X-Git-Url: http://source.jalview.org/gitweb/?a=blobdiff_plain;f=examples%2Ftestdata%2Fphyre2results%2F56da5616b4559c93%2Faligs%2Fc4ylfA_.79.alig.html;fp=examples%2Ftestdata%2Fphyre2results%2F56da5616b4559c93%2Faligs%2Fc4ylfA_.79.alig.html;h=a22ec4ffb43eece4cb9ba3c32a2d55db962f6e2f;hb=207b06de28859536277608ad94897eaa526b1279;hp=0000000000000000000000000000000000000000;hpb=8537d486848be3e97578248dae6bede12e343fe1;p=jalview.git diff --git a/examples/testdata/phyre2results/56da5616b4559c93/aligs/c4ylfA_.79.alig.html b/examples/testdata/phyre2results/56da5616b4559c93/aligs/c4ylfA_.79.alig.html new file mode 100644 index 0000000..a22ec4f --- /dev/null +++ b/examples/testdata/phyre2results/56da5616b4559c93/aligs/c4ylfA_.79.alig.html @@ -0,0 +1,215 @@ + +Phyre 2 alignment of FER_CAPAN_1-144 with c4ylfA_ + + + + + + + + + + +
+ +
Return to main resultsRetrieve Phyre Job Id +
+ +

+
+ + + + + +
Job DescriptionFER_CAPAN_1-144
Confidence93.26%DateWed Jan 4 12:02:18 GMT 2017
Rank79Aligned Residues31
% Identity26%Templatec4ylfA_
PDB infoPDB header:oxidoreductaseChain: A: PDB Molecule:dihydroorotate dehydrogenase b (nad(+)), electron transfer +PDBTitle: insights into flavin-based electron bifurcation via the nadh-dependent2 reduced ferredoxin-nadp oxidoreductase structure +
Resolution2.30 Å
+

+

+

+

+ + + + +
  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment
+

+ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
  71........80.........90.........100.
Predicted Secondary structure 
......
Query SS confidence 
......
Query Sequence ILDQAEEAGHDLPYS......CRAGSCSSCAGKIAGG
Query Conservation 
  
 
  
......
 
 
   
  
Alig confidence 
......
Template Conservation 
   
   
   
 
  
 
 
 
 
 
     
Template Sequence CTLKAREFGVPIWVSLNPIMVDGTGMCGACRVTVSGQ
Template Known Secondary structure TTTTS
SSSSSSS
TTTT
Template Predicted Secondary structure 
Template SS confidence 
  199200.........210.........220.........230.....
 
+ + + +
Download:Text versionFASTA version

No model constructed - rank, confidence too low

+

+

Phyre is for non-commercial use only

+

Commercial users please contact Michael Sternberg

+ + + + + + + + +
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols +10, 845-858 (2015) + [paper] + [Citation + link]
 
+ + + + + + + + + + +
© Structural Bioinformatics Group, Imperial College, London
Lawrence +Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
+ +		 + + +
+ +

Phyre2 is part of Genome3D
+

+ + +