X-Git-Url: http://source.jalview.org/gitweb/?a=blobdiff_plain;ds=sidebyside;f=test%2Fjalview%2Fio%2FJSONFileTest.java;h=108dd319751f53ee6d4649157ff3a6ac0c7e120b;hb=f0abe70b5a54b6a9730aa5f4e2bf2bd697508757;hp=0f957ea985017bf63b6ced69dbafc8c72804e316;hpb=7431a6e01992d55b94a0b4113e19ef65932ca723;p=jalview.git diff --git a/test/jalview/io/JSONFileTest.java b/test/jalview/io/JSONFileTest.java index 0f957ea..108dd31 100644 --- a/test/jalview/io/JSONFileTest.java +++ b/test/jalview/io/JSONFileTest.java @@ -1,34 +1,70 @@ package jalview.io; + +import static org.testng.AssertJUnit.assertNotNull; + +import jalview.api.AlignExportSettingI; +import jalview.datamodel.Alignment; import jalview.datamodel.AlignmentAnnotation; +import jalview.datamodel.AlignmentI; import jalview.datamodel.Annotation; +import jalview.datamodel.ColumnSelection; import jalview.datamodel.Sequence; import jalview.datamodel.SequenceFeature; import jalview.datamodel.SequenceGroup; import jalview.datamodel.SequenceI; +import jalview.gui.AlignFrame; import jalview.schemes.ColourSchemeI; -import jalview.viewmodel.seqfeatures.FeaturesDisplayed; +import jalview.schemes.ZappoColourScheme; +import java.io.IOException; import java.util.ArrayList; +import java.util.HashMap; +import java.util.List; -import org.junit.After; -import org.junit.Assert; -import org.junit.Before; -import org.junit.Test; +import org.testng.Assert; +import org.testng.AssertJUnit; +import org.testng.annotations.AfterTest; +import org.testng.annotations.BeforeMethod; +import org.testng.annotations.BeforeTest; +import org.testng.annotations.Test; public class JSONFileTest { - private JSONFile jsonFile; private int TEST_SEQ_HEIGHT = 0; private int TEST_GRP_HEIGHT = 0; - @Before - public void setUp() throws Exception - { - jsonFile = new JSONFile(); + private int TEST_ANOT_HEIGHT = 0; + + private int TEST_CS_HEIGHT = 0; + + private String TEST_JSON_FILE = "examples/example.json"; + + private Alignment alignment; + + private HashMap expectedSeqs = new HashMap(); + + private HashMap expectedAnnots = new HashMap(); + + private HashMap expectedGrps = new HashMap(); + + private ColumnSelection expectedColSel = new ColumnSelection(); + + private SequenceI[] expectedHiddenSeqs = new SequenceI[1]; + + private AlignmentI testAlignment; + + private int passedCount; + private JSONFile testJsonFile; + + private JSONFile jf; + + @BeforeTest + public void setup() throws Exception + { // create and add sequences Sequence[] seqs = new Sequence[5]; seqs[0] = new Sequence("FER_CAPAN", @@ -42,40 +78,41 @@ public class JSONFileTest seqs[4] = new Sequence("Q7XA98_TRIPR", "ALYGTAVSTSFMRRQPVPMSV-ATTTTTKAFPSGF", 6, 39); + SequenceI hiddenSeq = new Sequence("FER_TOCH", + "FILGTMISKSFLFRKPAVTSL-KAISNVGE--ALF", 3, 34); + expectedHiddenSeqs[0] = hiddenSeq; + // create and add sequence features SequenceFeature seqFeature2 = new SequenceFeature("feature_x", - "desciption", "status", 22, 29, "jalview"); + "desciption", "status", 6, 15, "Jalview"); SequenceFeature seqFeature3 = new SequenceFeature("feature_x", - "desciption", "status", 25, 32, "jalview"); + "desciption", "status", 9, 18, "Jalview"); SequenceFeature seqFeature4 = new SequenceFeature("feature_x", - "desciption", "status", 25, 32, "jalview"); + "desciption", "status", 9, 18, "Jalview"); seqs[2].addSequenceFeature(seqFeature2); seqs[3].addSequenceFeature(seqFeature3); seqs[4].addSequenceFeature(seqFeature4); - // add