X-Git-Url: http://source.jalview.org/gitweb/?a=blobdiff_plain;ds=sidebyside;f=forester%2Fjava%2Fsrc%2Forg%2Fforester%2Fws%2Fseqdb%2FEbiDbEntry.java;h=340fc3be6ddd5d6ea92983e7f329c322fa9d4c30;hb=6a91fb9b9673c051fdc8b5d557ef9de3b5d16d2a;hp=65ae847164055227f99b18fe71c2dc7014db9ae2;hpb=b80a84de8b4d07847496bc04f51b45bacd146ff3;p=jalview.git diff --git a/forester/java/src/org/forester/ws/seqdb/EbiDbEntry.java b/forester/java/src/org/forester/ws/seqdb/EbiDbEntry.java index 65ae847..340fc3b 100644 --- a/forester/java/src/org/forester/ws/seqdb/EbiDbEntry.java +++ b/forester/java/src/org/forester/ws/seqdb/EbiDbEntry.java @@ -26,127 +26,585 @@ package org.forester.ws.seqdb; import java.util.List; +import java.util.SortedSet; +import java.util.TreeSet; +import java.util.regex.Matcher; +import java.util.regex.Pattern; import org.forester.go.GoTerm; import org.forester.phylogeny.data.Accession; +import org.forester.phylogeny.data.Annotation; import org.forester.util.ForesterUtil; public final class EbiDbEntry implements SequenceDatabaseEntry { - //http://www.ebi.ac.uk/Tools/dbfetch/dbfetch/emb/AAR37336/ - private String _pa; - private String _de; - private String _os; - private String _tax_id; - private String _symbol; - private String _provider; - - private EbiDbEntry() { - } - - @Override - public Object clone() throws CloneNotSupportedException { - throw new CloneNotSupportedException(); - } - + // public static SequenceDatabaseEntry createInstanceFromPlainText( final List lines ) { + // final EbiDbEntry e = new EbiDbEntry(); + // for( final String line : lines ) { + // if ( line.startsWith( "PA" ) ) { + // e.setPA( SequenceDbWsTools.extractFrom( line, "PA" ) ); + // } + // else if ( line.startsWith( "DE" ) ) { + // e.setDe( SequenceDbWsTools.extractFrom( line, "DE" ) ); + // } + // else if ( line.startsWith( "OS" ) ) { + // if ( line.indexOf( "(" ) > 0 ) { + // e.setOs( SequenceDbWsTools.extractFromTo( line, "OS", "(" ) ); + // } + // else { + // e.setOs( SequenceDbWsTools.extractFrom( line, "OS" ) ); + // } + // } + // else if ( line.startsWith( "OX" ) ) { + // if ( line.indexOf( "NCBI_TaxID=" ) > 0 ) { + // e.setTaxId( SequenceDbWsTools.extractFromTo( line, "NCBI_TaxID=", ";" ) ); + // } + // } + // } + // return e; + // } public static SequenceDatabaseEntry createInstanceFromPlainTextForRefSeq( final List lines ) { + final Pattern X_PATTERN = Pattern.compile( "^[A-Z]+" ); + final Pattern chromosome_PATTERN = Pattern.compile( "\\s+/chromosome=\"(\\w+)\"" ); + final Pattern map_PATTERN = Pattern.compile( "\\s+/map=\"([\\w+\\.])\"" ); + final Pattern gene_PATTERN = Pattern.compile( "\\s+/gene=\"(.+)\"" ); + final Pattern mim_PATTERN = Pattern.compile( "\\s+/db_xref=\"MIM:(\\d+)\"" ); + final Pattern taxon_PATTERN = Pattern.compile( "\\s+/db_xref=\"taxon:(\\d+)\"" ); + final Pattern interpro_PATTERN = Pattern.compile( "\\s+/db_xref=\"InterPro:([A-Z0-9]+)\"" ); + final Pattern uniprot_PATTERN = Pattern.compile( "\\s+/db_xref=\"UniProtKB/[A-Za-z-]*:(\\w+)\"" ); + final Pattern hgnc_PATTERN = Pattern.compile( "\\s+/db_xref=\"[A-Z:]*HGNC:(\\d+)\"" ); + final Pattern geneid_PATTERN = Pattern.compile( "\\s+/db_xref=\"GeneID:(\\d+)\"" ); + final Pattern pdb_PATTERN = Pattern.compile( "\\s+/db_xref=\"PDB:([A-Z0-9]+)\"" ); + final Pattern ec_PATTERN = Pattern.compile( "\\s+/EC_number=\"([\\.