X-Git-Url: http://source.jalview.org/gitweb/?a=blobdiff_plain;ds=sidebyside;f=test%2Fjalview%2Fio%2FJSONFileTest.java;h=0fe721a879332e31d7861055676ed3ddd0c4e1e7;hb=92031091141338165383a81aa2f6ba2207603337;hp=d2960d9035c71e4ddc487d2bb8adf9a2a5a86193;hpb=f3b869801edcd73a57ddbb6adbfa02d40652625d;p=jalview.git diff --git a/test/jalview/io/JSONFileTest.java b/test/jalview/io/JSONFileTest.java index d2960d9..0fe721a 100644 --- a/test/jalview/io/JSONFileTest.java +++ b/test/jalview/io/JSONFileTest.java @@ -1,24 +1,69 @@ +/* + * Jalview - A Sequence Alignment Editor and Viewer ($$Version-Rel$$) + * Copyright (C) $$Year-Rel$$ The Jalview Authors + * + * This file is part of Jalview. + * + * Jalview is free software: you can redistribute it and/or + * modify it under the terms of the GNU General Public License + * as published by the Free Software Foundation, either version 3 + * of the License, or (at your option) any later version. + * + * Jalview is distributed in the hope that it will be useful, but + * WITHOUT ANY WARRANTY; without even the implied warranty + * of MERCHANTABILITY or FITNESS FOR A PARTICULAR + * PURPOSE. See the GNU General Public License for more details. + * + * You should have received a copy of the GNU General Public License + * along with Jalview. If not, see . + * The Jalview Authors are detailed in the 'AUTHORS' file. + */ package jalview.io; +import static org.testng.AssertJUnit.assertNotNull; + +import jalview.api.AlignExportSettingsI; +import jalview.datamodel.AlignExportSettingsAdapter; +import jalview.datamodel.Alignment; import jalview.datamodel.AlignmentAnnotation; +import jalview.datamodel.AlignmentI; import jalview.datamodel.Annotation; +import jalview.datamodel.HiddenColumns; import jalview.datamodel.Sequence; import jalview.datamodel.SequenceFeature; import jalview.datamodel.SequenceGroup; import jalview.datamodel.SequenceI; +import jalview.datamodel.features.SequenceFeatures; +import jalview.gui.AlignFrame; +import jalview.gui.JvOptionPane; +import jalview.json.binding.biojson.v1.ColourSchemeMapper; import jalview.schemes.ColourSchemeI; -import jalview.viewmodel.seqfeatures.FeaturesDisplayed; +import jalview.schemes.ResidueColourScheme; +import java.io.IOException; import java.util.ArrayList; +import java.util.HashMap; +import java.util.Iterator; +import java.util.List; +import java.util.Map; -import org.junit.After; -import org.junit.Assert; -import org.junit.Before; -import org.junit.Test; +import org.testng.Assert; +import org.testng.AssertJUnit; +import org.testng.annotations.AfterTest; +import org.testng.annotations.BeforeClass; +import org.testng.annotations.BeforeMethod; +import org.testng.annotations.BeforeTest; +import org.testng.annotations.Test; public class JSONFileTest { - private JSONFile jsonFile; + + @BeforeClass(alwaysRun = true) + public void setUpJvOptionPane() + { + JvOptionPane.setInteractiveMode(false); + JvOptionPane.setMockResponse(JvOptionPane.CANCEL_OPTION); + } private int TEST_SEQ_HEIGHT = 0; @@ -26,11 +71,39 @@ public class JSONFileTest private int TEST_ANOT_HEIGHT = 0; - @Before - public void setUp() throws Exception - { - jsonFile = new JSONFile(); + private int TEST_CS_HEIGHT = 0; + + private String TEST_JSON_FILE = "examples/example.json"; + + private Alignment alignment; + + private HashMap expectedSeqs = new HashMap<>(); + + private HashMap expectedAnnots = new HashMap<>(); + + private HashMap expectedGrps = new HashMap<>(); + + private HiddenColumns expectedColSel = new HiddenColumns(); + + private SequenceI[] expectedHiddenSeqs = new