X-Git-Url: http://source.jalview.org/gitweb/?a=blobdiff_plain;f=src%2Fjalview%2Fdatamodel%2FSeqCigar.java;h=8441609643c31a29453ecbd1054d105f291aef13;hb=0b2e0f52baa343973a6c9b1e652ff584ce418fa0;hp=c8965558c091ecd51888de14d18e3a124d700e61;hpb=7bc226b58110fa26d9dbd3f0c78095d06909ffc3;p=jalview.git diff --git a/src/jalview/datamodel/SeqCigar.java b/src/jalview/datamodel/SeqCigar.java index c896555..8441609 100644 --- a/src/jalview/datamodel/SeqCigar.java +++ b/src/jalview/datamodel/SeqCigar.java @@ -1,36 +1,45 @@ /* - * Jalview - A Sequence Alignment Editor and Viewer - * Copyright (C) 2007 AM Waterhouse, J Procter, G Barton, M Clamp, S Searle - * - * This program is free software; you can redistribute it and/or - * modify it under the terms of the GNU General Public License - * as published by the Free Software Foundation; either version 2 + * Jalview - A Sequence Alignment Editor and Viewer (Version 2.8.2) + * Copyright (C) 2014 The Jalview Authors + * + * This file is part of Jalview. + * + * Jalview is free software: you can redistribute it and/or + * modify it under the terms of the GNU General Public License + * as published by the Free Software Foundation, either version 3 * of the License, or (at your option) any later version. - * - * This program is distributed in the hope that it will be useful, - * but WITHOUT ANY WARRANTY; without even the implied warranty of - * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the - * GNU General Public License for more details. - * + * + * Jalview is distributed in the hope that it will be useful, but + * WITHOUT ANY WARRANTY; without even the implied warranty + * of MERCHANTABILITY or FITNESS FOR A PARTICULAR + * PURPOSE. See the GNU General Public License for more details. + * * You should have received a copy of the GNU General Public License - * along with this program; if not, write to the Free Software - * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301, USA + * along with Jalview. If not, see . + * The Jalview Authors are detailed in the 'AUTHORS' file. */ package jalview.datamodel; +import java.util.Enumeration; +import java.util.Hashtable; + import jalview.analysis.*; import jalview.util.*; -public class SeqCigar - extends CigarSimple +public class SeqCigar extends CigarSimple { /** * start(inclusive) and end(exclusive) of subsequence on refseq */ private int start, end; + private SequenceI refseq = null; + + private Hashtable seqProps; + /** * Reference dataset sequence for the cigar string + * * @return SequenceI */ public SequenceI getRefSeq() @@ -39,7 +48,7 @@ public class SeqCigar } /** - * + * * @return int start index of cigar ops on refSeq */ public int getStart() @@ -48,7 +57,7 @@ public class SeqCigar } /** - * + * * @return int end index (exclusive) of cigar ops on refSeq */ public int getEnd() @@ -58,17 +67,19 @@ public class SeqCigar /** * Returns sequence as a string with cigar operations applied to it + * * @return String */ public String getSequenceString(char GapChar) { - return (length == 0) ? "" : - (String) getSequenceAndDeletions(refseq.getSequenceAsString(start, end), - GapChar)[0]; + return (length == 0) ? "" : (String) getSequenceAndDeletions( + refseq.getSequenceAsString(start, end), GapChar)[0]; } /** - * recreates a gapped and edited version of RefSeq or null for an empty cigar string + * recreates a gapped and edited version of RefSeq or null for an empty cigar + * string + * * @return SequenceI */ public SequenceI getSeq(char GapChar) @@ -78,51 +89,63 @@ public class SeqCigar { return null; } - Object[] edit_result = getSequenceAndDeletions(refseq.getSequenceAsString( - start, end), - GapChar); + Object[] edit_result = getSequenceAndDeletions( + refseq.getSequenceAsString(start, end), GapChar); if (edit_result == null) { - throw new Error( - "Implementation Error - unexpected null from getSequenceAndDeletions"); + throw new Error(MessageManager.getString("error.implementation_error_unexpected_null_from_get_sequence_and_deletions")); } int bounds[] = (int[]) edit_result[1]; seq = new Sequence(refseq.getName(), (String) edit_result[0], - refseq.getStart() + start + bounds[0], - refseq.getStart() + start + - ( (bounds[2] == 0) ? -1 : bounds[2])); + refseq.getStart() + start + bounds[0], refseq.getStart() + + start + ((bounds[2] == 0) ? -1 : bounds[2])); + seq.setDescription(refseq.getDescription()); + int sstart = seq.getStart(), send = seq.getEnd(); // seq.checkValidRange(); probably not needed + // recover local properties