) ) { + System.out.println( fasta ); return false; } } @@ -5795,8 +6510,6 @@ public final class Test { if ( !ext.get( 4 ).getName().equals( "h" ) ) { return false; } - // - // ext.clear(); final StringBuffer sb2 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h)gh)fgh)cdefgh)abcdefgh" ); final Phylogeny t2 = factory.create( sb2, new NHXParser() )[ 0 ]; @@ -5825,8 +6538,6 @@ public final class Test { if ( !ext.get( 3 ).getName().equals( "gh" ) ) { return false; } - // - // ext.clear(); final StringBuffer sb3 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h)gh)fgh)cdefgh)abcdefgh" ); final Phylogeny t3 = factory.create( sb3, new NHXParser() )[ 0 ]; @@ -5853,8 +6564,6 @@ public final class Test { if ( !ext.get( 2 ).getName().equals( "fgh" ) ) { return false; } - // - // ext.clear(); final StringBuffer sb4 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h)gh)fgh)cdefgh)abcdefgh" ); final Phylogeny t4 = factory.create( sb4, new NHXParser() )[ 0 ]; @@ -5871,8 +6580,6 @@ public final class Test { if ( n.getNextExternalNodeWhileTakingIntoAccountCollapsedNodes() != null ) { return false; } - // - // final StringBuffer sb5 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h))fgh)cdefgh)abcdefgh" ); final Phylogeny t5 = factory.create( sb5, new NHXParser() )[ 0 ]; ext.clear(); @@ -5908,8 +6615,6 @@ public final class Test { if ( !ext.get( 7 ).getName().equals( "h" ) ) { return false; } - // - // final StringBuffer sb6 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h))fgh)cdefgh)abcdefgh" ); final Phylogeny t6 = factory.create( sb6, new NHXParser() )[ 0 ]; ext.clear(); @@ -5943,8 +6648,6 @@ public final class Test { if ( !ext.get( 6 ).getName().equals( "h" ) ) { return false; } - // - // final StringBuffer sb7 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h))fgh)cdefgh)abcdefgh" ); final Phylogeny t7 = factory.create( sb7, new NHXParser() )[ 0 ]; ext.clear(); @@ -5978,8 +6681,6 @@ public final class Test { if ( !ext.get( 6 ).getName().equals( "h" ) ) { return false; } - // - // final StringBuffer sb8 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h))fgh)cdefgh)abcdefgh" ); final Phylogeny t8 = factory.create( sb8, new NHXParser() )[ 0 ]; ext.clear(); @@ -6016,8 +6717,6 @@ public final class Test { if ( !ext.get( 6 ).getName().equals( "h" ) ) { return false; } - // - // final StringBuffer sb9 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h)gh)fgh)cdefgh)abcdefgh" ); final Phylogeny t9 = factory.create( sb9, new NHXParser() )[ 0 ]; ext.clear(); @@ -6051,8 +6750,6 @@ public final class Test { if ( !ext.get( 6 ).getName().equals( "gh" ) ) { return false; } - // - // final StringBuffer sb10 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h)gh)fgh)cdefgh)abcdefgh" ); final Phylogeny t10 = factory.create( sb10, new NHXParser() )[ 0 ]; ext.clear(); @@ -6088,8 +6785,6 @@ public final class Test { if ( !ext.get( 6 ).getName().equals( "gh" ) ) { return false; } - // - // final StringBuffer sb11 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h)gh)fgh)cdefgh)abcdefgh" ); final Phylogeny t11 = factory.create( sb11, new NHXParser() )[ 0 ]; ext.clear(); @@ -6121,8 +6816,6 @@ public final class Test { if ( !ext.get( 5 ).getName().equals( "fgh" ) ) { return false; } - // - // final StringBuffer sb12 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h)gh)fgh)cdefgh)abcdefgh" ); final Phylogeny t12 = factory.create( sb12, new NHXParser() )[ 0 ]; ext.clear(); @@ -6157,8 +6850,6 @@ public final class Test { if ( !ext.get( 5 ).getName().equals( "fgh" ) ) { return false; } - // - // final StringBuffer sb13 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h)gh)fgh)cdefgh)abcdefgh" ); final Phylogeny t13 = factory.create( sb13, new NHXParser() )[ 0 ]; ext.clear(); @@ -6189,8 +6880,6 @@ public final class Test { if ( !ext.get( 4 ).getName().equals( "fgh" ) ) { return false; } - // - // final StringBuffer sb14 = new StringBuffer( "((a,b,0)ab,(((c,d)cd,e)cde,(f,(g,h,1,2)gh,0)fgh)cdefgh)abcdefgh" ); final Phylogeny t14 = factory.create( sb14, new NHXParser() )[ 0 ]; ext.clear(); @@ -6221,8 +6910,6 @@ public final class Test { if ( !ext.get( 4 ).getName().equals( "fgh" ) ) { return false; } - // - // final StringBuffer sb15 = new StringBuffer( "((a,b,0)ab,(((c,d)cd,e)cde,x,(f,(g,h,1,2)gh,0)fgh)cdefgh)abcdefgh" ); final Phylogeny t15 = factory.create( sb15, new NHXParser() )[ 0 ]; ext.clear(); @@ -6618,6 +7305,35 @@ public final class Test { if ( phylogenies[ 17 ].getNumberOfExternalNodes() != 10 ) { return false; } + final NexusPhylogeniesParser p2 = new NexusPhylogeniesParser(); + phylogenies = null; + phylogenies = factory.create( Test.PATH_TO_TEST_DATA + "S15613.nex", p2 ); + if ( phylogenies.length != 9 ) { + return false; + } + if ( !isEqual( 0.48039661496919533, phylogenies[ 0 ].getNode( "Diadocidia_spinosula" ) + .getDistanceToParent() ) ) { + return false; + } + if ( !isEqual( 0.3959796191512233, phylogenies[ 0 ].getNode( "Diadocidia_stanfordensis" ) + .getDistanceToParent() ) ) { + return false; + } + if ( !phylogenies[ 0 ].getName().equals( "Family Diadocidiidae MLT (Imported_tree_0)" ) ) { + return false; + } + if ( !phylogenies[ 1 ].getName().equals( "Family Diadocidiidae BAT (con_50_majrule)" ) ) { + return false; + } + if ( !phylogenies[ 2 ].getName().equals( "Family Diadocidiidae BAT (con_50_majrule)" ) ) { + return false; + } + if ( !isEqual( 0.065284, phylogenies[ 7 ].getNode( "Bradysia_amoena" ).getDistanceToParent() ) ) { + return false; + } + if ( !isEqual( 0.065284, phylogenies[ 8 ].getNode( "Bradysia_amoena" ).getDistanceToParent() ) ) { + return false; + } } catch ( final Exception e ) { e.printStackTrace( System.out ); @@ -6650,7 +7366,6 @@ public final class Test { if ( phy != null ) { return false; } - // p.reset(); if ( !p.hasNext() ) { return false; @@ -6672,7 +7387,6 @@ public final class Test { if ( phy != null ) { return false; } - //// p.setSource( Test.PATH_TO_TEST_DATA + "nexus_test_2.nex" ); if ( !p.hasNext() ) { return false; @@ -6694,7 +7408,6 @@ public final class Test { if ( phy != null ) { return false; } - // p.reset(); if ( !p.hasNext() ) { return false; @@ -6716,7 +7429,6 @@ public final class Test { if ( phy != null ) { return false; } - //// p.setSource( Test.PATH_TO_TEST_DATA + "nexus_test_3.nex" ); if ( !p.hasNext() ) { return false; @@ -6763,15 +7475,12 @@ public final class Test { if ( phy != null ) { return false; } - //// + // p.setSource( Test.PATH_TO_TEST_DATA + "nexus_test_4_1.nex" ); - // if ( phylogenies.length != 18 ) { - // return false; - // } - //0 if ( !p.hasNext() ) { return false; } + //0 phy = p.next(); if ( phy == null ) { return false; @@ -6805,6 +7514,7 @@ public final class Test { return false; } if ( phy.getNumberOfExternalNodes() != 3 ) { + System.out.println( phy.toString() ); return false; } if ( !phy.getName().equals( "" ) ) { @@ -7182,6 +7892,82 @@ public final class Test { if ( phy.isRooted() ) { return false; } + // + final NexusPhylogeniesParser p2 = new NexusPhylogeniesParser(); + p2.setSource( Test.PATH_TO_TEST_DATA + "S15613.nex" ); + // 0 + if ( !p2.hasNext() ) { + return false; + } + phy = p2.next(); + if ( !isEqual( 0.48039661496919533, phy.getNode( "Diadocidia_spinosula" ).getDistanceToParent() ) ) { + return false; + } + if ( !isEqual( 0.3959796191512233, phy.getNode( "Diadocidia_stanfordensis" ).getDistanceToParent() ) ) { + return false; + } + // 1 + if ( !p2.hasNext() ) { + return false; + } + phy = p2.next(); + // 2 + if ( !p2.hasNext() ) { + return false; + } + phy = p2.next(); + // 3 + if ( !p2.hasNext() ) { + return false; + } + phy = p2.next(); + // 4 + if ( !p2.hasNext() ) { + return false; + } + phy = p2.next(); + // 5 + if ( !p2.hasNext() ) { + return false; + } + phy = p2.next(); + // 6 + if ( !p2.hasNext() ) { + return false; + } + phy = p2.next(); + // 7 + if ( !p2.hasNext() ) { + return false; + } + phy = p2.next(); + // 8 + if ( !p2.hasNext() ) { + return false; + } + phy = p2.next(); + if ( !isEqual( 0.065284, phy.getNode( "Bradysia_amoena" ).getDistanceToParent() ) ) { + return false; + } + if ( p2.hasNext() ) { + return false; + } + phy = p2.next(); + if ( phy != null ) { + return false; + } + // 0 + p2.reset(); + if ( !p2.hasNext() ) { + return false; + } + phy = p2.next(); + if ( !isEqual( 0.48039661496919533, phy.getNode( "Diadocidia_spinosula" ).getDistanceToParent() ) ) { + return false; + } + if ( !isEqual( 0.3959796191512233, phy.getNode( "Diadocidia_stanfordensis" ).getDistanceToParent() ) ) { + return false; + } } catch ( final Exception e ) { e.printStackTrace( System.out ); @@ -7338,6 +8124,14 @@ public final class Test { .equals( "Aranaeus" ) ) { return false; } + phylogenies = factory.create( Test.PATH_TO_TEST_DATA + "S14117.nex", parser ); + if ( phylogenies.length != 3 ) { + return false; + } + if ( !isEqual( phylogenies[ 2 ].getNode( "Aloysia lycioides 251-76-02169" ).getDistanceToParent(), + 0.00100049 ) ) { + return false; + } } catch ( final Exception e ) { e.printStackTrace( System.out ); @@ -7357,10 +8151,10 @@ public final class Test { nhxp.setTaxonomyExtraction( NHXParser.TAXONOMY_EXTRACTION.NO ); nhxp.setReplaceUnderscores( true ); final Phylogeny uc0 = factory.create( "(A__A_,_B_B)", nhxp )[ 0 ]; - if ( !uc0.getRoot().getChildNode( 0 ).getName().equals( "A A " ) ) { + if ( !uc0.getRoot().getChildNode( 0 ).getName().equals( "A A" ) ) { return false; } - if ( !uc0.getRoot().getChildNode( 1 ).getName().equals( " B B" ) ) { + if ( !uc0.getRoot().getChildNode( 1 ).getName().equals( "B B" ) ) { return false; } final Phylogeny p1b = factory @@ -7383,9 +8177,9 @@ public final class Test { final Phylogeny[] p11 = factory.create( "(A,B11);(C,D11) (E,F11)\t(G,H11)", new NHXParser() ); final Phylogeny[] p12 = factory.create( "(A,B12) (C,D12) (E,F12) (G,H12)", new NHXParser() ); final Phylogeny[] p13 = factory.create( " ; (;A; , ; B ; 1 3 ; \n)\t ( \n ;" - + " C ; ,; D;13;);;;;;;(;E;,;F;13 ;) ; " - + "; ; ( \t\n\r\b; G ;, ;H ;1 3; ) ; ; ;", - new NHXParser() ); + + " C ; ,; D;13;);;;;;;(;E;,;F;13 ;) ; " + + "; ; ( \t\n\r\b; G ;, ;H ;1 3; ) ; ; ;", + new NHXParser() ); if ( !p13[ 0 ].toNewHampshireX().equals( "(';A;',';B;13;')" ) ) { return false; } @@ -7651,14 +8445,14 @@ public final class Test { if ( p50.getNode( "A" ) == null ) { return false; } - if ( !p50.toNewHampshire( false, NH_CONVERSION_SUPPORT_VALUE_STYLE.IN_SQUARE_BRACKETS ) + if ( !p50.toNewHampshire( NH_CONVERSION_SUPPORT_VALUE_STYLE.IN_SQUARE_BRACKETS ) .equals( "((A,B)ab:2.0[88],C);" ) ) { return false; } - if ( !p50.toNewHampshire( false, NH_CONVERSION_SUPPORT_VALUE_STYLE.NONE ).equals( "((A,B)ab:2.0,C);" ) ) { + if ( !p50.toNewHampshire( NH_CONVERSION_SUPPORT_VALUE_STYLE.NONE ).equals( "((A,B)ab:2.0,C);" ) ) { return false; } - if ( !p50.toNewHampshire( false, NH_CONVERSION_SUPPORT_VALUE_STYLE.AS_INTERNAL_NODE_NAMES ) + if ( !p50.toNewHampshire( NH_CONVERSION_SUPPORT_VALUE_STYLE.AS_INTERNAL_NODE_NAMES ) .equals( "((A,B)88:2.0,C);" ) ) { return false; } @@ -7676,13 +8470,63 @@ public final class Test { if ( p53.getNode( "B (x (a' ,b) f(x);" ) == null ) { return false; } - // final Phylogeny p54 = factory.create( new StringBuffer( "((A,B):[88],C)" ), new NHXParser() )[ 0 ]; if ( p54.getNode( "A" ) == null ) { return false; } - if ( !p54.toNewHampshire( false, NH_CONVERSION_SUPPORT_VALUE_STYLE.IN_SQUARE_BRACKETS ) - .equals( "((A,B)[88],C);" ) ) { + if ( !p54.toNewHampshire( NH_CONVERSION_SUPPORT_VALUE_STYLE.IN_SQUARE_BRACKETS ).equals( "((A,B)[88],C);" ) ) { + return false; + } + final Phylogeny p55 = factory + .create( new StringBuffer( "((\"lcl|HPV32_L1.:1 s\":0.195593,\"lcl|HPV30_L1.1|;a\":0.114237):0.0359322,\"lcl|HPV56_L1.1|,d\":0.0727412,\"lcl|HPV66_L1.1x\":0.0798012);" ), + new NHXParser() )[ 0 ]; + if ( !p55 + .toNewHampshire() + .equals( "(('lcl|HPV32_L1.:1 s':0.195593,'lcl|HPV30_L1.1|;a':0.114237):0.0359322,'lcl|HPV56_L1.1|,d':0.0727412,lcl|HPV66_L1.1x:0.0798012);" ) ) { + System.out.println( p55.toNewHampshire() ); + return false; + } + final Phylogeny p56 = factory + .create( new StringBuffer( "((\"lcl|HPV32_L1.:1 s\":0.195593,\"lcl|HPV30_L1.1|;a\":0.114\n237):0.0359322,\"lcl|HPV56_L1.1|,d\":0.0727412,\"lcl|HPV66_L1.1:x\":0.0798012);" ), + new NHXParser() )[ 0 ]; + if ( !p56 + .toNewHampshire() + .equals( "(('lcl|HPV32_L1.:1 s':0.195593,'lcl|HPV30_L1.1|;a':0.114237):0.0359322,'lcl|HPV56_L1.1|,d':0.0727412,'lcl|HPV66_L1.1:x':0.0798012);" ) ) { + System.out.println( p56.toNewHampshire() ); + return false; + } + final Phylogeny p57 = factory + .create( new StringBuffer( "((\"lcl|HPV32_L1.:1 s\":0.195593,\"lcl|HPV30_L1.1|;a\":0.114\n237):0.0359322,\"lcl|HPV56_L1.1|,d\":0.0727412,\"lcl|HPV66_L1.1:x\":0.0798012);" ), + new NHXParser() )[ 0 ]; + if ( !p57 + .toNewHampshire() + .equals( "(('lcl|HPV32_L1.:1 s':0.195593,'lcl|HPV30_L1.1|;a':0.114237):0.0359322,'lcl|HPV56_L1.1|,d':0.0727412,'lcl|HPV66_L1.1:x':0.0798012);" ) ) { + System.out.println( p56.toNewHampshire() ); + return false; + } + final String s58 = "('Homo \"man\" sapiens:1',\"Homo 'man' sapiens;\")';root \"1_ )';"; + final Phylogeny p58 = factory.create( new StringBuffer( s58 ), new NHXParser() )[ 0 ]; + if ( !p58.toNewHampshire().equals( s58 ) ) { + System.out.println( p58.toNewHampshire() ); + return false; + } + final String s59 = "('Homo \"man sapiens:1',\"Homo 'man sapiens\")\"root; '1_ )\";"; + final Phylogeny p59 = factory.create( new StringBuffer( s59 ), new NHXParser() )[ 0 ]; + if ( !p59.toNewHampshire().equals( s59 ) ) { + System.out.println( p59.toNewHampshire() ); + return false; + } + final String s60 = "('\" ;,:\":\"',\"'abc def' g's_\",'=:0.45+,.:%~`!@#$%^&*()_-+={} | ;,');"; + final Phylogeny p60 = factory.create( new StringBuffer( s60 ), new NHXParser() )[ 0 ]; + if ( !p60.toNewHampshire().equals( s60 ) ) { + System.out.println( p60.toNewHampshire() ); + return false; + } + final String s61 = "('H[omo] \"man\" sapiens:1',\"H[omo] 'man' sapiens;\",H[omo] sapiens)';root \"1_ )';"; + final Phylogeny p61 = factory.create( new StringBuffer( s61 ), new NHXParser() )[ 0 ]; + if ( !p61.toNewHampshire() + .equals( "('H{omo} \"man\" sapiens:1',\"H{omo} 'man' sapiens;\",Hsapiens)';root \"1_ )';" ) ) { + System.out.println( p61.toNewHampshire() ); return false; } } @@ -8173,6 +9017,14 @@ public final class Test { System.out.println( n6.toNewHampshireX() ); return false; } + final PhylogenyNode n7 = new PhylogenyNode(); + n7.setName( " gks:dr-m4 \" ' `@:[]sadq04 " ); + if ( !n7.toNewHampshire( true, PhylogenyNode.NH_CONVERSION_SUPPORT_VALUE_STYLE.IN_SQUARE_BRACKETS ) + .equals( "'gks:dr-m4 \" ` `@:[]sadq04'" ) ) { + System.out.println( n7 + .toNewHampshire( true, PhylogenyNode.NH_CONVERSION_SUPPORT_VALUE_STYLE.IN_SQUARE_BRACKETS ) ); + return false; + } } catch ( final Exception e ) { e.printStackTrace( System.out ); @@ -8420,8 +9272,8 @@ public final class Test { return false; } final PhylogenyNode n13 = PhylogenyNode - .createInstanceFromNhxString( "blah_12345/1-2", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ); - if ( !n13.getName().equals( "blah_12345/1-2" ) ) { + .createInstanceFromNhxString( "BLAH_12345/1-2", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ); + if ( !n13.getName().equals( "BLAH_12345/1-2" ) ) { return false; } if ( PhylogenyMethods.getSpecies( n13 ).equals( "12345" ) ) { @@ -8486,7 +9338,7 @@ public final class Test { return false; } final PhylogenyNode n19 = PhylogenyNode - .createInstanceFromNhxString( "blah_1-roejojoej", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ); + .createInstanceFromNhxString( "BLAH_1-roejojoej", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ); if ( !n19.getNodeData().getTaxonomy().getIdentifier().getValue().equals( "1" ) ) { return false; } @@ -8494,7 +9346,7 @@ public final class Test { return false; } final PhylogenyNode n30 = PhylogenyNode - .createInstanceFromNhxString( "blah_1234567-roejojoej", + .createInstanceFromNhxString( "BLAH_1234567-roejojoej", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ); if ( !n30.getNodeData().getTaxonomy().getIdentifier().getValue().equals( "1234567" ) ) { return false; @@ -8503,7 +9355,7 @@ public final class Test { return false; } final PhylogenyNode n31 = PhylogenyNode - .createInstanceFromNhxString( "blah_12345678-roejojoej", + .createInstanceFromNhxString( "BLAH_12345678-roejojoej", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ); if ( n31.getNodeData().isHasTaxonomy() ) { return false; @@ -8514,7 +9366,7 @@ public final class Test { return false; } final PhylogenyNode n40 = PhylogenyNode - .createInstanceFromNhxString( "bcl2_12345", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ); + .createInstanceFromNhxString( "BCL2_12345", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ); if ( !n40.getNodeData().getTaxonomy().getIdentifier().getValue().equals( "12345" ) ) { return false; } @@ -8609,6 +9461,17 @@ public final class Test { if ( !p10.toNewHampshireX().equals( "((A:0.2,B:0.3):0.5[&&NHX:B=91],C:0.1)root:0.1[&&NHX:B=100]" ) ) { return false; } + final Phylogeny p11 = factory + .create( " [79] ( ('A: \" ' [co mment] :0 .2[comment],B:0.3[com])[com ment]: 0. 