SequenceI[1]; + + private AlignmentI testAlignment; + + private int passedCount; + + private JSONFile testJsonFile; + + private JSONFile jf; + + private AlignExportSettingsI exportSettings; + @BeforeTest(alwaysRun = true) + public void setup() throws Exception + { + /* + * construct expected values + * nb this have to match the data in examples/example.json + */ // create and add sequences Sequence[] seqs = new Sequence[5]; seqs[0] = new Sequence("FER_CAPAN", @@ -44,40 +117,46 @@ public class JSONFileTest seqs[4] = new Sequence("Q7XA98_TRIPR", "ALYGTAVSTSFMRRQPVPMSV-ATTTTTKAFPSGF", 6, 39); + SequenceI hiddenSeq = new Sequence("FER_TOCH", + "FILGTMISKSFLFRKPAVTSL-KAISNVGE--ALF", 3, 34); + expectedHiddenSeqs[0] = hiddenSeq; + // create and add sequence features SequenceFeature seqFeature2 = new SequenceFeature("feature_x", - "desciption", "status", 22, 29, "jalview"); + "theDesc", 6, 15, "Jalview"); SequenceFeature seqFeature3 = new SequenceFeature("feature_x", - "desciption", "status", 25, 32, "jalview"); + "theDesc", 9, 18, "Jalview"); SequenceFeature seqFeature4 = new SequenceFeature("feature_x", - "desciption", "status", 25, 32, "jalview"); + "theDesc", 9, 18, "Jalview"); + // non-positional feature: + SequenceFeature seqFeature5 = new SequenceFeature("Domain", + "My description", 0, 0, "Pfam"); seqs[2].addSequenceFeature(seqFeature2); seqs[3].addSequenceFeature(seqFeature3); seqs[4].addSequenceFeature(seqFeature4); - - // add created features to features displayed - FeaturesDisplayed fDis = new FeaturesDisplayed(); - fDis.setVisible("feature_x"); - jsonFile.setDisplayedFeatures(fDis); - JSONFile.setSeqFeaturesEnabled(true); + seqs[2].addSequenceFeature(seqFeature5); for (Sequence seq : seqs) { - seq.setDatasetSequence(seq); - jsonFile.seqs.add(seq); + seq.createDatasetSequence(); + expectedSeqs.put(seq.getName(), seq); } - // create and add sequence groups - ArrayList grpSeqs = new ArrayList(); - grpSeqs.add(seqs[0]); + // create and add a sequence group + List grpSeqs = new ArrayList<>(); grpSeqs.add(seqs[1]); grpSeqs.add(seqs[2]); - ColourSchemeI scheme = jsonFile.getJalviewColorScheme("zappo"); - SequenceGroup seqGrp = new SequenceGroup(grpSeqs, "JGroup:1114606272", - scheme, true, true, false, 2, 9); + grpSeqs.add(seqs[3]); + grpSeqs.add(seqs[4]); + SequenceGroup seqGrp = new SequenceGroup(grpSeqs, "JGroup:1883305585", + null, true, true, false, 21, 29); + ColourSchemeI scheme = ColourSchemeMapper + .getJalviewColourScheme("zappo", seqGrp); + seqGrp.cs.setColourScheme(scheme); seqGrp.setShowNonconserved(false); seqGrp.setDescription(null); - jsonFile.seqGroups.add(seqGrp); + + expectedGrps.put(seqGrp.getName(), seqGrp); // create and add annotation Annotation[] annot = new Annotation[35]; @@ -86,130 +165,333 @@ public class JSONFileTest annot[2] = new Annotation("α", "", 'H', 0); annot[3] = new Annotation("α", "", 'H', 0); annot[4] = new Annotation("α", "", 'H', 0); - annot[5] = new Annotation("α", "", 'H', 0); + annot[5] = new Annotation("", "", '\u0000', 0); annot[6] = new Annotation("", "", '\u0000', 0); annot[7] = new Annotation("", "", '\u0000', 0); - annot[8] = new Annotation("", "", '\u0000', 0); - annot[9] = new Annotation("", "", '\u0000', 0); + annot[8] = new Annotation("β", "", 'E', 0); + annot[9] = new Annotation("β", "", 'E', 0); annot[10] = new Annotation("β", "", 'E', 0); annot[11] = new Annotation("β", "", 'E', 0); - annot[12] = new Annotation("", "", '\u0000', 0); - annot[13] = new Annotation("", "", '\u0000', 0); - annot[14] = new Annotation("", "", '\u0000', 0); - annot[15] = new Annotation("", "", '\u0000', 