\\-\\d]+)\"" ); + final Pattern product_PATTERN = Pattern.compile( "\\s+/product=\"(\\w{1,10})\"" ); final EbiDbEntry e = new EbiDbEntry(); + final StringBuilder def = new StringBuilder(); + boolean in_definition = false; + boolean in_features = false; + boolean in_source = false; + boolean in_gene = false; + boolean in_cds = false; + boolean in_mrna = false; + boolean in_protein = false; for( final String line : lines ) { - // System.out.println( "-" + line ); - if ( line.startsWith( "ACCESSION" ) ) { - e.setPA( DatabaseTools.extract( line, "ACCESSION" ) ); + if ( line.startsWith( "ACCESSION " ) ) { + e.setAccession( SequenceDbWsTools.extractFrom( line, "ACCESSION" ) ); + in_definition = false; + } + else if ( line.startsWith( "ID " ) ) { + e.setAccession( SequenceDbWsTools.extractFromTo( line, "ID", ";" ) ); + in_definition = false; } - else if ( line.startsWith( "DEFINITION" ) ) { + else if ( line.startsWith( "DEFINITION " ) || ( line.startsWith( "DE " ) ) ) { + boolean definiton = false; + if ( line.startsWith( "DEFINITION " ) ) { + definiton = true; + } if ( line.indexOf( "[" ) > 0 ) { - e.setDe( DatabaseTools.extract( line, "DEFINITION", "[" ) ); + if ( definiton ) { + x( def, ( SequenceDbWsTools.extractFromTo( line, "DEFINITION", "[" ) ) ); + } + else { + x( def, ( SequenceDbWsTools.extractFromTo( line, "DE", "[" ) ) ); + } } else if ( line.indexOf( "." ) > 0 ) { - e.setDe( DatabaseTools.extract( line, "DEFINITION", "." ) ); + if ( definiton ) { + x( def, ( SequenceDbWsTools.extractFromTo( line, "DEFINITION", "." ) ) ); + } + else { + x( def, ( SequenceDbWsTools.extractFromTo( line, "DE", "." ) ) ); + } } else { - e.setDe( DatabaseTools.extract( line, "DEFINITION" ) ); + if ( definiton ) { + x( def, ( SequenceDbWsTools.extractFrom( line, "DEFINITION" ) ) ); + } + else { + x( def, ( SequenceDbWsTools.extractFrom( line, "DE" ) ) ); + } + } + if ( definiton ) { + in_definition = true; } } - else if ( line.startsWith( "SOURCE" ) ) { + else if ( line.startsWith( " ORGANISM " ) ) { if ( line.indexOf( "(" ) > 0 ) { - e.setOs( DatabaseTools.extract( line, "SOURCE", "(" ) ); + e.setTaxonomyScientificName( SequenceDbWsTools.extractFromTo( line, " ORGANISM", "(" ) ); } else { - e.setOs( DatabaseTools.extract( line, "SOURCE" ) ); + e.setTaxonomyScientificName( SequenceDbWsTools.extractFrom( line, " ORGANISM" ) ); } + // in_def = false; } - } - return e; - } - - public static SequenceDatabaseEntry createInstanceFromPlainText( final List lines ) { - final EbiDbEntry e = new EbiDbEntry(); - for( final String line : lines ) { - if ( line.startsWith( "PA" ) ) { - e.setPA( DatabaseTools.extract( line, "PA" ) ); - } - else if ( line.startsWith( "DE" ) ) { - e.setDe( DatabaseTools.extract( line, "DE" ) ); - } - else if ( line.startsWith( "OS" ) ) { + else if ( line.startsWith( "OS " ) ) { if ( line.indexOf( "(" ) > 0 ) { - e.setOs( DatabaseTools.extract( line, "OS", "(" ) ); + e.setTaxonomyScientificName( SequenceDbWsTools.extractFromTo( line, "OS", "(" ) ); } else { - e.setOs( DatabaseTools.extract( line, "OS" ) ); + e.setTaxonomyScientificName( SequenceDbWsTools.extractFrom( line, "OS" ) ); + } + } + else if ( line.startsWith( " " ) && in_definition ) { + def.append( " " ); + if ( line.indexOf( "[" ) > 0 ) { + def.append( SequenceDbWsTools.extractTo( line, "[" ) ); + } + else if ( line.indexOf( "." ) > 0 ) { + def.append( SequenceDbWsTools.extractTo( line, "." ) ); + } + else { + def.append( line.trim() ); + } + } + else { + in_definition = false; + } + if ( !line.startsWith( "FT " ) && X_PATTERN.matcher( line ).find() ) { + in_features = false; + in_source = false; + in_gene = false; + in_cds = false; + in_mrna = false; + in_protein = false; + // in_def = false; + } + if ( line.startsWith( "FEATURES " ) || line.startsWith( "FT " ) ) { + in_features = true; + } + if ( in_features && ( line.startsWith( " source " ) || line.startsWith( "FT source " ) ) ) { + in_source = true; + in_gene = false; + in_cds = false; + in_mrna = false; + in_protein = false; + } + if ( in_features && ( line.startsWith( " gene " ) || line.startsWith( "FT gene " ) ) ) { + in_source = false; + in_gene = true; + in_cds = false; + in_mrna = false; + in_protein = false; + } + if ( in_features && ( line.startsWith( " CDS " ) || line.startsWith( "FT CDS " ) ) ) { + in_source = false; + in_gene = false; + in_cds = true; + in_mrna = false; + in_protein = false; + } + if ( in_features && ( line.startsWith( " Protein " ) || line.startsWith( "FT Protein " ) ) ) { + in_source = false; + in_gene = false; + in_cds = false; + in_mrna = false; + in_protein = true; + } + if ( in_features && ( line.startsWith( " mRNA " ) || line.startsWith( "FT mRNA " ) ) ) { + in_source = false; + in_gene = false; + in_cds = false; + in_mrna = true; + in_protein = false; + } + if ( in_source ) { + final Matcher ti = taxon_PATTERN.matcher( line ); + if ( ti.find() ) { + e.setTaxId( ti.group( 1 ) ); + } + final Matcher chr = chromosome_PATTERN.matcher( line ); + if ( chr.find() ) { + e.setChromosome( chr.group( 1 ) ); + } + final Matcher map = map_PATTERN.matcher( line ); + if ( map.find() ) { + e.setMap( map.group( 1 ) ); } } - else if ( line.startsWith( "OX" ) ) { - if ( line.indexOf( "NCBI_TaxID=" ) > 0 ) { - e.setTaxId( DatabaseTools.extract( line, "NCBI_TaxID=", ";" ) ); + if ( in_cds || in_gene ) { + final Matcher hgnc = hgnc_PATTERN.matcher( line ); + if ( hgnc.find() ) { + e.addCrossReference( new Accession( hgnc.group( 1 ), "hgnc" ) ); + } + final Matcher geneid = geneid_PATTERN.matcher( line ); + if ( geneid.find() ) { + e.addCrossReference( new Accession( geneid.group( 1 ), "geneid" ) ); + } + } + if ( in_protein || in_cds || in_gene || in_mrna ) { + final Matcher ec = ec_PATTERN.matcher( line ); + if ( ec.find() ) { + e.addAnnotation( new Annotation( "EC", ec.group( 1 ) ) ); + } + final Matcher gene = gene_PATTERN.matcher( line ); + if ( gene.find() ) { + e.setGeneName( gene.group( 1 ) ); + } + final Matcher uniprot = uniprot_PATTERN.matcher( line ); + if ( uniprot.find() ) { + e.addCrossReference( new Accession( uniprot.group( 1 ), "uniprot" ) ); + } + final Matcher interpro = interpro_PATTERN.matcher( line ); + if ( interpro.find() ) { + e.addCrossReference( new Accession( interpro.group( 1 ), "interpro" ) ); + } + final Matcher mim = mim_PATTERN.matcher( line ); + if ( mim.find() ) { + e.addCrossReference( new Accession( mim.group( 1 ), "mim" ) ); + } + final Matcher product = product_PATTERN.matcher( line ); + if ( product.find() ) { + e.setSequenceSymbol( product.group( 1 ) ); + } + final Matcher pdb = pdb_PATTERN.matcher( line ); + if ( pdb.find() ) { + e.addCrossReference( new Accession( pdb.group( 1 ), "pdb" ) ); } } } + if ( def.length() > 0 ) { + e.setSequenceName( def.toString().trim() ); + } return e; } + private String _map; + private String _chromosome; + + private void