5 \t[ 9 1 ][ comment],C: 0.1)[comment]root:0.1[100] [comment]", + new NHXParser() )[ 0 ]; + if ( !p11.toNewHampshireX().equals( "(('A: \"':0.2,B:0.3):0.5[&&NHX:B=91],C:0.1)root:0.1[&&NHX:B=100]" ) ) { + return false; + } + final Phylogeny p12 = factory.create( "((A:0.2,B:0.3):0.5[&&NHX:B=91],C:0.1)root:0.1[&&NHX:B=100]", + new NHXParser() )[ 0 ]; + if ( !p12.toNewHampshireX().equals( "((A:0.2,B:0.3):0.5[&&NHX:B=91],C:0.1)root:0.1[&&NHX:B=100]" ) ) { + return false; + } } catch ( final Exception e ) { e.printStackTrace( System.out ); @@ -8647,15 +9510,15 @@ public final class Test { } final Phylogeny p2 = factory .create( "(1[something_else(?)s,prob=0.9500000000000000e+00{}(((,p)rob_stddev=0.110000000000e+00," - + "prob_range={1.000000000000000e+00,1.000000000000000e+00},prob(percent)=\"100\"," - + "prob+-sd=\"100+-0\"]:4.129000000000000e-02[&length_mean=4.153987461671767e-02," - + "length_median=4.129000000000000e-02,length_95%HPD={3.217800000000000e-02," - + "5.026800000000000e-02}],2[&prob=0.810000000000000e+00,prob_stddev=0.000000000000000e+00," - + "prob_range={1.000000000000000e+00,1.000000000000000e+00},prob(percent)=\"100\"," - + "prob+-sd=\"100+-0\"]:6.375699999999999e-02[&length_mean=6.395210411945065e-02," - + "length_median=6.375699999999999e-02,length_95%HPD={5.388600000000000e-02," - + "7.369400000000000e-02}])", - new NHXParser() )[ 0 ]; + + "prob_range={1.000000000000000e+00,1.000000000000000e+00},prob(percent)=\"100\"," + + "prob+-sd=\"100+-0\"]:4.129000000000000e-02[&length_mean=4.153987461671767e-02," + + "length_median=4.129000000000000e-02,length_95%HPD={3.217800000000000e-02," + + "5.026800000000000e-02}],2[&prob=0.810000000000000e+00,prob_stddev=0.000000000000000e+00," + + "prob_range={1.000000000000000e+00,1.000000000000000e+00},prob(percent)=\"100\"," + + "prob+-sd=\"100+-0\"]:6.375699999999999e-02[&length_mean=6.395210411945065e-02," + + "length_median=6.375699999999999e-02,length_95%HPD={5.388600000000000e-02," + + "7.369400000000000e-02}])", + new NHXParser() )[ 0 ]; if ( p2.getNode( "1" ) == null ) { return false; } @@ -8699,13 +9562,13 @@ public final class Test { if ( phy.getNodes( "'single quotes' inside double quotes" ).size() != 1 ) { return false; } - if ( phy.getNodes( "double quotes inside single quotes" ).size() != 1 ) { + if ( phy.getNodes( "\"double quotes\" inside single quotes" ).size() != 1 ) { return false; } if ( phy.getNodes( "noquotes" ).size() != 1 ) { return false; } - if ( phy.getNodes( "A ( B C '" ).size() != 1 ) { + if ( phy.getNodes( "A ( B C '" ).size() != 1 ) { return false; } final NHXParser p1p = new NHXParser(); @@ -8735,7 +9598,7 @@ public final class Test { final Phylogeny p10 = factory .create( " [79] ( (\"A \n\tB \" [co mment] :0 .2[comment],'B':0.3[com])[com ment]: 0. 5 \t[ 9 1 ][ comment],'C (or D?\\//;,))': 0.1)[comment]'\nroot is here (cool, was! ) ':0.1[100] [comment]", new NHXParser() )[ 0 ]; - final String p10_clean_str = "(('A B':0.2,B:0.3):0.5[&&NHX:B=91],'C (or D?\\//;,))':0.1)'root is here (cool, was! )':0.1[&&NHX:B=100]"; + final String p10_clean_str = "(('A B':0.2,B:0.3):0.5[&&NHX:B=91],'C (or D?\\//;,))':0.1)'root is here (cool, was! )':0.1[&&NHX:B=100]"; if ( !p10.toNewHampshireX().equals( p10_clean_str ) ) { return false; } @@ -8743,11 +9606,10 @@ public final class Test { if ( !p11.toNewHampshireX().equals( p10_clean_str ) ) { return false; } - // final Phylogeny p12 = factory .create( " [79] ( (\"A \n\tB \" [[][] :0 .2[comment][\t&\t&\n N\tH\tX:S=mo\tnkey !],'\tB\t\b\t\n\f\rB B ':0.0\b3[])\t[com ment]: 0. 5 \t[ 9 1 ][ \ncomment],'C\t (or D?\\//;,))': 0.\b1)[comment]'\nroot \tis here (cool, \b\t\n\f\r was! ) ':0.1[100] [comment]", new NHXParser() )[ 0 ]; - final String p12_clean_str = "(('A B':0.2[&&NHX:S=monkey!],'BB B':0.03):0.5[&&NHX:B=91],'C (or D?\\//;,))':0.1)'root is here (cool, was! )':0.1[&&NHX:B=100]"; + final String p12_clean_str = "(('A B':0.2[&&NHX:S=monkey!],'BB B':0.03):0.5[&&NHX:B=91],'C (or D?\\//;,))':0.1)'root is here (cool, was! )':0.1[&&NHX:B=100]"; if ( !p12.toNewHampshireX().equals( p12_clean_str ) ) { return false; } @@ -8755,7 +9617,7 @@ public final class Test { if ( !p13.toNewHampshireX().equals( p12_clean_str ) ) { return false; } - final String p12_clean_str_nh = "(('A B':0.2,'BB B':0.03):0.5,'C (or D?\\//;,))':0.1)'root is here (cool, was! )':0.1;"; + final String p12_clean_str_nh = "(('A B':0.2,'BB B':0.03):0.5,'C (or D?\\//;,))':0.1)'root is here (cool, was! )':0.1;"; if ( !p13.toNewHampshire().equals( p12_clean_str_nh ) ) { return false; } @@ -9787,13 +10649,13 @@ public final class Test { // J. of Comput Bio. Vol. 4, No 2, pp.177-187 final Phylogeny species6 = factory .create( "(((1:[&&NHX:S=1],5:[&&NHX:S=5])1-5,((4:[&&NHX:S=4],6:[&&NHX:S=6])4-6,2:[&&NHX:S=2])4-6-2)1-5-4-6-2," - + "((9:[&&NHX:S=9],3:[&&NHX:S=3])9-3,(8:[&&NHX:S=8],7:[&&NHX:S=7])8-7)9-3-8-7)", - new NHXParser() )[ 0 ]; + + "((9:[&&NHX:S=9],3:[&&NHX:S=3])9-3,(8:[&&NHX:S=8],7:[&&NHX:S=7])8-7)9-3-8-7)", + new NHXParser() )[ 0 ]; final Phylogeny gene6 = factory .create( "(((1:0.1[&&NHX:S=1],2:0.1[&&NHX:S=2])1-2:0.1,3:0.1[&&NHX:S=3])1-2-3:0.1," - + "((4:0.1[&&NHX:S=4],(5:0.1[&&NHX:S=5],6:0.1[&&NHX:S=6])5-6:0.1)4-5-6:0.1," - + "(7:0.1[&&NHX:S=7],(8:0.1[&&NHX:S=8],9:0.1[&&NHX:S=9])8-9:0.1)7-8-9:0.1)4-5-6-7-8-9:0.1)r;", - new NHXParser() )[ 0 ]; + + "((4:0.1[&&NHX:S=4],(5:0.1[&&NHX:S=5],6:0.1[&&NHX:S=6])5-6:0.1)4-5-6:0.1," + + "(7:0.1[&&NHX:S=7],(8:0.1[&&NHX:S=8],9:0.1[&&NHX:S=9])8-9:0.1)7-8-9:0.1)4-5-6-7-8-9:0.1)r;", + new NHXParser() )[ 0 ]; species6.setRooted( true ); gene6.setRooted( true ); final SDI sdi6 = new SDI( gene6, species6 ); @@ -10127,15 +10989,15 @@ public final class Test { } final Phylogeny species6 = factory .create( "(((1:[&&NHX:S=1],5:[&&NHX:S=5])1-5,((4:[&&NHX:S=4],6:[&&NHX:S=6])4-6,2:[&&NHX:S=2])4-6-2)1-5-4-6-2," - + "((9:[&&NHX:S=9],3:[&&NHX:S=3])9-3,(8:[&&NHX:S=8],7:[&&NHX:S=7])8-7)9-3-8-7)", - new