X-Git-Url: http://source.jalview.org/gitweb/?a=blobdiff_plain;f=src%2Fjalview%2Fdatamodel%2FSeqCigar.java;h=09b2e89eceb926fd363218b55e732e0ef380e9aa;hb=fddf3084802b37e5cee17829e32692a4aac3e60d;hp=b18c047b907d2909680c29b4237267c5fdb6f7b2;hpb=59d682209891099d46b960509907c79e3fb276fe;p=jalview.git
diff --git a/src/jalview/datamodel/SeqCigar.java b/src/jalview/datamodel/SeqCigar.java
index b18c047..09b2e89 100644
--- a/src/jalview/datamodel/SeqCigar.java
+++ b/src/jalview/datamodel/SeqCigar.java
@@ -1,28 +1,32 @@
/*
- * Jalview - A Sequence Alignment Editor and Viewer (Version 2.8)
- * Copyright (C) 2012 J Procter, AM Waterhouse, LM Lui, J Engelhardt, G Barton, M Clamp, S Searle
+ * Jalview - A Sequence Alignment Editor and Viewer ($$Version-Rel$$)
+ * Copyright (C) $$Year-Rel$$ The Jalview Authors
*
* This file is part of Jalview.
*
* Jalview is free software: you can redistribute it and/or
* modify it under the terms of the GNU General Public License
- * as published by the Free Software Foundation, either version 3 of the License, or (at your option) any later version.
+ * as published by the Free Software Foundation, either version 3
+ * of the License, or (at your option) any later version.
*
* Jalview is distributed in the hope that it will be useful, but
* WITHOUT ANY WARRANTY; without even the implied warranty
* of MERCHANTABILITY or FITNESS FOR A PARTICULAR
* PURPOSE. See the GNU General Public License for more details.
*
- * You should have received a copy of the GNU General Public License along with Jalview. If not, see .
+ * You should have received a copy of the GNU General Public License
+ * along with Jalview. If not, see .
+ * The Jalview Authors are detailed in the 'AUTHORS' file.
*/
package jalview.datamodel;
import java.util.Enumeration;
import java.util.Hashtable;
-import java.util.Vector;
-import jalview.analysis.*;
-import jalview.util.*;
+import jalview.analysis.AlignSeq;
+import jalview.analysis.SeqsetUtils;
+import jalview.util.MessageManager;
+import jalview.util.ShiftList;
public class SeqCigar extends CigarSimple
{
@@ -91,8 +95,7 @@ public class SeqCigar extends CigarSimple
refseq.getSequenceAsString(start, end), GapChar);
if (edit_result == null)
{
- throw new Error(
- "Implementation Error - unexpected null from getSequenceAndDeletions");
+ throw new Error(MessageManager.getString("error.implementation_error_unexpected_null_from_get_sequence_and_deletions"));
}
int bounds[] = (int[]) edit_result[1];
seq = new Sequence(refseq.getName(), (String) edit_result[0],
@@ -140,11 +143,11 @@ public class SeqCigar extends CigarSimple
boolean hasgaps = false;
if (seq == null)
{
- throw new Error("Implementation Error - _setSeq(null,...)");
+ throw new Error(MessageManager.getString("error.implementation_error_set_seq_null"));
}
if (_s < 0)
{
- throw new Error("Implementation Error: _s=" + _s);
+ throw new Error(MessageManager.formatMessage("error.implementation_error_s", new String[]{Integer.valueOf(_s).toString()}));
}
String seq_string = seq.getSequenceAsString();
if (_e == 0 || _e < _s || _e > seq_string.length())
@@ -210,8 +213,7 @@ public class SeqCigar extends CigarSimple
// Check offsets
if (end > ds.getLength())
{
- throw new Error(
- "SeqCigar: Possible implementation error: sequence is longer than dataset sequence");
+ throw new Error(MessageManager.getString("error.implementation_error_seqcigar_possible"));
// end = ds.getLength();
}
@@ -235,12 +237,11 @@ public class SeqCigar extends CigarSimple
