X-Git-Url: http://source.jalview.org/gitweb/?a=blobdiff_plain;f=examples%2Ftestdata%2Fphyre2results%2F56da5616b4559c93%2Faligs%2Fd2hj1a1.81.alig.html;fp=examples%2Ftestdata%2Fphyre2results%2F56da5616b4559c93%2Faligs%2Fd2hj1a1.81.alig.html;h=7f94df5ede1534bb5b45a23e5ddd7d9522206046;hb=c51dbe7933683b64548f5353e67561d2b5e377f7;hp=0000000000000000000000000000000000000000;hpb=12d4dfa00a5e93ae1de1d8409c6d5ca2bc8af13f;p=jalview.git diff --git a/examples/testdata/phyre2results/56da5616b4559c93/aligs/d2hj1a1.81.alig.html b/examples/testdata/phyre2results/56da5616b4559c93/aligs/d2hj1a1.81.alig.html new file mode 100644 index 0000000..7f94df5 --- /dev/null +++ b/examples/testdata/phyre2results/56da5616b4559c93/aligs/d2hj1a1.81.alig.html @@ -0,0 +1,203 @@ + +Phyre 2 alignment of FER_CAPAN_1-144 with d2hj1a1 + + + + + + + + + + +
+ +
Return to main resultsRetrieve Phyre Job Id +
+ +

+
+ + + + +
Job DescriptionFER_CAPAN_1-144
Confidence49.96%DateWed Jan 4 12:02:18 GMT 2017
Rank81Aligned Residues30
% Identity10%Templated2hj1a1
SCOP infobeta-Grasp (ubiquitin-like) +MoaD/ThiS +HI0395-like +
Resolution2.10
+

+

+

+

+ + + + +
  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment
+

+ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
  51........60.........70.........80
Predicted Secondary structure 


..







Query SS confidence 









..



















Query Sequence KVKLITPDGP..IEFDCPDNVYILDQAEEAGH
Query Conservation  
      
 ..         





  


Alig confidence 









..



















Template Conservation  
 

 
  
 
  
 
  



  

  


Template Sequence EIAYAFPERYYLKSFQVDEGITVQTAITQSGI
Template Known Secondary structure TTTT

T
Template Predicted Secondary structure 











Template SS confidence 































  16...20.........30.........40.......
 
+ + + +
Download:Text versionFASTA version

No model constructed - rank, confidence too low

+


+

Phyre is for non-commercial use only

+

Commercial users please contact Michael Sternberg

+ + + + + + + + +
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols +10, 845-858 (2015) + [paper] + [Citation + link]
 
+ + + + + + + + + + +
© Structural Bioinformatics Group, Imperial College, London
Lawrence +Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
+ +
+ + +
+ +

Phyre2 is part of Genome3D
+

+ + +