if present + if (seqProps != null) + { + // this recovers dataset sequence reference as well as local features, + // names, start/end settings. + SeqsetUtils.SeqCharacterUnhash(seq, seqProps); + } + // ensure dataset sequence is up to date from local reference seq.setDatasetSequence(refseq); - seq.setDescription(refseq.getDescription()); + seq.setStart(sstart); + seq.setEnd(send); return seq; } /* - We don't allow this - refseq is given at construction time only - public void setSeq(SequenceI seq) { - this.seq = seq; - } + * We don't allow this - refseq is given at construction time only public void + * setSeq(SequenceI seq) { this.seq = seq; } */ /** - * internal constructor - sets seq to a gapless sequence derived from seq - * and prepends any 'D' operations needed to get to the first residue of seq. - * @param seq SequenceI - * @param initialDeletion true to mark initial dataset sequence residues as deleted in subsequence - * @param _s index of first position in seq - * @param _e index after last position in (possibly gapped) seq + * internal constructor - sets seq to a gapless sequence derived from seq and + * prepends any 'D' operations needed to get to the first residue of seq. + * + * @param seq + * SequenceI + * @param initialDeletion + * true to mark initial dataset sequence residues as deleted in + * subsequence + * @param _s + * index of first position in seq + * @param _e + * index after last position in (possibly gapped) seq * @return true if gaps are present in seq */ private boolean _setSeq(SequenceI seq, boolean initialDeletion, int _s, - int _e) + int _e) { boolean hasgaps = false; if (seq == null) { - throw new Error("Implementation Error - _setSeq(null,...)"); + throw new Error(MessageManager.getString("error.implementation_error_set_seq_null")); } if (_s < 0) { - throw new Error("Implementation Error: _s=" + _s); + throw new Error(MessageManager.formatMessage("error.implementation_error_s", new String[]{Integer.valueOf(_s).toString()})); } String seq_string = seq.getSequenceAsString(); if (_e == 0 || _e < _s || _e > seq_string.length()) @@ -133,13 +156,14 @@ public class SeqCigar start = seq.findPosition(_s) - seq.getStart(); end = seq.findPosition(_e) - seq.getStart(); int l_ungapped = end - start; - // Find correct sequence to reference and correct start and end - if necessary + // Find correct sequence to reference and correct start and end - if + // necessary SequenceI ds = seq.getDatasetSequence(); if (ds == null) { // make a new dataset sequence - String ungapped = AlignSeq.extractGaps(jalview.util.Comparison.GapChars, - new String(seq_string)); + String ungapped = AlignSeq.extractGaps( + jalview.util.Comparison.GapChars, new String(seq_string)); l_ungapped = ungapped.length(); // check that we haven't just duplicated an ungapped sequence. if (l_ungapped == seq.getLength()) @@ -148,11 +172,10 @@ public class SeqCigar } else { - ds = new Sequence(seq.getName(), ungapped, - seq.getStart(), - seq.getStart() + ungapped.length() - 1); + ds = new Sequence(seq.getName(), ungapped, seq.getStart(), + seq.getStart() + ungapped.length() - 1); // JBPNote: this would be consistent but may not be useful - // seq.setDatasetSequence(ds); + // seq.setDatasetSequence(ds); } } // add in offset between seq and the dataset sequence @@ -182,35 +205,41 @@ public class SeqCigar hasgaps = true; } - this.refseq = ds; - - // Check offsets + refseq = ds; + // copy over local properties for the sequence instance of the refseq + seqProps = SeqsetUtils.SeqCharacterHash(seq); + // Check offsets if (end > ds.getLength()) { - throw new Error("SeqCigar: Possible implementation error: sequence is longer than dataset sequence"); -// end = ds.getLength(); + throw new Error(MessageManager.getString("error.implementation_error_seqcigar_possible")); + // end = ds.getLength(); } return hasgaps; } /** - * directly initialise a cigar object with a sequence of range, operation pairs and a sequence to apply it to. - * operation and range should be relative to the seq.getStart()'th residue of the dataset seq resolved from seq. - * @param seq SequenceI - * @param operation char[] - * @param range int[] + * directly initialise a cigar object with a sequence of range, operation + * pairs and a sequence to apply it to. operation and range should be relative + * to the seq.getStart()'th residue of the dataset seq resolved from seq. + * + * @param seq + * SequenceI + * @param operation + * char[] + * @param range + * int[] */ public SeqCigar(SequenceI seq, char operation[], int range[]) { super(); if (seq == null) { - throw new Error("Implementation Bug. Null seq !"); + throw new Error(MessageManager.getString("error.implmentation_bug_seq_null")); } if (operation.length != range.length) { - throw new Error("Implementation Bug. Cigar Operation list!