super();
if (seq == null)
{
- throw new Error("Implementation Bug. Null seq !");
+ throw new Error(MessageManager.getString("error.implmentation_bug_seq_null"));
}
if (operation.length != range.length)
{
- throw new Error(
- "Implementation Bug. Cigar Operation list!= range list");
+ throw new Error(MessageManager.getString("error.implementation_bug_cigar_operation_list_range_list"));
}
if (operation != null)
@@ -250,17 +251,14 @@ public class SeqCigar extends CigarSimple
if (_setSeq(seq, false, 0, 0))
{
- throw new Error(
- "NOT YET Implemented: Constructing a Cigar object from a cigar string and a gapped sequence.");
+ throw new Error(MessageManager.getString("error.not_yet_implemented_cigar_object_from_cigar_string"));
}
for (int i = this.length, j = 0; j < operation.length; i++, j++)
{
char op = operation[j];
if (op != M && op != I && op != D)
{
- throw new Error("Implementation Bug. Cigar Operation '" + j
- + "' '" + op + "' not one of '" + M + "', '" + I
- + "', or '" + D + "'.");
+ throw new Error(MessageManager.formatMessage("error.implementation_bug_cigar_operation", new String[]{Integer.valueOf(j).toString(),Integer.valueOf(op).toString(),Integer.valueOf(M).toString(),Integer.valueOf(I).toString(),Integer.valueOf(D).toString()}));
}
this.operation[i] = op;
this.range[i] = range[j];
@@ -274,8 +272,7 @@ public class SeqCigar extends CigarSimple
this.length = 0;
if (_setSeq(seq, false, 0, 0))
{
- throw new Error(
- "NOT YET Implemented: Constructing a Cigar object from a cigar string and a gapped sequence.");
+ throw new Error(MessageManager.getString("error.not_yet_implemented_cigar_object_from_cigar_string"));
}
}
}
@@ -382,7 +379,7 @@ public class SeqCigar extends CigarSimple
super();
if (seq == null)
{
- throw new Error("Implementation error for new Cigar(SequenceI)");
+ throw new Error(MessageManager.getString("error.implementation_error_for_new_cigar"));
}
_setSeq(seq, false, 0, 0);
// there is still work to do
@@ -404,7 +401,7 @@ public class SeqCigar extends CigarSimple
super();
if (seq == null)
{
- throw new Error("Implementation error for new Cigar(SequenceI)");
+ throw new Error(MessageManager.getString("error.implementation_error_for_new_cigar"));
}
_setSeq(seq, false, start, end + 1);
// there is still work to do
@@ -459,8 +456,7 @@ public class SeqCigar extends CigarSimple
// endcol}, hidden regions {{start, end, col}})
if (gs_regions[i] == null)
{
- throw new Error("Implementation error: " + i
- + "'th sequence Cigar has no operations.");
+ throw new Error(MessageManager.formatMessage("error.implementation_error_cigar_seq_no_operations", new String[]{Integer.valueOf(i).toString()}));
}
g_seqs[i] = new StringBuffer((String) ((Object[]) gs_regions[i])[0]); // the
// visible
@@ -544,157 +540,6 @@ public class SeqCigar extends CigarSimple
}
/**
- * non rigorous testing
- */
- /**
- *
- * @param seq
- * Sequence
- * @param ex_cs_gapped
- * String
- * @return String
- */
- public static String testCigar_string(Sequence seq, String ex_cs_gapped)
- {
- SeqCigar c_sgapped = new SeqCigar(seq);
- String cs_gapped = c_sgapped.getCigarstring();
- if (!cs_gapped.equals(ex_cs_gapped))
- {
- System.err.println("Failed getCigarstring: incorect string '"
- + cs_gapped + "' != " + ex_cs_gapped);
- }
- return cs_gapped;
- }
-
- public static boolean testSeqRecovery(SeqCigar gen_sgapped,
- SequenceI s_gapped)
- {
- // this is non-rigorous - start and end recovery is not tested.