NHXParser() )[ 0 ]; + + "((9:[&&NHX:S=9],3:[&&NHX:S=3])9-3,(8:[&&NHX:S=8],7:[&&NHX:S=7])8-7)9-3-8-7)", + new NHXParser() )[ 0 ]; final Phylogeny gene6 = factory .create( "((5:0.1[&&NHX:S=5],6:0.1[&&NHX:S=6])5-6:0.05[&&NHX:S=6],(4:0.1[&&NHX:S=4]," - + "(((1:0.1[&&NHX:S=1],2:0.1[&&NHX:S=2])1-2:0.1[&&NHX:S=2],3:0.25[&&NHX:S=3])1-2-3:0.2[&&NHX:S=2]," - + "(7:0.1[&&NHX:S=7],(8:0.1[&&NHX:S=8]," - + "9:0.1[&&NHX:S=9])8-9:0.1[&&NHX:S=9])7-8-9:0.1[&&NHX:S=8])" - + "4-5-6-7-8-9:0.1[&&NHX:S=5])4-5-6:0.05[&&NHX:S=5])", - new NHXParser() )[ 0 ]; + + "(((1:0.1[&&NHX:S=1],2:0.1[&&NHX:S=2])1-2:0.1[&&NHX:S=2],3:0.25[&&NHX:S=3])1-2-3:0.2[&&NHX:S=2]," + + "(7:0.1[&&NHX:S=7],(8:0.1[&&NHX:S=8]," + + "9:0.1[&&NHX:S=9])8-9:0.1[&&NHX:S=9])7-8-9:0.1[&&NHX:S=8])" + + "4-5-6-7-8-9:0.1[&&NHX:S=5])4-5-6:0.05[&&NHX:S=5])", + new NHXParser() )[ 0 ]; species6.setRooted( true ); gene6.setRooted( true ); Phylogeny[] p6 = sdi_unrooted.infer( gene6, species6, false, true, true, true, 10 ); @@ -10181,15 +11043,15 @@ public final class Test { p6 = null; final Phylogeny species7 = factory .create( "(((1:[&&NHX:S=1],5:[&&NHX:S=5])1-5,((4:[&&NHX:S=4],6:[&&NHX:S=6])4-6,2:[&&NHX:S=2])4-6-2)1-5-4-6-2," - + "((9:[&&NHX:S=9],3:[&&NHX:S=3])9-3,(8:[&&NHX:S=8],7:[&&NHX:S=7])8-7)9-3-8-7)", - new NHXParser() )[ 0 ]; + + "((9:[&&NHX:S=9],3:[&&NHX:S=3])9-3,(8:[&&NHX:S=8],7:[&&NHX:S=7])8-7)9-3-8-7)", + new NHXParser() )[ 0 ]; final Phylogeny gene7 = factory .create( "((5:0.1[&&NHX:S=5],6:0.1[&&NHX:S=6])5-6:0.05[&&NHX:S=6],(4:0.1[&&NHX:S=4]," - + "(((1:0.1[&&NHX:S=1],2:0.1[&&NHX:S=2])1-2:0.1[&&NHX:S=2],3:0.25[&&NHX:S=3])1-2-3:0.2[&&NHX:S=2]," - + "(7:0.1[&&NHX:S=7],(8:0.1[&&NHX:S=8]," - + "9:0.1[&&NHX:S=9])8-9:0.1[&&NHX:S=9])7-8-9:0.1[&&NHX:S=8])" - + "4-5-6-7-8-9:0.1[&&NHX:S=5])4-5-6:0.05[&&NHX:S=5])", - new NHXParser() )[ 0 ]; + + "(((1:0.1[&&NHX:S=1],2:0.1[&&NHX:S=2])1-2:0.1[&&NHX:S=2],3:0.25[&&NHX:S=3])1-2-3:0.2[&&NHX:S=2]," + + "(7:0.1[&&NHX:S=7],(8:0.1[&&NHX:S=8]," + + "9:0.1[&&NHX:S=9])8-9:0.1[&&NHX:S=9])7-8-9:0.1[&&NHX:S=8])" + + "4-5-6-7-8-9:0.1[&&NHX:S=5])4-5-6:0.05[&&NHX:S=5])", + new NHXParser() )[ 0 ]; species7.setRooted( true ); gene7.setRooted( true ); Phylogeny[] p7 = sdi_unrooted.infer( gene7, species7, true, true, true, true, 10 ); @@ -10235,15 +11097,15 @@ public final class Test { p7 = null; final Phylogeny species8 = factory .create( "(((1:[&&NHX:S=1],5:[&&NHX:S=5])1-5,((4:[&&NHX:S=4],6:[&&NHX:S=6])4-6,2:[&&NHX:S=2])4-6-2)1-5-4-6-2," - + "((9:[&&NHX:S=9],3:[&&NHX:S=3])9-3,(8:[&&NHX:S=8],7:[&&NHX:S=7])8-7)9-3-8-7)", - new NHXParser() )[ 0 ]; + + "((9:[&&NHX:S=9],3:[&&NHX:S=3])9-3,(8:[&&NHX:S=8],7:[&&NHX:S=7])8-7)9-3-8-7)", + new NHXParser() )[ 0 ]; final Phylogeny gene8 = factory .create( "((5:0.1[&&NHX:S=5],6:0.1[&&NHX:S=6])5-6:0.05[&&NHX:S=6],(4:0.1[&&NHX:S=4]," - + "(((1:0.1[&&NHX:S=1],2:0.1[&&NHX:S=2])1-2:0.1[&&NHX:S=2],3:0.25[&&NHX:S=3])1-2-3:0.2[&&NHX:S=2]," - + "(7:0.1[&&NHX:S=7],(8:0.1[&&NHX:S=8]," - + "9:0.1[&&NHX:S=9])8-9:0.1[&&NHX:S=9])7-8-9:0.1[&&NHX:S=8])" - + "4-5-6-7-8-9:0.1[&&NHX:S=5])4-5-6:0.05[&&NHX:S=5])", - new NHXParser() )[ 0 ]; + + "(((1:0.1[&&NHX:S=1],2:0.1[&&NHX:S=2])1-2:0.1[&&NHX:S=2],3:0.25[&&NHX:S=3])1-2-3:0.2[&&NHX:S=2]," + + "(7:0.1[&&NHX:S=7],(8:0.1[&&NHX:S=8]," + + "9:0.1[&&NHX:S=9])8-9:0.1[&&NHX:S=9])7-8-9:0.1[&&NHX:S=8])" + + "4-5-6-7-8-9:0.1[&&NHX:S=5])4-5-6:0.05[&&NHX:S=5])", + new NHXParser() )[ 0 ]; species8.setRooted( true ); gene8.setRooted( true ); Phylogeny[] p8 = sdi_unrooted.infer( gene8, species8, false, false, true, true, 10 ); @@ -10438,8 +11300,7 @@ public final class Test { } final PhylogenyNode n2 = new PhylogenyNode( "NM_001030253" ); SequenceDbWsTools.obtainSeqInformation( n2 ); - if ( !n2.getNodeData().getSequence().getName() - .equals( "Danio rerio B-cell leukemia/lymphoma 2 (bcl2), mRNA" ) ) { + if ( !n2.getNodeData().getSequence().getName().equals( "Danio rerio B-cell CLL/lymphoma 2a (bcl2a), mRNA" ) ) { return false; } if ( !n2.getNodeData().getTaxonomy().getScientificName().equals( "Danio rerio" ) ) { @@ -10491,7 +11352,6 @@ public final class Test { } return false; } - // id = SequenceAccessionTools.parseAccessorFromString( "segmented worms|gb_ADF31344" ); if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() ) || !id.getValue().equals( "ADF31344" ) || !id.getSource().equals( "ncbi" ) ) { @@ -10501,7 +11361,6 @@ public final class Test { } return false; } - // id = SequenceAccessionTools.parseAccessorFromString( "segmented worms gb_ADF31344 and more" ); if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() ) || !id.getValue().equals( "ADF31344" ) || !id.getSource().equals( "ncbi" ) ) { @@ -10511,7 +11370,6 @@ public final class Test { } return false; } - // id = SequenceAccessionTools.parseAccessorFromString( "gb_AAA96518_1" ); if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() ) || !id.getValue().equals( "AAA96518" ) || !id.getSource().equals( "ncbi" ) ) { @@ -10521,7 +11379,6 @@ public final class Test { } return false; } - // id = SequenceAccessionTools.parseAccessorFromString( "gb_EHB07727_1_rodents_" ); if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() ) || !id.getValue().equals( "EHB07727" ) || !id.getSource().equals( "ncbi" ) ) { @@ -10531,7 +11388,6 @@ public final class Test { } return false; } - // id = SequenceAccessionTools.parseAccessorFromString( "dbj_BAF37827_1_turtles_" ); if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() ) || !id.getValue().equals( "BAF37827" ) || !id.getSource().equals( "ncbi" ) ) { @@ -10541,7 +11397,6 @@ public final class Test { } return false; } - // id = SequenceAccessionTools.parseAccessorFromString( "emb_CAA73223_1_primates_" ); if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() ) || !id.getValue().equals( "CAA73223" ) || !id.getSource().equals( "ncbi" ) ) { @@ -10551,7 +11406,6 @@ public final class Test { } return false; } - // id = SequenceAccessionTools.parseAccessorFromString( "mites|ref_XP_002434188_1" ); if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() ) || !id.getValue().equals( "XP_002434188" ) || !id.getSource().equals( "refseq" ) ) { @@ -10561,7 +11415,6 @@ public final class Test { } return false; } - // id = SequenceAccessionTools.parseAccessorFromString( "mites_ref_XP_002434188_1_bla_XP_12345" ); if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() ) || !id.getValue().equals( "XP_002434188" ) || !id.getSource().equals( "refseq" ) ) { @@ -10571,7 +11424,6 @@ public final class Test { } return false; } - // id = SequenceAccessionTools.parseAccessorFromString( "P4A123" ); if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() ) || !id.getValue().equals( "P4A123" ) || !id.getSource().equals( "uniprot" ) ) { @@ -10587,6 +11439,39 @@ public final class Test { System.out.println( "provider=" + id.getSource() ); return false; } + id = SequenceAccessionTools.parseAccessorFromString( "N3B004Z009" ); + if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() ) + || !id.getValue().equals( "N3B004Z009" ) || !id.getSource().equals( "uniprot" ) ) { + if ( id != null ) { + System.out.println( "value =" + id.getValue() ); + System.out.println( "provider=" + id.getSource() ); + } + return false; + } + id = SequenceAccessionTools.parseAccessorFromString( "A4CAA4ZBB9" ); + if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() ) + || !id.getValue().equals( "A4CAA4ZBB9" ) || !id.getSource().equals( "uniprot" ) ) { + if ( id != null ) { + System.out.println( "value =" + id.getValue() ); + System.out.println( "provider=" + id.getSource() ); + } + return false; + } + id = SequenceAccessionTools.parseAccessorFromString( "ecoli_A4CAA4ZBB9_rt" ); + if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() ) + || !id.getValue().equals( "A4CAA4ZBB9" ) || !id.getSource().equals( "uniprot" ) ) { + if ( id != null ) { + System.out.println( "value =" + id.getValue() ); + System.out.println( "provider=" + id.getSource() ); + } + return false; + } + id = SequenceAccessionTools.parseAccessorFromString( "Q4CAA4ZBB9" ); + if ( id != null ) { + System.out.println( "value =" + id.getValue() ); + System.out.println( "provider=" + id.getSource() ); + return false; + } } catch ( final Exception e ) { e.printStackTrace( System.out ); @@ -10758,14 +11643,12 @@ public final class Test { if ( !s0.match( query_nodes ) ) { return false; } - // query_nodes = new HashSet(); query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) ); query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) ); if ( !s0.match( query_nodes ) ) { return false; } - // query_nodes = new HashSet(); query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) ); query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) ); @@ -10775,7 +11658,6 @@ public final class Test { if ( !s0.match( query_nodes ) ) { return false; } - // query_nodes = new HashSet(); query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) ); query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) ); @@ -10783,7 +11665,6 @@ public final class Test { if ( !s0.match( query_nodes ) ) { return false; } - // query_nodes = new HashSet(); query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) ); query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) ); @@ -10792,14 +11673,12 @@ public final class Test { if ( !s0.match( query_nodes ) ) { return false; } - // query_nodes = new HashSet(); query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) ); query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) ); if ( s0.match( query_nodes ) ) { return false; } - // query_nodes = new HashSet(); query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) ); query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) ); @@ -10808,7 +11687,6 @@ public final class Test { if ( s0.match( query_nodes ) ) { return false; } - // query_nodes = new HashSet(); query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) ); query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) ); @@ -10818,7 +11696,6 @@ public final class Test { if ( s0.match( query_nodes ) ) { return false; } - // query_nodes = new HashSet(); query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) ); query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) ); @@ -10826,49 +11703,42 @@ public final class Test { if ( s0.match( query_nodes ) ) { return false; } - // query_nodes = new HashSet(); query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) ); query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) ); if ( s0.match( query_nodes ) ) { return false; } - // query_nodes = new HashSet(); query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) ); query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) ); if ( s0.match( query_nodes ) ) { return false; } - // query_nodes = new HashSet(); query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) ); query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "C" ) ); if ( s0.match( query_nodes ) ) { return false; } - // query_nodes = new HashSet(); query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) ); query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) ); if ( s0.match( query_nodes ) ) { return false; } - // query_nodes = new HashSet(); query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) ); query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) ); if ( s0.match( query_nodes ) ) { return false; } - // query_nodes = new