0); - annot[16] = new Annotation("α", "", 'H', 0); - annot[17] = new Annotation("α", "", 'H', 0); - annot[18] = new Annotation("α", "", 'H', 0); - annot[19] = new Annotation("α", "", 'H', 0); - annot[20] = new Annotation("α", "", 'H', 0); - + annot[12] = new Annotation("β", "", 'E', 0); + annot[13] = new Annotation("β", "", 'E', 0); + annot[14] = new Annotation("β", "", 'E', 0); + annot[15] = new Annotation("β", "", 'E', 0); + annot[16] = new Annotation("", "", '\u0000', 0); + annot[17] = new Annotation("", "", '\u0000', 0); + annot[18] = new Annotation("", "", '\u0000', 0); + annot[19] = new Annotation("", "", '\u0000', 0); + annot[20] = new Annotation("", "", '\u0000', 0); annot[21] = new Annotation("", "", '\u0000', 0); annot[22] = new Annotation("", "", '\u0000', 0); annot[23] = new Annotation("", "", '\u0000', 0); annot[24] = new Annotation("", "", '\u0000', 0); annot[25] = new Annotation("", "", '\u0000', 0); - annot[26] = new Annotation("", "", '\u0000', 0); - annot[27] = new Annotation("", "", '\u0000', 0); - annot[28] = new Annotation("", "", '\u0000', 0); - annot[29] = new Annotation("", "", '\u0000', 0); - annot[30] = new Annotation("", "", '\u0000', 0); + annot[26] = new Annotation("α", "", 'H', 0); + annot[27] = new Annotation("α", "", 'H', 0); + annot[28] = new Annotation("α", "", 'H', 0); + annot[29] = new Annotation("α", "", 'H', 0); + annot[30] = new Annotation("α", "", 'H', 0); annot[31] = new Annotation("", "", '\u0000', 0); - annot[32] = new Annotation("β", "", 'E', 0); - annot[33] = new Annotation("β", "", 'E', 0); - annot[34] = new Annotation("β", "", 'E', 0); + annot[32] = new Annotation("", "", '\u0000', 0); + annot[33] = new Annotation("", "", '\u0000', 0); + annot[34] = new Annotation("", "", '\u0000', 0); AlignmentAnnotation alignAnnot = new AlignmentAnnotation( "Secondary Structure", "New description", annot); - jsonFile.annotations.add(alignAnnot); + expectedAnnots.put(alignAnnot.label, alignAnnot); + + expectedColSel.hideColumns(32, 33); + expectedColSel.hideColumns(34, 34); + + TEST_SEQ_HEIGHT = expectedSeqs.size(); + TEST_GRP_HEIGHT = expectedGrps.size(); + TEST_ANOT_HEIGHT = expectedAnnots.size(); + TEST_CS_HEIGHT = expectedColSel.getNumberOfRegions(); + + exportSettings = new AlignExportSettingsAdapter(true); + + AppletFormatAdapter formatAdapter = new AppletFormatAdapter(); + try + { + alignment = (Alignment) formatAdapter.readFile(TEST_JSON_FILE, + DataSourceType.FILE, FileFormat.Json); + jf = (JSONFile) formatAdapter.getAlignFile(); + + AlignFrame af = new AlignFrame(alignment, jf.getHiddenSequences(), + jf.getHiddenColumns(), AlignFrame.DEFAULT_WIDTH, + AlignFrame.DEFAULT_HEIGHT); + af.getViewport().setShowSequenceFeatures(jf.isShowSeqFeatures()); + String colourSchemeName = jf.getGlobalColourScheme(); + ColourSchemeI cs = ColourSchemeMapper + .getJalviewColourScheme(colourSchemeName, alignment); + af.changeColour(cs); + af.getViewport().setFeaturesDisplayed(jf.getDisplayedFeatures()); + + formatAdapter = new AppletFormatAdapter(af.alignPanel, + exportSettings); + String jsonOutput = formatAdapter.formatSequences(FileFormat.Json, + af.alignPanel.getAlignment(), false); + + formatAdapter = new AppletFormatAdapter(); + testAlignment = formatAdapter.readFile(jsonOutput, + DataSourceType.PASTE, FileFormat.Json); + testJsonFile = (JSONFile) formatAdapter.getAlignFile(); + System.out.println(jsonOutput); + } catch (IOException e) + { + e.printStackTrace(); + } - // Alignment al = new Alignment(seqs); - TEST_SEQ_HEIGHT = jsonFile.seqs.size(); - TEST_GRP_HEIGHT = jsonFile.seqGroups.size(); - TEST_ANOT_HEIGHT = jsonFile.annotations.size(); } - @After + @BeforeMethod(alwaysRun = true) + public void methodSetup() + { + passedCount = 0; + } + + @AfterTest(alwaysRun = true) public void tearDown() throws Exception { + testJsonFile = null; + alignment = null; + expectedSeqs = null; + expectedAnnots = null; + expectedGrps = null; + testAlignment = null; + jf = null; } - @Test - public void test() + @Test(groups = { "Functional" }) + public void roundTripTest() { - String jsonOuput = jsonFile.print(); - // System.out.println(">>>>>>>>>>>>>> " + jsonOuput); - JSONFile output = new JSONFile().parse(jsonOuput); + assertNotNull("JSON roundtrip test failed!", testJsonFile); + } - int matchedCounter = 0; - for (SequenceI in : jsonFile.getSeqs()) + @Test(groups = { "Functional" }) + public void testSeqParsed() + { + assertNotNull("Couldn't read supplied alignment data.", testAlignment); + Assert.assertNotNull(testAlignment.getSequences()); + for (SequenceI seq : testAlignment.getSequences()) { - for (SequenceI out : output.getSeqs()) - { - if (in.getName().equals(out.getName()) - && in.getSequenceAsString().equals( - out.getSequenceAsString()) - && in.getStart() == out.getStart() - && in.getEnd() == out.getEnd() && featuresMatched(in, out)) - { - // System.out.println(">>>> Seq Match Detected"); - ++matchedCounter; - } - } + SequenceI expectedSeq = expectedSeqs.get(seq.getName()); + AssertJUnit.assertTrue( + "Failed Sequence Test for >>> " + seq.getName(), + isSeqMatched(expectedSeq, seq)); + passedCount++; } - Assert.assertTrue(matchedCounter == TEST_SEQ_HEIGHT); + AssertJUnit.assertEquals("Some Sequences did not pass the test", + TEST_SEQ_HEIGHT, passedCount); + } + + @Test(groups = { "Functional" }) + public void hiddenColsTest() + { + HiddenColumns cs = testJsonFile.getHiddenColumns(); + Assert.assertNotNull(cs); + + Iterator it = cs.iterator(); + Iterator colselit = expectedColSel.iterator(); + Assert.assertTrue(it.hasNext()); + Assert.assertEquals(cs.getNumberOfRegions(), TEST_CS_HEIGHT); + Assert.assertEquals(it.next(), colselit.next(), + "Mismatched hidden columns!"); + } + + @Test(groups = { "Functional" }) + public void hiddenSeqsTest() + { + Assert.assertNotNull(testJsonFile.getHiddenSequences(), + "Hidden sequence Expected but found Null"); + Assert.assertEquals(jf.getHiddenSequences().length, 1, + "Hidden sequence"); + } - matchedCounter = 0; - for (SequenceGroup in : jsonFile.getSeqGroups()) + @Test(groups = { "Functional" }) + public void colorSchemeTest() + { + Assert.assertNotNull(testJsonFile.getGlobalColourScheme(), + "Colourscheme is null, parsing failed!"); + Assert.assertEquals(testJsonFile.getGlobalColourScheme(), "Zappo", + "Zappo colour scheme expected!"); + } + + /** + * Test for bug JAL-2489, NPE when exporting BioJSON with global colour + * scheme, and a group colour scheme, set as 'None' + */ + @Test(groups = { "Functional" }) + public void testBioJSONRoundTripWithColourSchemeNone() + { + AppletFormatAdapter formatAdapter = new AppletFormatAdapter(); + + Alignment _alignment; + try { - for (SequenceGroup out : output.getSeqGroups()) - { - if (in.getName().equals(out.getName()) - && in.getColourText() == out.getColourText() - && in.getDisplayBoxes() == out.getDisplayBoxes() - && in.getIgnoreGapsConsensus() == out - .getIgnoreGapsConsensus() && in.cs.equals(out.cs) - && in.getSequences().size() == out.getSequences().size()) - { - // System.out.println(">>>> Grp Match Detected"); - ++matchedCounter; - } - } + // load example BioJSON file + _alignment = (Alignment) formatAdapter.readFile(TEST_JSON_FILE, + DataSourceType.FILE, FileFormat.Json); + JSONFile bioJsonFile = (JSONFile) formatAdapter.getAlignFile(); + AlignFrame alignFrame = new AlignFrame(_alignment, + bioJsonFile.getHiddenSequences(), + bioJsonFile.getHiddenColumns(), AlignFrame.DEFAULT_WIDTH, + AlignFrame.DEFAULT_HEIGHT); + + /* + * Create a group on the alignment; + * Change global and group colour scheme to 'None' and perform round trip + */ + SequenceGroup sg = new SequenceGroup(); + sg.addSequence(_alignment.getSequenceAt(0), false); + sg.setColourScheme(null); + ColourSchemeI cs = ColourSchemeMapper + .getJalviewColourScheme(ResidueColourScheme.NONE, _alignment); + alignFrame.changeColour(cs); + alignFrame.getViewport() + .setFeaturesDisplayed(bioJsonFile.getDisplayedFeatures()); + formatAdapter = new AppletFormatAdapter(alignFrame.alignPanel, + exportSettings); + // export BioJSON string + String jsonOutput = formatAdapter.formatSequences(FileFormat.Json, + alignFrame.alignPanel.getAlignment(), false); + // read back Alignment from BioJSON string + formatAdapter = new AppletFormatAdapter(); + formatAdapter.readFile(jsonOutput, DataSourceType.PASTE, + FileFormat.Json); + // assert 'None' colour scheme is retained after round trip + JSONFile _bioJsonFile = (JSONFile) formatAdapter.getAlignFile(); + Assert.assertEquals(_bioJsonFile.getGlobalColourScheme(), + ResidueColourScheme.NONE); + } catch (IOException e) + { + e.printStackTrace(); + } + } + + @Test(groups = { "Functional" }) + public void isShowSeqFeaturesSet() + { + Assert.assertTrue(testJsonFile.isShowSeqFeatures(), + "Sequence feature isDisplayed setting expected to be true"); + } + + @Test(groups = { "Functional" }) + public void testGrpParsed() + { + Assert.assertNotNull(testAlignment.getGroups()); + for (SequenceGroup seqGrp : testAlignment.getGroups()) + { + SequenceGroup expectedGrp = expectedGrps.get(seqGrp.getName()); + AssertJUnit.assertTrue( + "Failed SequenceGroup Test for >>> " + seqGrp.getName(), + isGroupMatched(expectedGrp, seqGrp)); + passedCount++; } - Assert.assertTrue(matchedCounter == TEST_GRP_HEIGHT); + AssertJUnit.assertEquals("Some SequenceGroups did not pass the test", + TEST_GRP_HEIGHT, passedCount); + } - matchedCounter = 0; - for (AlignmentAnnotation in : jsonFile.annotations) + @Test(groups = { "Functional" }) + public void testAnnotationParsed() + { + Assert.assertNotNull(testAlignment.getAlignmentAnnotation()); + for (AlignmentAnnotation annot : testAlignment.getAlignmentAnnotation()) { - for (AlignmentAnnotation out : output.annotations) + AlignmentAnnotation expectedAnnot = expectedAnnots.get(annot.label); + AssertJUnit.assertTrue( + "Failed AlignmentAnnotation Test for >>> " + annot.label, + isAnnotationMatched(expectedAnnot, annot)); + passedCount++; + } + AssertJUnit.assertEquals("Some Sequences did not pass the test", + TEST_ANOT_HEIGHT, passedCount); + } + + public boolean isAnnotationMatched(AlignmentAnnotation eAnnot, + AlignmentAnnotation annot) + { + if (!eAnnot.label.equals(annot.label) + || !eAnnot.description.equals(annot.description) + || eAnnot.annotations.length != annot.annotations.length) + { + return false; + } + + for (int x = 0; x < annot.annotations.length; x++) + { + Annotation y = annot.annotations[x]; + Annotation z = annot.annotations[x]; + + if (!y.displayCharacter.equals(z.displayCharacter) + || y.value != z.value + || y.secondaryStructure != z.secondaryStructure) { - try - { - // System.out.println("label >>>>> " + in.label + " | " + out.label); - // System.out.println("label >>>>> " + in.description + " | " - // + out.description); - // System.out.println("label >>>>> " + in.annotations.length + " | " - // + out.annotations.length); - if (in.label.equals(out.label) - && in.description.equals(out.description) - && in.annotations.length == out.annotations.length) - { - ++matchedCounter; - } - } catch (Exception e) - { - e.printStackTrace(); - } + return false; } } - // System.out.println("matched >>>>> " + matchedCounter + " | " - // + TEST_ANOT_HEIGHT); - Assert.assertTrue(matchedCounter == TEST_ANOT_HEIGHT); + return true; + } + boolean isSeqMatched(SequenceI expectedSeq, SequenceI actualSeq) + { + System.out.println("Testing >>> " + actualSeq.getName()); + + if (expectedSeq.getName().equals(actualSeq.getName()) + && expectedSeq.getSequenceAsString() + .equals(actualSeq.getSequenceAsString()) + && expectedSeq.getStart() == actualSeq.getStart() + && expectedSeq.getEnd() == actualSeq.getEnd() + && featuresMatched(expectedSeq, actualSeq)) + { + return true; + } + return false; + } + + public boolean isGroupMatched(SequenceGroup expectedGrp, + SequenceGroup actualGrp) + { + + System.out.println("Testing >>> " + actualGrp.getName()); + System.out.println(expectedGrp.getName() + " | " + actualGrp.getName()); + System.out.println(expectedGrp.getColourText() + " | " + + actualGrp.getColourText()); + System.out.println(expectedGrp.getDisplayBoxes() + " | " + + actualGrp.getDisplayBoxes()); + System.out.println(expectedGrp.getIgnoreGapsConsensus() + " | " + + actualGrp.getIgnoreGapsConsensus()); + System.out.println(expectedGrp.getSequences().size() + " | " + + actualGrp.getSequences().size()); + System.out.println( + expectedGrp.getStartRes() + " | " + actualGrp.getStartRes()); + System.out.println( + expectedGrp.getEndRes() + " | " + actualGrp.getEndRes()); + System.out.println(expectedGrp.cs.getColourScheme() + " | " + + actualGrp.cs.getColourScheme()); + + boolean colourSchemeMatches = (expectedGrp.cs.getColourScheme() == null + && actualGrp.cs.getColourScheme() == null) + || expectedGrp.cs.getColourScheme().getClass() + .equals(actualGrp.cs.getColourScheme().getClass()); + if (expectedGrp.getName().equals(actualGrp.getName()) + && expectedGrp.getColourText() == actualGrp.getColourText() + && expectedGrp.getDisplayBoxes() == actualGrp.getDisplayBoxes() + && expectedGrp.getIgnoreGapsConsensus() == actualGrp + .getIgnoreGapsConsensus() + && colourSchemeMatches + && expectedGrp.getSequences().size() == actualGrp.getSequences() + .size() + && expectedGrp.getStartRes() == actualGrp.getStartRes() + && expectedGrp.getEndRes() == actualGrp.getEndRes()) + { + return true; + } + return false; } private boolean featuresMatched(SequenceI seq1, SequenceI seq2) { - boolean matched = false; try { if (seq1 == null && seq2 == null) @@ -217,46 +499,137 @@ public class JSONFileTest return true; } - SequenceFeature[] inFeature = seq1.getSequenceFeatures(); - SequenceFeature[] outFeature = seq2.getSequenceFeatures(); + List inFeature = seq1.getFeatures().getAllFeatures(); + List outFeature = seq2.getFeatures() + .getAllFeatures(); - if (inFeature == null && outFeature == null) - { - return true; - } - else if ((inFeature == null && outFeature != null) - || (inFeature != null && outFeature == null)) + if (inFeature.size() != outFeature.size()) { + System.err.println("Feature count in: " + inFeature.size() + + ", out: " + outFeature.size()); return false; } - int testSize = inFeature.length; - int matchedCount = 0; - // System.out.println(">>>>>>>>>>>>> 1"); + SequenceFeatures.sortFeatures(inFeature, true); + SequenceFeatures.sortFeatures(outFeature, true); + int