- SequenceI gen_sgapped_s = gen_sgapped.getSeq('-');
- if (!gen_sgapped_s.getSequence().equals(s_gapped.getSequence()))
- {
- System.err.println("Couldn't reconstruct sequence.\n"
- + gen_sgapped_s.getSequenceAsString() + "\n"
- + s_gapped.getSequenceAsString());
- return false;
- }
- return true;
- }
-
- public static void main(String argv[]) throws Exception
- {
- String o_seq;
- Sequence s = new Sequence("MySeq",
- o_seq = "asdfktryasdtqwrtsaslldddptyipqqwaslchvhttt", 39, 80);
- String orig_gapped;
- Sequence s_gapped = new Sequence(
- "MySeq",
- orig_gapped = "----asdf------ktryas---dtqwrtsasll----dddptyipqqwa----slchvhttt",
- 39, 80);
- String ex_cs_gapped = "4I4M6I6M3I11M4I12M4I9M";
- s_gapped.setDatasetSequence(s);
- String sub_gapped_s;
- Sequence s_subsequence_gapped = new Sequence(
- "MySeq",
- sub_gapped_s = "------ktryas---dtqwrtsasll----dddptyipqqwa----slchvh",
- 43, 77);
-
- s_subsequence_gapped.setDatasetSequence(s);
- SeqCigar c_null = new SeqCigar(s);
- String cs_null = c_null.getCigarstring();
- if (!cs_null.equals("42M"))
- {
- System.err
- .println("Failed to recover ungapped sequence cigar operations:"
- + ((cs_null == "") ? "empty string" : cs_null));
- }
- testCigar_string(s_gapped, ex_cs_gapped);
- SeqCigar gen_sgapped = SeqCigar.parseCigar(s, ex_cs_gapped);
- if (!gen_sgapped.getCigarstring().equals(ex_cs_gapped))
- {
- System.err.println("Failed parseCigar(" + ex_cs_gapped
- + ")->getCigarString()->'" + gen_sgapped.getCigarstring()
- + "'");
- }
- testSeqRecovery(gen_sgapped, s_gapped);
- // Test dataset resolution
- SeqCigar sub_gapped = new SeqCigar(s_subsequence_gapped);
- if (!testSeqRecovery(sub_gapped, s_subsequence_gapped))
- {
- System.err
- .println("Failed recovery for subsequence of dataset sequence");
- }
- // width functions
- if (sub_gapped.getWidth() != sub_gapped_s.length())
- {
- System.err.println("Failed getWidth()");
- }
-
- sub_gapped.getFullWidth();
- if (sub_gapped.hasDeletedRegions())
- {
- System.err.println("hasDeletedRegions is incorrect.");
- }
- // Test start-end region SeqCigar
- SeqCigar sub_se_gp = new SeqCigar(s_subsequence_gapped, 8, 48);
- if (sub_se_gp.getWidth() != 41)
- {
- System.err
- .println("SeqCigar(seq, start, end) not properly clipped alignsequence.");
- }
- System.out.println("Original sequence align:\n" + sub_gapped_s
- + "\nReconstructed window from 8 to 48\n" + "XXXXXXXX"
- + sub_se_gp.getSequenceString('-') + "..." + "\nCigar String:"
- + sub_se_gp.getCigarstring() + "\n");
- SequenceI ssgp = sub_se_gp.getSeq('-');
- System.out.println("\t " + ssgp.getSequenceAsString());
- for (int r = 0; r < 10; r++)
- {
- sub_se_gp = new SeqCigar(s_subsequence_gapped, 8, 48);
- int sl = sub_se_gp.getWidth();
- int st = sl - 1 - r;
- for (int rs = 0; rs < 10; rs++)
- {
- int e = st + rs;
- sub_se_gp.deleteRange(st, e);
- String ssgapedseq = sub_se_gp.getSeq('-').getSequenceAsString();
- System.out.println(st + "," + e + "\t:" + ssgapedseq);
- st -= 3;
- }
- }
- {
- SeqCigar[] set = new SeqCigar[]
- { new SeqCigar(s), new SeqCigar(s_subsequence_gapped, 8, 48),
- new SeqCigar(s_gapped) };
- Alignment al = new Alignment(set);
- for (int i = 0; i < al.getHeight(); i++)
- {
- System.out.println("" + al.getSequenceAt(i).getName() + "\t"
- + al.getSequenceAt(i).getStart() + "\t"
- + al.getSequenceAt(i).getEnd() + "\t"
- + al.getSequenceAt(i).getSequenceAsString());
- }
- }
- {
- System.out.println("Gapped.");
- SeqCigar[] set = new SeqCigar[]
- { new SeqCigar(s), new SeqCigar(s_subsequence_gapped, 8, 48),
- new SeqCigar(s_gapped) };
- set[0].deleteRange(20, 25);
- Alignment al = new Alignment(set);
- for (int i = 0; i < al.getHeight(); i++)
- {
- System.out.println("" + al.getSequenceAt(i).getName() + "\t"
- + al.getSequenceAt(i).getStart() + "\t"
- + al.getSequenceAt(i).getEnd() + "\t"
- + al.getSequenceAt(i).getSequenceAsString());
- }
- }
- // if (!ssgapedseq.equals("ryas---dtqqwa----slchvh"))
- // System.err.println("Subseqgaped\n------ktryas---dtqwrtsasll----dddptyipqqwa----slchvhryas---dtqwrtsasll--qwa----slchvh\n"+ssgapedseq+"\n"+sub_se_gp.getCigarstring());
- }
-
- /**
* references to entities that this sequence cigar is associated with.
*/
private Hashtable selGroups = null;