created features to features displayed - FeaturesDisplayed fDis = new FeaturesDisplayed(); - fDis.setVisible("feature_x"); - jsonFile.setDisplayedFeatures(fDis); - JSONFile.setSeqFeaturesEnabled(true); for (Sequence seq : seqs) { seq.setDatasetSequence(seq); - jsonFile.seqs.add(seq); + expectedSeqs.put(seq.getName(), seq); } // create and add sequence groups ArrayList grpSeqs = new ArrayList(); - grpSeqs.add(seqs[0]); grpSeqs.add(seqs[1]); grpSeqs.add(seqs[2]); - ColourSchemeI scheme = jsonFile.getJalviewColorScheme("zappo"); - SequenceGroup seqGrp = new SequenceGroup(grpSeqs, "JGroup:1114606272", - scheme, true, true, false, 2, 9); + grpSeqs.add(seqs[3]); + grpSeqs.add(seqs[4]); + ColourSchemeI scheme = JSONFile.getJalviewColorScheme("zappo"); + SequenceGroup seqGrp = new SequenceGroup(grpSeqs, "JGroup:1883305585", + scheme, true, true, false, 21, 29); seqGrp.setShowNonconserved(false); seqGrp.setDescription(null); - jsonFile.seqGroups.add(seqGrp); + + expectedGrps.put(seqGrp.getName(), seqGrp); // create and add annotation Annotation[] annot = new Annotation[35]; @@ -84,96 +121,297 @@ public class JSONFileTest annot[2] = new Annotation("α", "", 'H', 0); annot[3] = new Annotation("α", "", 'H', 0); annot[4] = new Annotation("α", "", 'H', 0); - annot[5] = new Annotation("α", "", 'H', 0); + annot[5] = new Annotation("", "", '\u0000', 0); annot[6] = new Annotation("", "", '\u0000', 0); annot[7] = new Annotation("", "", '\u0000', 0); - annot[8] = new Annotation("", "", '\u0000', 0); - annot[9] = new Annotation("", "", '\u0000', 0); + annot[8] = new Annotation("β", "", 'E', 0); + annot[9] = new Annotation("β", "", 'E', 0); annot[10] = new Annotation("β", "", 'E', 0); annot[11] = new Annotation("β", "", 'E', 0); - annot[12] = new Annotation("", "", '\u0000', 0); - annot[13] = new Annotation("", "", '\u0000', 0); - annot[14] = new Annotation("", "", '\u0000', 0); - annot[15] = new Annotation("", "", '\u0000', 0); - annot[16] = new Annotation("α", "", 'H', 0); - annot[17] = new Annotation("α", "", 'H', 0); - annot[18] = new Annotation("α", "", 'H', 0); - annot[19] = new Annotation("α", "", 'H', 0); - annot[20] = new Annotation("α", "", 'H', 0); - + annot[12] = new Annotation("β", "", 'E', 0); + annot[13] = new Annotation("β", "", 'E', 0); + annot[14] = new Annotation("β", "", 'E', 0); + annot[15] = new Annotation("β", "", 'E', 0); + annot[16] = new Annotation("", "", '\u0000', 0); + annot[17] = new Annotation("", "", '\u0000', 0); + annot[18] = new Annotation("", "", '\u0000', 0); + annot[19] = new Annotation("", "", '\u0000', 0); + annot[20] = new Annotation("", "", '\u0000', 0); annot[21] = new Annotation("", "", '\u0000', 0); annot[22] = new Annotation("", "", '\u0000', 0); annot[23] = new Annotation("", "", '\u0000', 0); annot[24] = new Annotation("", "", '\u0000', 0); annot[25] = new Annotation("", "", '\u0000', 0); - annot[26] = new Annotation("", "", '\u0000', 0); - annot[27] = new Annotation("", "", '\u0000', 0); - annot[28] = new Annotation("", "", '\u0000', 0); - annot[29] = new Annotation("", "", '\u0000', 0); - annot[30] = new Annotation("", "", '\u0000', 0); + annot[26] = new Annotation("α", "", 'H', 0); + annot[27] = new Annotation("α", "", 'H', 0); + annot[28] = new Annotation("α", "", 'H', 0); + annot[29] = new Annotation("α", "", 'H', 0); + annot[30] = new Annotation("α", "", 