HashSet(); query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) ); query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) ); if ( s0.match( query_nodes ) ) { return false; } - // query_nodes = new HashSet(); query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) ); query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) ); @@ -10876,7 +11746,6 @@ public final class Test { if ( s0.match( query_nodes ) ) { return false; } - // query_nodes = new HashSet(); query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) ); query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) ); @@ -10884,7 +11753,6 @@ public final class Test { if ( s0.match( query_nodes ) ) { return false; } - // query_nodes = new HashSet(); query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) ); query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) ); @@ -10892,7 +11760,6 @@ public final class Test { if ( s0.match( query_nodes ) ) { return false; } - // query_nodes = new HashSet(); query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) ); query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) ); @@ -11381,24 +12248,24 @@ public final class Test { final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance(); final Phylogeny t0_1 = factory.create( "(((A,B),C),(D,E))", new NHXParser() )[ 0 ]; final Phylogeny[] phylogenies_1 = factory.create( "(((A,B),C),(D,E)) " + "(((C,B),A),(D,E))" - + "(((A,B),C),(D,E)) " + "(((A,B),C),(D,E))" - + "(((A,B),C),(D,E))" + "(((C,B),A),(D,E))" - + "(((E,B),D),(C,A))" + "(((C,B),A),(D,E))" - + "(((A,B),C),(D,E))" + "(((A,B),C),(D,E))", - new NHXParser() ); + + "(((A,B),C),(D,E)) " + "(((A,B),C),(D,E))" + + "(((A,B),C),(D,E))" + "(((C,B),A),(D,E))" + + "(((E,B),D),(C,A))" + "(((C,B),A),(D,E))" + + "(((A,B),C),(D,E))" + "(((A,B),C),(D,E))", + new NHXParser() ); SupportCount.count( t0_1, phylogenies_1, true, false ); final Phylogeny t0_2 = factory.create( "(((((A,B),C),D),E),(F,G))", new NHXParser() )[ 0 ]; final Phylogeny[] phylogenies_2 = factory.create( "(((((A,B),C),D),E),(F,G))" - + "(((((A,B),C),D),E),((F,G),X))" - + "(((((A,Y),B),C),D),((F,G),E))" - + "(((((A,B),C),D),E),(F,G))" - + "(((((A,B),C),D),E),(F,G))" - + "(((((A,B),C),D),E),(F,G))" - + "(((((A,B),C),D),E),(F,G),Z)" - + "(((((A,B),C),D),E),(F,G))" - + "((((((A,B),C),D),E),F),G)" - + "(((((X,Y),F,G),E),((A,B),C)),D)", - new NHXParser() ); + + "(((((A,B),C),D),E),((F,G),X))" + + "(((((A,Y),B),C),D),((F,G),E))" + + "(((((A,B),C),D),E),(F,G))" + + "(((((A,B),C),D),E),(F,G))" + + "(((((A,B),C),D),E),(F,G))" + + "(((((A,B),C),D),E),(F,G),Z)" + + "(((((A,B),C),D),E),(F,G))" + + "((((((A,B),C),D),E),F),G)" + + "(((((X,Y),F,G),E),((A,B),C)),D)", + new NHXParser() ); SupportCount.count( t0_2, phylogenies_2, true, false ); final PhylogenyNodeIterator it = t0_2.iteratorPostorder(); while ( it.hasNext() ) { @@ -11575,7 +12442,7 @@ public final class Test { return false; } final PhylogenyNode n3 = PhylogenyNode - .createInstanceFromNhxString( "blag_12345", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ); + .createInstanceFromNhxString( "BLAG_12345", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ); if ( !n3.getNodeData().getTaxonomy().getIdentifier().getValue().equals( "12345" ) ) { System.out.println( n3.toString() ); return false; @@ -11593,43 +12460,43 @@ public final class Test { return false; } final PhylogenyNode n6 = PhylogenyNode - .createInstanceFromNhxString( "blag-12345-blag", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ); + .createInstanceFromNhxString( "BLAG-12345-blag", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ); if ( n6.getNodeData().isHasTaxonomy() ) { System.out.println( n6.toString() ); return false; } final PhylogenyNode n7 = PhylogenyNode - .createInstanceFromNhxString( "blag-12345_blag", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ); + .createInstanceFromNhxString( "BLAG-12345_blag", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ); if ( n7.getNodeData().isHasTaxonomy() ) { System.out.println( n7.toString() ); return false; } final PhylogenyNode n8 = PhylogenyNode - .createInstanceFromNhxString( "blag_12345-blag", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ); + .createInstanceFromNhxString( "BLAG_12345-blag", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ); if ( !n8.getNodeData().getTaxonomy().getIdentifier().getValue().equals( "12345" ) ) { System.out.println( n8.toString() ); return false; } final PhylogenyNode n9 = PhylogenyNode - .createInstanceFromNhxString( "blag_12345/blag", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ); + .createInstanceFromNhxString( "BLAG_12345/blag", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ); if ( !n9.getNodeData().getTaxonomy().getIdentifier().getValue().equals( "12345" ) ) { System.out.println( n9.toString() ); return false; } final PhylogenyNode n10x = PhylogenyNode - .createInstanceFromNhxString( "blag_12X45-blag", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ); + .createInstanceFromNhxString( "BLAG_12X45-blag", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ); if ( n10x.getNodeData().isHasTaxonomy() ) { System.out.println( n10x.toString() ); return false; } final PhylogenyNode n10xx = PhylogenyNode - .createInstanceFromNhxString( "blag_1YX45-blag", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ); + .createInstanceFromNhxString( "BLAG_1YX45-blag", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ); if ( n10xx.getNodeData().isHasTaxonomy() ) { System.out.println( n10xx.toString() ); return false; } final PhylogenyNode n10 = PhylogenyNode - .createInstanceFromNhxString( "blag_9YX45-blag", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ); + .createInstanceFromNhxString( "BLAG_9YX45-blag", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ); if ( !n10.getNodeData().getTaxonomy().getTaxonomyCode().equals( "9YX45" ) ) { System.out.println( n10.toString() ); return false; @@ -11653,6 +12520,90 @@ public final class Test { System.out.println( n13.toString() ); return false; } + final PhylogenyNode n14 = PhylogenyNode + .createInstanceFromNhxString( "Mus_musculus_392", NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE ); + if ( !n14.getNodeData().getTaxonomy().getScientificName().equals( "Mus musculus" ) ) { + System.out.println( n14.toString() ); + return false; + } + final PhylogenyNode n15 = PhylogenyNode + .createInstanceFromNhxString( "Mus_musculus_K392", NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE ); + if ( !n15.getNodeData().getTaxonomy().getScientificName().equals( "Mus musculus" ) ) { + System.out.println( n15.toString() ); + return false; + } + final PhylogenyNode n16 = PhylogenyNode + .createInstanceFromNhxString( "Mus musculus 392", NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE ); + if ( !n16.getNodeData().getTaxonomy().getScientificName().equals( "Mus musculus" ) ) { + System.out.println( n16.toString() ); + return false; + } + final PhylogenyNode n17 = PhylogenyNode + .createInstanceFromNhxString( "Mus musculus K392", NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE ); + if ( !n17.getNodeData().getTaxonomy().getScientificName().equals( "Mus musculus" ) ) { + System.out.println( n17.toString() ); + return false; + } + final PhylogenyNode n18 = PhylogenyNode + .createInstanceFromNhxString( "Mus_musculus_musculus_392", NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE ); + if ( !n18.getNodeData().getTaxonomy().getScientificName().equals( "Mus musculus musculus" ) ) { + System.out.println( n18.toString() ); + return false; + } + final PhylogenyNode n19 = PhylogenyNode + .createInstanceFromNhxString( "Mus_musculus_musculus_K392", + NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE ); + if ( !n19.getNodeData().getTaxonomy().getScientificName().equals( "Mus musculus musculus" ) ) { + System.out.println( n19.toString() ); + return false; + } + final PhylogenyNode n20 = PhylogenyNode + .createInstanceFromNhxString( "Mus musculus musculus 392", NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE ); + if ( !n20.getNodeData().getTaxonomy().getScientificName().equals( "Mus musculus musculus" ) ) { + System.out.println( n20.toString() ); + return false; + } + final PhylogenyNode n21 = PhylogenyNode + .createInstanceFromNhxString( "Mus musculus musculus K392", + NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE ); + if ( !n21.getNodeData().getTaxonomy().getScientificName().equals( "Mus musculus musculus" ) ) { + System.out.println( n21.toString() ); + return false; + } + final PhylogenyNode n23 = PhylogenyNode + .createInstanceFromNhxString( "9EMVE_Nematostella_vectensis", + NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE ); + if ( !n23.getNodeData().getTaxonomy().getScientificName().equals( "Nematostella vectensis" ) ) { + System.out.println( n23.toString() ); + return false; + } + final PhylogenyNode n24 = PhylogenyNode + .createInstanceFromNhxString( "9EMVE_Nematostella", NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE ); + if ( !n24.getNodeData().getTaxonomy().getTaxonomyCode().equals( "9EMVE" ) ) { + System.out.println( n24.toString() ); + return false; + } + // + final PhylogenyNode n25 = PhylogenyNode + .createInstanceFromNhxString( "Nematostella_vectensis_NEMVE", + NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE ); + if ( !n25.getNodeData().getTaxonomy().getTaxonomyCode().equals( "NEMVE" ) ) { + System.out.println( n25.toString() ); + return false; + } + final PhylogenyNode n26 = PhylogenyNode + .createInstanceFromNhxString( "Nematostella_vectensis_9EMVE", + NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE ); + if ( !n26.getNodeData().getTaxonomy().getScientificName().equals( "Nematostella vectensis" ) ) { + System.out.println( n26.toString() ); + return false; + } + final PhylogenyNode n27 = PhylogenyNode + .createInstanceFromNhxString( "Nematostella_9EMVE", NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE ); + if ( !n27.getNodeData().getTaxonomy().getTaxonomyCode().equals( "9EMVE" ) ) { + System.out.println( n27.toString() ); + return false; + } } catch ( final Exception e ) { e.printStackTrace( System.out ); @@ -11726,7 +12677,7 @@ public final class Test { private static boolean testUniprotEntryRetrieval() { try { - final SequenceDatabaseEntry entry = SequenceDbWsTools.obtainUniProtEntry( "P12345", 200 ); + final SequenceDatabaseEntry entry = SequenceDbWsTools.obtainUniProtEntry( "P12345", 5000 ); if ( !entry.getAccession().equals( "P12345" ) ) { return false; } @@ -11745,6 +12696,18 @@ public final class Test { if ( !entry.getTaxonomyIdentifier().equals( "9986" ) ) { return false; } + if ( entry.getMolecularSequence() == null ) { + return false; + } + if ( !entry + .getMolecularSequence() + .getMolecularSequenceAsString() + .startsWith( "MALLHSARVLSGVASAFHPGLAAAASARASSWWAHVEMGPPDPILGVTEAYKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKGLDKEYLPIGGLAEFCRASAELALGENSEV" ) + || !entry.getMolecularSequence().getMolecularSequenceAsString().endsWith( "LAHAIHQVTK" ) ) { + System.out.println( "got: " + entry.getMolecularSequence().getMolecularSequenceAsString() ); + System.out.println( "expected something else." ); + return false; + } } catch ( final IOException e ) { System.out.println(); @@ -11752,6 +12715,10 @@ public final class Test { e.printStackTrace( System.out ); return true; } + catch ( final NullPointerException f ) { + f.printStackTrace( System.out ); + return false; + } catch ( final Exception e ) { return false; }