setMap( String map ) { + _map = map; + + } + + private void setChromosome( String chromosome ) { + _chromosome = chromosome; + + } @Override - public String getAccession() { - return _pa; + public String getMap( ) { + return _map; + + } + @Override + public String getChromosome() { + return _chromosome; + } + + + private static void x( final StringBuilder sb, final String s ) { + if ( sb.length() > 0 ) { + sb.append( " " ); + } + sb.append( s.trim() ); + } + // FIXME actually this is NCBI entry + //http://www.ebi.ac.uk/Tools/dbfetch/dbfetch/emb/AAR37336/ + private String _pa; + private String _de; + private String _os; + private String _tax_id; + private String _symbol; + private String _provider; + private SortedSet _cross_references; + private SortedSet _annotations; + private String _gene_name; - private void setPA( final String pa ) { - if ( _pa == null ) { - _pa = pa; + // TODO PUBMED 15798186 + //TODO (FEATURES) + // source /db_xref="taxon:9606" + // gene 1..2881 + // /gene="RBM39" + // + // /db_xref="MIM:604739" + // CDS + // /gene="RBM39" + // /db_xref="MIM:604739" + // /db_xref="InterPro:IPR002475" + // /product="Bcl-2" + // /db_xref="UniProtKB/TrEMBL:Q5J7V1" <- reparse? + // + // Protein + /* + LOCUS NM_184234 2881 bp mRNA linear PRI 16-JUN-2013 + DEFINITION Homo sapiens RNA binding motif protein 39 (RBM39), transcript + variant 1, mRNA. + ACCESSION NM_184234 + VERSION NM_184234.2 GI:336176061 + KEYWORDS RefSeq. + SOURCE Homo sapiens (human) + ORGANISM Homo sapiens + Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; + Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; + Catarrhini; Hominidae; Homo. + REFERENCE 1 (bases 1 to 2881) + AUTHORS Sillars-Hardebol,A.H., Carvalho,B., Belien,J.A., de Wit,M., + Delis-van Diemen,P.M., Tijssen,M., van de Wiel,M.A., Ponten,F., + Meijer,G.A. and Fijneman,R.J. + TITLE CSE1L, DIDO1 and RBM39 in colorectal adenoma to carcinoma + progression + JOURNAL Cell Oncol (Dordr) 35 (4), 293-300 (2012) + PUBMED 22711543 + REMARK GeneRIF: Data show that CSE1L, DIDO1 and RBM39 mRNA expression + levels correlated with chromosome 20q DNA copy number status. + REFERENCE 2 (bases 1 to 2881) + AUTHORS Huang,G., Zhou,Z., Wang,H. and Kleinerman,E.S. + TITLE CAPER-alpha alternative splicing regulates the expression of + vascular endothelial growth factor(1)(6)(5) in Ewing sarcoma cells + JOURNAL Cancer 118 (8), 2106-2116 (2012) + PUBMED 22009261 + REMARK GeneRIF: Increased VEGF(165) expression is secondary to the + down-regulation of CAPER-alpha by EWS/FLI-1. CAPER-alpha mediates + alternative splicing and controls the shift from VEGF(189) to + VEGF(165) . + REFERENCE 3 (bases 1 to 2881) + AUTHORS Han,B., Stockwin,L.H., Hancock,C., Yu,S.X., Hollingshead,M.G. and + Newton,D.L. + TITLE Proteomic analysis of nuclei isolated from cancer cell lines + treated with indenoisoquinoline NSC 724998, a novel topoisomerase I + inhibitor + JOURNAL J. Proteome Res. 9 (8), 4016-4027 (2010) + PUBMED 20515076 + REMARK Erratum:[J Proteome Res. 2011 Apr 1;10(4):2128] + REFERENCE 4 (bases 1 to 2881) + AUTHORS Zhang,J.Y., Looi,K.S. and Tan,E.M. + TITLE Identification of tumor-associated antigens as diagnostic and + predictive biomarkers in cancer + JOURNAL Methods Mol. Biol. 520, 1-10 (2009) + PUBMED 19381943 + REFERENCE 5 (bases 1 to 2881) + AUTHORS Dutta,J., Fan,G. and Gelinas,C. + TITLE CAPERalpha is a novel Rel-TAD-interacting factor that inhibits + lymphocyte transformation by the potent Rel/NF-kappaB oncoprotein + v-Rel + JOURNAL J. Virol. 