'H', 0); annot[31] = new Annotation("", "", '\u0000', 0); - annot[32] = new Annotation("β", "", 'E', 0); - annot[33] = new Annotation("β", "", 'E', 0); - annot[34] = new Annotation("β", "", 'E', 0); + annot[32] = new Annotation("", "", '\u0000', 0); + annot[33] = new Annotation("", "", '\u0000', 0); + annot[34] = new Annotation("", "", '\u0000', 0); AlignmentAnnotation alignAnnot = new AlignmentAnnotation( "Secondary Structure", "New description", annot); - jsonFile.annotations.add(alignAnnot); + expectedAnnots.put(alignAnnot.label, alignAnnot); + + expectedColSel.hideColumns(32, 33); + expectedColSel.hideColumns(34, 34); + + TEST_SEQ_HEIGHT = expectedSeqs.size(); + TEST_GRP_HEIGHT = expectedGrps.size(); + TEST_ANOT_HEIGHT = expectedAnnots.size(); + TEST_CS_HEIGHT = expectedColSel.getHiddenColumns().size(); + + AlignExportSettingI exportSettings = new AlignExportSettingI() + { + @Override + public boolean isExportHiddenSequences() + { + return true; + } + + @Override + public boolean isExportHiddenColumns() + { + return true; + } + + @Override + public boolean isExportGroups() + { + return true; + } + + @Override + public boolean isExportFeatures() + { + return true; + } + + @Override + public boolean isExportAnnotations() + { + return true; + } + }; + + AppletFormatAdapter formatAdapter = new AppletFormatAdapter(); + try + { + alignment = (Alignment) formatAdapter.readFile(TEST_JSON_FILE, + AppletFormatAdapter.FILE, JSONFile.FILE_DESC); + jf = (JSONFile) formatAdapter.getAlignFile(); + + AlignFrame af = new AlignFrame(alignment, jf.getHiddenSequences(), + jf.getColumnSelection(), AlignFrame.DEFAULT_WIDTH, + AlignFrame.DEFAULT_HEIGHT); + af.getViewport().setShowSequenceFeatures(jf.isShowSeqFeatures()); + af.changeColour(jf.getColourScheme()); + af.getViewport().setFeaturesDisplayed(jf.getDisplayedFeatures()); + + + formatAdapter = new AppletFormatAdapter(af.alignPanel, exportSettings); + String jsonOutput = formatAdapter.formatSequences(JSONFile.FILE_DESC, + af.alignPanel.getAlignment(), false); + + formatAdapter = new AppletFormatAdapter(); + testAlignment = formatAdapter.readFile(jsonOutput, + AppletFormatAdapter.PASTE, JSONFile.FILE_DESC); + testJsonFile = (JSONFile) formatAdapter.getAlignFile(); + // System.out.println(jsonOutput); + } catch (IOException e) + { + e.printStackTrace(); + } - // Alignment al = new Alignment(seqs); - TEST_SEQ_HEIGHT = jsonFile.seqs.size(); - TEST_GRP_HEIGHT = jsonFile.seqGroups.size(); } - @After + @BeforeMethod + public void methodSetup() + { + passedCount = 0; + } + + @AfterTest public void tearDown() throws Exception { + testJsonFile = null; + alignment = null; + expectedSeqs = null; + expectedAnnots = null; + expectedGrps = null; + testAlignment = null; + jf = null; } - @Test - public void test() + @Test(groups ={ "Functional" }) + public void roundTripTest() { - String jsonOuput = jsonFile.print(); - // System.out.println(">>>>>>>>>>>>>> " + jsonOuput); - JSONFile output = new JSONFile().parse(jsonOuput); + assertNotNull("JSON roundtrip test failed!", testJsonFile); + } - int matchedCounter = 0; - for (SequenceI in : jsonFile.getSeqs()) + @Test(groups ={ "Functional" }) + public void testSeqParsed() + { + assertNotNull("Couldn't read supplied alignment data.", testAlignment); + Assert.assertNotNull(testAlignment.getSequences()); + for (SequenceI seq : testAlignment.getSequences()) { - for (SequenceI out : output.getSeqs()) - { - if (in.getName().equals(out.getName()) - && in.getSequenceAsString().equals( - out.getSequenceAsString()) - && in.getStart() == out.getStart() - && in.getEnd() == out.getEnd() && featuresMatched(in, out)) - { - // System.out.println(">>>> Seq Match Detected"); - ++matchedCounter; - } - } + SequenceI expectedSeq = expectedSeqs.get(seq.getName()); + AssertJUnit.assertTrue( + "Failed Sequence Test for >>> " + seq.getName(), + isSeqMatched(expectedSeq, seq)); + passedCount++; + } + AssertJUnit.assertEquals("Some Sequences did not pass the test", + TEST_SEQ_HEIGHT, passedCount); + } + + @Test(groups ={ "Functional" }) + public void hiddenColsTest() + { + ColumnSelection cs = testJsonFile.getColumnSelection(); + Assert.assertNotNull(cs); + Assert.assertNotNull(cs.getHiddenColumns()); + List hiddenCols = cs.getHiddenColumns(); + Assert.assertEquals(hiddenCols.size(), TEST_CS_HEIGHT); + Assert.assertEquals(hiddenCols, expectedColSel.getHiddenColumns(), + "Mismatched hidden columns!"); + } + + @Test(groups ={ "Functional" }) + public void hiddenSeqsTest() + { + Assert.assertNotNull(testJsonFile.getHiddenSequences(), + "Hidden sequence Expected but found Null"); + Assert.assertEquals(jf.getHiddenSequences().length, 1, + "Hidden sequece"); + } + + @Test(groups ={ "Functional" }) + public void colorSchemeTest() + { + Assert.assertNotNull(testJsonFile.getColourScheme(), + "Colourscheme is null, parsing failed!"); + Assert.assertTrue( + testJsonFile.getColourScheme() instanceof ZappoColourScheme, + "Zappo colour scheme expected!"); + } + + @Test(groups ={ "Functional" }) + public void isShowSeqFeaturesSet() + { + Assert.assertTrue(testJsonFile.isShowSeqFeatures(), + "Sequence feature isDisplayed setting expected to be true"); + } + + @Test(groups ={ "Functional" }) + public void testGrpParsed() + { + Assert.assertNotNull(testAlignment.getGroups()); + for (SequenceGroup seqGrp : testAlignment.getGroups()) + { + SequenceGroup expectedGrp = expectedGrps.get(seqGrp.getName()); + AssertJUnit.assertTrue( + "Failed SequenceGroup Test for >>> " + seqGrp.getName(), + isGroupMatched(expectedGrp, seqGrp)); + passedCount++; + } + AssertJUnit.assertEquals("Some SequenceGroups did not pass the test", + TEST_GRP_HEIGHT, passedCount); + } + + @Test(groups ={ "Functional" }) + public void testAnnotationParsed() + { + Assert.assertNotNull(testAlignment.getAlignmentAnnotation()); + for (AlignmentAnnotation annot : testAlignment.getAlignmentAnnotation()) + { + AlignmentAnnotation expectedAnnot = expectedAnnots.get(annot.label); + AssertJUnit.assertTrue("Failed AlignmentAnnotation Test for >>> " + + annot.label, isAnnotationMatched(expectedAnnot, annot)); + passedCount++; } - Assert.assertTrue(matchedCounter == TEST_SEQ_HEIGHT); + AssertJUnit.assertEquals("Some Sequences did not pass the test", + TEST_ANOT_HEIGHT, passedCount); + } - matchedCounter = 0; - for (SequenceGroup in : jsonFile.getSeqGroups()) + public boolean isAnnotationMatched(AlignmentAnnotation eAnnot, + AlignmentAnnotation annot) + { + if (!eAnnot.label.equals(annot.label) + || !eAnnot.description.equals(annot.description) + || eAnnot.annotations.length != annot.annotations.length) { - for (SequenceGroup out : output.getSeqGroups()) + return false; + } + + for (int x = 0; x < annot.annotations.length; x++) + { + Annotation y = annot.annotations[x]; + Annotation z = annot.annotations[x]; + + if (!y.displayCharacter.equals(z.displayCharacter) + || y.value != z.value + || y.secondaryStructure != z.secondaryStructure) { - if (in.getName().equals(out.getName()) - && in.getColourText() == out.getColourText() - && in.getDisplayBoxes() == out.getDisplayBoxes() - && in.getIgnoreGapsConsensus() == out - .getIgnoreGapsConsensus() && in.cs.equals(out.cs) - && in.getSequences().size() == out.getSequences().size()) - { - // System.out.println(">>>> Grp Match Detected"); - ++matchedCounter; - } + return false; } - Assert.assertTrue(matchedCounter == TEST_GRP_HEIGHT); } + return true; + } + + public boolean isSeqMatched(SequenceI expectedSeq, SequenceI actualSeq) + { + System.out.println("Testing >>> " + actualSeq.getName()); + if (expectedSeq.getName().equals(actualSeq.getName()) + && expectedSeq.getSequenceAsString().equals( + actualSeq.getSequenceAsString()) + && expectedSeq.getStart() == actualSeq.getStart() + && expectedSeq.getEnd() == actualSeq.getEnd() + && featuresMatched(expectedSeq, actualSeq)) + { + return true; + } + return false; + } + + public boolean isGroupMatched(SequenceGroup expectedGrp, + SequenceGroup actualGrp) + { + + System.out.println("Testing >>> " + actualGrp.getName()); + System.out.println(expectedGrp.getName() + " | " + actualGrp.getName()); + System.out.println(expectedGrp.getColourText() + " | " + + actualGrp.getColourText()); + System.out.println(expectedGrp.getDisplayBoxes() + " | " + + actualGrp.getDisplayBoxes()); + System.out.println(expectedGrp.getIgnoreGapsConsensus() + " | " + + actualGrp.getIgnoreGapsConsensus()); + System.out.println(expectedGrp.getSequences().size() + " | " + + actualGrp.getSequences().size()); + System.out.println(expectedGrp.getStartRes() + " | " + + actualGrp.getStartRes()); + System.out.println(expectedGrp.getEndRes() + " | " + + actualGrp.getEndRes()); + + if (expectedGrp.getName().equals(actualGrp.getName()) + && expectedGrp.getColourText() == actualGrp.getColourText() + && expectedGrp.getDisplayBoxes() == actualGrp.getDisplayBoxes() + && expectedGrp.getIgnoreGapsConsensus() == actualGrp + .getIgnoreGapsConsensus() + && expectedGrp.cs.equals(actualGrp.cs) + && expectedGrp.getSequences().size() == actualGrp + .getSequences().size() + && expectedGrp.getStartRes() == actualGrp.getStartRes() + && expectedGrp.getEndRes() == actualGrp.getEndRes()) + { + return true; + } + return false; } private boolean featuresMatched(SequenceI seq1, SequenceI seq2) @@ -201,22 +439,27 @@ public class JSONFileTest int testSize = inFeature.length; int matchedCount = 0; - // System.out.println(">>>>>>>>>>>>> 1"); for (SequenceFeature in : inFeature) { - for (SequenceFeature out : inFeature) + for (SequenceFeature out : outFeature) { + System.out.println(out.getType() + " | " + in.getType()); + System.out.println(out.getBegin() + " | " + in.getBegin()); + System.out.println(out.getEnd() + " | " + in.getEnd()); + if (inFeature.length == outFeature.length && in.getBegin() == out.getBegin() && in.getEnd() == out.getEnd() && in.getScore() == out.getScore() - && in.getFeatureGroup().equals(out.getFeatureGroup())) + && in.getFeatureGroup().equals(out.getFeatureGroup()) + && in.getType().equals(out.getType())) { ++matchedCount; } } } + System.out.println("matched count >>>>>> " + matchedCount); if (testSize == matchedCount) { matched = true;