i = 0; for (SequenceFeature in : inFeature) { - for (SequenceFeature out : inFeature) + SequenceFeature out = outFeature.get(i); + /* + System.out.println(out.getType() + " | " + in.getType()); + System.out.println(out.getBegin() + " | " + in.getBegin()); + System.out.println(out.getEnd() + " | " + in.getEnd()); + */ + if (!in.equals(out)) { - if (inFeature.length == outFeature.length - && in.getBegin() == out.getBegin() - && in.getEnd() == out.getEnd() - && in.getScore() == out.getScore() - && in.getFeatureGroup().equals(out.getFeatureGroup())) - { - - ++matchedCount; - } + System.err.println( + "Mismatch of " + in.toString() + " " + out.toString()); + return false; } - } - if (testSize == matchedCount) - { - matched = true; + /* + if (in.getBegin() == out.getBegin() && in.getEnd() == out.getEnd() + && in.getScore() == out.getScore() + && in.getFeatureGroup().equals(out.getFeatureGroup()) + && in.getType().equals(out.getType()) + && mapsMatch(in.otherDetails, out.otherDetails)) + { + } + else + { + System.err.println("Feature[" + i + "] mismatch, in: " + + in.toString() + ", out: " + + outFeature.get(i).toString()); + return false; + } + */ + i++; } } catch (Exception e) { e.printStackTrace(); } // System.out.println(">>>>>>>>>>>>>> features matched : " + matched); - return matched; + return true; + } + + boolean mapsMatch(Map m1, Map m2) + { + if (m1 == null || m2 == null) + { + if (m1 != null || m2 != null) + { + System.err.println( + "only one SequenceFeature.otherDetails is not null"); + return false; + } + else + { + return true; + } + } + if (m1.size() != m2.size()) + { + System.err.println("otherDetails map different sizes"); + return false; + } + for (String key : m1.keySet()) + { + if (!m2.containsKey(key)) + { + System.err.println(key + " in only one otherDetails"); + return false; + } + if (m1.get(key) == null && m2.get(key) != null + || m1.get(key) != null && m2.get(key) == null + || !m1.get(key).equals(m2.get(key))) + { + System.err.println(key + " values in otherDetails don't match"); + return false; + } + } + return true; + } + + /** + * Test group roundtrip with null (None) group colour scheme + * + * @throws IOException + */ + @Test(groups = { "Functional" }) + public void testGrpParsed_colourNone() throws IOException + { + AlignmentI copy = new Alignment(testAlignment); + SequenceGroup sg = testAlignment.getGroups().get(0); + SequenceGroup copySg = new SequenceGroup(new ArrayList(), + sg.getName(), null, sg.getDisplayBoxes(), sg.getDisplayText(), + sg.getColourText(), sg.getStartRes(), sg.getEndRes()); + for (SequenceI seq : sg.getSequences()) + { + int seqIndex = testAlignment.findIndex(seq); + copySg.addSequence(copy.getSequenceAt(seqIndex), false); + } + copy.addGroup(copySg); + + AlignFrame af = new AlignFrame(copy, copy.getWidth(), copy.getHeight()); + AppletFormatAdapter formatAdapter = new AppletFormatAdapter( + af.alignPanel); + String jsonOutput = formatAdapter.formatSequences(FileFormat.Json, copy, + false); + formatAdapter = new AppletFormatAdapter(); + AlignmentI newAlignment = formatAdapter.readFile(jsonOutput, + DataSourceType.PASTE, FileFormat.Json); + + Assert.assertNotNull(newAlignment.getGroups()); + for (SequenceGroup seqGrp : newAlignment.getGroups()) + { + SequenceGroup expectedGrp = copySg; + AssertJUnit.assertTrue( + "Failed SequenceGroup Test for >>> " + seqGrp.getName(), + isGroupMatched(expectedGrp, seqGrp)); + passedCount++; + } + AssertJUnit.assertEquals("Some SequenceGroups did not pass the test", + TEST_GRP_HEIGHT, passedCount); } }