82 (21), 10792-10802 (2008) + PUBMED 18753212 + REMARK GeneRIF: this study identifies CAPERalpha (RNA binding motif + protein 39) as a new transcriptional coregulator for v-Rel and + reveals an important role in modulating Rel's oncogenic activity. + REFERENCE 6 (bases 1 to 2881) + AUTHORS Cazalla,D., Newton,K. and Caceres,J.F. + TITLE A novel SR-related protein is required for the second step of + Pre-mRNA splicing + JOURNAL Mol. Cell. Biol. 25 (8), 2969-2980 (2005) + PUBMED 15798186 + REFERENCE 7 (bases 1 to 2881) + AUTHORS Dowhan,D.H., Hong,E.P., Auboeuf,D., Dennis,A.P., Wilson,M.M., + Berget,S.M. and O'Malley,B.W. + TITLE Steroid hormone receptor coactivation and alternative RNA splicing + by U2AF65-related proteins CAPERalpha and CAPERbeta + JOURNAL Mol. Cell 17 (3), 429-439 (2005) + PUBMED 15694343 + REFERENCE 8 (bases 1 to 2881) + AUTHORS Sun,N.N., Fastje,C.D., Wong,S.S., Sheppard,P.R., Macdonald,S.J., + Ridenour,G., Hyde,J.D. and Witten,M.L. + TITLE Dose-dependent transcriptome changes by metal ores on a human acute + lymphoblastic leukemia cell line + JOURNAL Toxicol Ind Health 19 (7-10), 157-163 (2003) + PUBMED 15747776 + REMARK GeneRIF: 10 genes were down-regulated following treatment of the + T-ALL cells with 0.15 and 1.5 microg/mL of metal ores at 72 h + REFERENCE 9 (bases 1 to 2881) + AUTHORS Jung,D.J., Na,S.Y., Na,D.S. and Lee,J.W. + TITLE Molecular cloning and characterization of CAPER, a novel + coactivator of activating protein-1 and estrogen receptors + JOURNAL J. Biol. Chem. 277 (2), 1229-1234 (2002) + PUBMED 11704680 + REMARK GeneRIF: This paper describes the mouse gene. + REFERENCE 10 (bases 1 to 2881) + AUTHORS Imai,H., Chan,E.K., Kiyosawa,K., Fu,X.D. and Tan,E.M. + TITLE Novel nuclear autoantigen with splicing factor motifs identified + with antibody from hepatocellular carcinoma + JOURNAL J. Clin. Invest. 92 (5), 2419-2426 (1993) + PUBMED 8227358 + COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The + reference sequence was derived from DC346351.1, BC141835.1 and + C75555.1. + On Jun 16, 2011 this sequence version replaced gi:35493810. + + Summary: This gene encodes a member of the U2AF65 family of + proteins. The encoded protein is found in the nucleus, where it + co-localizes with core spliceosomal proteins. It has been shown to + play a role in both steroid hormone receptor-mediated transcription + and alternative splicing, and it is also a transcriptional + coregulator of the viral oncoprotein v-Rel. Multiple transcript + variants have been observed for this gene. A related pseudogene has + been identified on chromosome X. [provided by RefSeq, Aug 2011]. + + Transcript Variant: This variant (1) encodes the longest isoform + (a, also called CC1.4). + + Publication Note: This RefSeq record includes a subset of the + publications that are available for this gene. Please see the Gene + record to access additional publications. + + ##Evidence-Data-START## + Transcript exon combination :: BC141835.1, L10911.1 [ECO:0000332] + RNAseq introns :: mixed/partial sample support + ERS025081, ERS025082 [ECO:0000350] + ##Evidence-Data-END## + COMPLETENESS: complete on the 3' end. + PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP + 1-578 DC346351.1 3-580 + 579-2872 BC141835.1 429-2722 + 2873-2881 C75555.1 1-9 c + FEATURES Location/Qualifiers + source 1..2881 + /organism="Homo sapiens" + /mol_type="mRNA" + /db_xref="taxon:9606" + /chromosome="20" + /map="20q11.22" + gene 1..2881 + /gene="RBM39" + /gene_synonym="CAPER; CAPERalpha; FSAP59; HCC1; RNPC2" + /note="RNA binding motif protein 39" + /db_xref="GeneID:9584" + /db_xref="HGNC:15923" + /db_xref="HPRD:09201" + /db_xref="MIM:604739" + exon 1..396 + /gene="RBM39" + /gene_synonym="CAPER; CAPERalpha; FSAP59; HCC1; RNPC2" + /inference="alignment:Splign:1.39.8" + STS 35..262 + /gene="RBM39" + /gene_synonym="CAPER; CAPERalpha; FSAP59; HCC1; RNPC2" + /standard_name="REN58946" + /db_xref="UniSTS:383746" + misc_feature 221..223 + /gene="RBM39" + /gene_synonym="CAPER; CAPERalpha; FSAP59; HCC1; RNPC2" + /note="upstream in-frame stop codon" + STS 299..453 + /gene="RBM39" + /gene_synonym="CAPER; CAPERalpha; FSAP59; HCC1; RNPC2" + /standard_name="G64285" + /db_xref="UniSTS:158667" + exon 397..460 + /gene="RBM39" + /gene_synonym="CAPER; CAPERalpha; FSAP59; HCC1; RNPC2" + /inference="alignment:Splign:1.39.8" + CDS 410..2002 + /gene="RBM39" + /gene_synonym="CAPER; CAPERalpha; FSAP59; HCC1; RNPC2" + /note="isoform a is encoded by transcript variant 1; + coactivator of activating protein-1 and estrogen + receptors; functional spliceosome-associated protein 59; + RNA-binding region (RNP1, RRM) containing 2; + hepatocellular carcinoma protein 1; splicing factor HCC1" + /codon_start=1 + /product="RNA-binding protein 39 isoform a" + /protein_id="NP_909122.1" + /db_xref="GI:35493811" + /db_xref="CCDS:CCDS13266.1" + /db_xref="GeneID:9584" + /db_xref="HGNC:15923" + /db_xref="HPRD:09201" + /db_xref="MIM:604739" + /translation="MADDIDIEAMLEAPYKKDENKLSSANGHEERSKKRKKSKSRSRS + HERKRSKSKERKRSRDRERKKSKSRERKRSRSKERRRSRSRSRDRRFRGRYRSPYSGP + KFNSAIRGKIGLPHSIKLSRRRSRSKSPFRKDKSPVREPIDNLTPEERDARTVFCMQL + AARIRPRDLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFVDVSSVPLAIGLTGQRV + LGVPIIVQASQAEKNRAAAMANNLQKGSAGPMRLYVGSLHFNITEDMLRGIFEPFGRI + ESIQLMMDSETGRSKGYGFITFSDSECAKKALEQLNGFELAGRPMKVGHVTERTDASS + ASSFLDSDELERTGIDLGTTGRLQLMARLAEGTGLQIPPAAQQALQMSGSLAFGAVAE + FSFVIDLQTRLSQQTEASALAAAASVQPLATQCFQLSNMFNPQTEEEVGWDTEIKDDV + IEECNKHGGVIHIYVDKNSAQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPL + PTYHNLFPDSMTATQLLVPSRR" + misc_feature 413..415 + /gene="RBM39" + /gene_synonym="CAPER; CAPERalpha; FSAP59; HCC1; RNPC2" + /experiment="experimental evidence, no additional details + recorded" + /note="N-acetylalanine; propagated from + UniProtKB/Swiss-Prot (Q14498.2); acetylation site" + + exon 461..510 + /gene="RBM39" + /gene_synonym="CAPER; CAPERalpha; FSAP59; HCC1; RNPC2" + /inference="alignment:Splign:1.39.8" + + exon 1902..2874 + /gene="RBM39" + /gene_synonym="CAPER; CAPERalpha; FSAP59; HCC1; RNPC2" + /inference="alignment:Splign:1.39.8" + STS 1956..2182 + /gene="RBM39" + /gene_synonym="CAPER; CAPERalpha; FSAP59; HCC1; RNPC2" + /standard_name="REN58786" + /db_xref="UniSTS:383586" + STS 2104..2148 + /gene="RBM39" + /gene_synonym="CAPER; CAPERalpha; FSAP59; HCC1; RNPC2" + /standard_name="D19S1033" + /db_xref="UniSTS:154759" + STS 2145..2400 + /gene="RBM39" + /gene_synonym="CAPER; CAPERalpha; FSAP59; HCC1; RNPC2" + /standard_name="REN58785" + /db_xref="UniSTS:383585" + + polyA_signal 2851..2856 + /gene="RBM39" + /gene_synonym="CAPER; CAPERalpha; FSAP59; HCC1; RNPC2" + polyA_site 2874 + /gene="RBM39" + /gene_synonym="CAPER; CAPERalpha; FSAP59; HCC1; RNPC2" + ORIGIN + 1 atttggagct tggggcagct tctcgcgaga gcccgtgctg agggctctgt gaggccccgt + 61 gtgtttgtgt gtgtgtatgt gtgctggtga atgtgagtac agggaagcag cggccgccat + 121 ttcagggagc ttgtcgacgc tgtcgcaggg gtggatcctg agctgccgaa gccgccgtcc + 181 tgctctcccg cgtgggcttc tctaattcca ttgttttttt tagattctct cgggcctagc + 241 cgtccttgga acccgatatt cgggctgggc ggttccgcgg cctgggccta ggggcttaac + + + + */ + private EbiDbEntry() { + } + + private void addCrossReference( final Accession accession ) { + if ( _cross_references == null ) { + _cross_references = new TreeSet(); } + System.out.println( "XREF ADDED: " + accession ); + _cross_references.add( accession ); } @Override - public String getSequenceName() { - return _de; + public Object clone() throws CloneNotSupportedException { + throw new CloneNotSupportedException(); } - private void setDe( final String rec_name ) { - if ( _de == null ) { - _de = rec_name; - } + @Override + public String getAccession() { + return _pa; } @Override - public String getTaxonomyScientificName() { - return _os; + public SortedSet getCrossReferences() { + return _cross_references; } - private void setOs( final String os ) { - if ( _os == null ) { - _os = os; - } + @Override + public String getGeneName() { + return _gene_name; } @Override - public String getTaxonomyIdentifier() { - return _tax_id; + public SortedSet getGoTerms() { + return null; } - private void setTaxId( final String tax_id ) { - if ( _tax_id == null ) { - _tax_id = tax_id; - } + @Override + public String getProvider() { + return _provider; + } + + @Override + public String getSequenceName() { + return _de; } @Override @@ -154,6 +612,20 @@ public final class EbiDbEntry implements SequenceDatabaseEntry { return _symbol; } + private void setSequenceSymbol( final String symbol ) { + _symbol = symbol; + } + + @Override + public String getTaxonomyIdentifier() { + return _tax_id; + } + + @Override + public String getTaxonomyScientificName() { + return _os; + } + @Override public boolean isEmpty() { return ( ForesterUtil.isEmpty( getAccession() ) && ForesterUtil.isEmpty( getSequenceName() ) @@ -161,27 +633,49 @@ public final class EbiDbEntry implements SequenceDatabaseEntry { && ForesterUtil.isEmpty( getTaxonomyIdentifier() ) && ForesterUtil.isEmpty( getSequenceSymbol() ) ); } - @Override - public String getProvider() { - return _provider; + private void setSequenceName( final String rec_name ) { + if ( _de == null ) { + _de = rec_name; + } + } + + private void setGeneName( final String gene_name ) { + if ( _gene_name == null ) { + _gene_name = gene_name; + } + } + + private void setTaxonomyScientificName( final String os ) { + if ( _os == null ) { + _os = os; + } + } + + private void setAccession( final String pa ) { + if ( _pa == null ) { + _pa = pa; + } } public void setProvider( final String provider ) { _provider = provider; } - @Override - public String getGeneName() { - return null; + private void setTaxId( final String tax_id ) { + if ( _tax_id == null ) { + _tax_id = tax_id; + } } @Override - public List getGoTerms() { - return null; + public SortedSet getAnnotations() { + return _annotations; } - @Override - public List getCrossReferences() { - return null; + private void addAnnotation( final Annotation annotation ) { + if ( _annotations == null ) { + _annotations = new TreeSet(); + } + _annotations.add( annotation ); } }