= range list"); + throw new Error(MessageManager.getString("error.implementation_bug_cigar_operation_list_range_list")); } if (operation != null) @@ -220,16 +249,14 @@ public class SeqCigar if (_setSeq(seq, false, 0, 0)) { - throw new Error("NOT YET Implemented: Constructing a Cigar object from a cigar string and a gapped sequence."); + throw new Error(MessageManager.getString("error.not_yet_implemented_cigar_object_from_cigar_string")); } for (int i = this.length, j = 0; j < operation.length; i++, j++) { char op = operation[j]; if (op != M && op != I && op != D) { - throw new Error( - "Implementation Bug. Cigar Operation '" + j + "' '" + op + - "' not one of '" + M + "', '" + I + "', or '" + D + "'."); + throw new Error(MessageManager.formatMessage("error.implementation_bug_cigar_operation", new String[]{Integer.valueOf(j).toString(),Integer.valueOf(op).toString(),Integer.valueOf(M).toString(),Integer.valueOf(I).toString(),Integer.valueOf(D).toString()})); } this.operation[i] = op; this.range[i] = range[j]; @@ -243,14 +270,16 @@ public class SeqCigar this.length = 0; if (_setSeq(seq, false, 0, 0)) { - throw new Error("NOT YET Implemented: Constructing a Cigar object from a cigar string and a gapped sequence."); + throw new Error(MessageManager.getString("error.not_yet_implemented_cigar_object_from_cigar_string")); } } } /** * add range matched residues to cigar string - * @param range int + * + * @param range + * int */ public void addMatch(int range) { @@ -258,19 +287,23 @@ public class SeqCigar } /** - * Adds - * insertion and match operations based on seq to the cigar up to - * the endpos column of seq. - * - * @param cigar CigarBase - * @param seq SequenceI - * @param startpos int - * @param endpos int - * @param initialDeletions if true then initial deletions will be added from start of seq to startpos + * Adds insertion and match operations based on seq to the cigar up to the + * endpos column of seq. + * + * @param cigar + * CigarBase + * @param seq + * SequenceI + * @param startpos + * int + * @param endpos + * int + * @param initialDeletions + * if true then initial deletions will be added from start of seq to + * startpos */ protected static void addSequenceOps(CigarBase cigar, SequenceI seq, - int startpos, int endpos, - boolean initialDeletions) + int startpos, int endpos, boolean initialDeletions) { char op = '\0'; int range = 0; @@ -283,8 +316,9 @@ public class SeqCigar while (p <= endpos) { - boolean isGap = (p < res) ? jalview.util.Comparison.isGap(seq.getCharAt(p)) : true; - if ( (startpos <= p) && (p <= endpos)) + boolean isGap = (p < res) ? jalview.util.Comparison.isGap(seq + .getCharAt(p)) : true; + if ((startpos <= p) && (p <= endpos)) { if (isGap) { @@ -334,14 +368,16 @@ public class SeqCigar /** * create a cigar string for given sequence - * @param seq SequenceI + * + * @param seq + * SequenceI */ public SeqCigar(SequenceI seq) { super(); if (seq == null) { - throw new Error("Implementation error for new Cigar(SequenceI)"); + throw new Error(MessageManager.getString("error.implementation_error_for_new_cigar")); } _setSeq(seq, false, 0, 0); // there is still work to do @@ -350,16 +386,20 @@ public class SeqCigar /** * Create Cigar from a range of gaps and residues on a sequence object - * @param seq SequenceI - * @param start int - first column in range - * @param end int - last column in range + * + * @param seq + * SequenceI + * @param start + * int - first column in range + * @param end + * int - last column in range */ public SeqCigar(SequenceI seq, int start, int end) { super(); if (seq == null) { - throw new Error("Implementation error for new Cigar(SequenceI)"); + throw new Error(MessageManager.getString("error.implementation_error_for_new_cigar")); } _setSeq(seq, false, start, end + 1); // there is still work to do @@ -367,28 +407,39 @@ public class SeqCigar } /** - * Create a cigar object from a cigar string like '[]+' - * Will fail if the given seq already contains gaps (JBPNote: future implementation will fix) - * @param seq SequenceI object resolvable to a dataset sequence - * @param cigarString String + * Create a cigar object from a cigar string like '[]+' Will + * fail if the given seq already contains gaps (JBPNote: future implementation + * will fix) + * + * @param seq + * SequenceI object resolvable to a dataset sequence + * @param cigarString + * String * @return Cigar */ public static SeqCigar parseCigar(SequenceI seq, String cigarString) - throws Exception + throws Exception { Object[] opsandrange = parseCigarString(cigarString); - return new SeqCigar(seq, (char[]) opsandrange[0], (int[]) opsandrange[1]); + return new SeqCigar(seq, (char[]) opsandrange[0], + (int[]) opsandrange[1]); } /** - * createAlignment - * - * @param alseqs SeqCigar[] - * @param gapCharacter char + * create an alignment from the given array of cigar sequences and gap + * character, and marking the given segments as visible in the given + * columselection. + * + * @param alseqs + * @param gapCharacter + * @param colsel + * - columnSelection where hidden regions are marked + * @param segments + * - visible regions of alignment * @return SequenceI[] */ public static SequenceI[] createAlignmentSequences(SeqCigar[] alseqs, - char gapCharacter, ColumnSelection colsel, int[] segments) + char gapCharacter, ColumnSelection colsel, int[] segments) { SequenceI[] seqs = new SequenceI[alseqs.length]; StringBuffer[] g_seqs = new StringBuffer[alseqs.length]; @@ -396,23 +447,27 @@ public class SeqCigar Object[] gs_regions = new Object[alseqs.length]; for (int i = 0; i < alseqs.length; i++) { - alseqs_string[i] = alseqs[i].getRefSeq(). - getSequenceAsString(alseqs[i].start, alseqs[i].end); + alseqs_string[i] = alseqs[i].getRefSeq().getSequenceAsString( + alseqs[i].start, alseqs[i].end); gs_regions[i] = alseqs[i].getSequenceAndDeletions(alseqs_string[i], - gapCharacter); // gapped sequence, {start, start col, end. endcol}, hidden regions {{start, end, col}}) + gapCharacter); // gapped sequence, {start, start col, end. + // endcol}, hidden regions {{start, end, col}}) if (gs_regions[i] == null) { - throw new Error("Implementation error: " + i + - "'th sequence Cigar has no operations."); + throw new Error(MessageManager.formatMessage("error.implementation_error_cigar_seq_no_operations", new String[]{Integer.valueOf(i).toString()})); } - g_seqs[i] = new StringBuffer( (String) ( (Object[]) gs_regions[i])[0]); // the visible gapped sequence + g_seqs[i] = new StringBuffer((String) ((Object[]) gs_regions[i])[0]); // the + // visible + // gapped + // sequence } // Now account for insertions. (well - deletions) - // this is complicated because we must keep track of shifted positions in each sequence + // this is complicated because we must keep track of shifted positions in + // each sequence ShiftList shifts = new ShiftList(); for (int i = 0; i < alseqs.length; i++) { - Object[] gs_region = ( (Object[]) ( (Object[]) gs_regions[i])[2]); + Object[] gs_region = ((Object[]) ((Object[]) gs_regions[i])[2]); if (gs_region != null) { @@ -424,7 +479,9 @@ public class SeqCigar { insert[s] = gapCharacter; } - int inspos = shifts.shift(region[2]); // resolve insertion position in current alignment frame of reference + int inspos = shifts.shift(region[2]); // resolve insertion position in + // current alignment frame of + // reference for (int s = 0; s < alseqs.length; s++) { if (s != i) @@ -434,7 +491,8 @@ public class SeqCigar // prefix insertion with more gaps. for (int l = inspos - g_seqs[s].length(); l > 0; l--) { - g_seqs[s].append(gapCharacter); // to debug - use a diffferent gap character here + g_seqs[s].append(gapCharacter); // to debug - use a diffferent + // gap character here } } g_seqs[s].insert(inspos, insert); @@ -442,11 +500,12 @@ public class SeqCigar else { g_seqs[s].insert(inspos, - alseqs_string[i].substring(region[0], - region[1] + 1)); + alseqs_string[i].substring(region[0], region[1] + 1)); } } - shifts.addShift(region[2], insert.length); // update shift in alignment frame of reference + shifts.addShift(region[2], insert.length); // update shift in + // alignment frame of + // reference if (segments == null) { // add a hidden column for this deletion @@ -457,12 +516,11 @@ public class SeqCigar } for (int i = 0; i < alseqs.length; i++) { - int[] bounds = ( (int[]) ( (Object[]) gs_regions[i])[1]); + int[] bounds = ((int[]) ((Object[]) gs_regions[i])[1]); SequenceI ref = alseqs[i].getRefSeq(); seqs[i] = new Sequence(ref.getName(), g_seqs[i].toString(), - ref.getStart() + alseqs[i].start + bounds[0], - ref.getStart() + alseqs[i].start + - (bounds[2] == 0 ? -1 : bounds[2])); + ref.getStart() + alseqs[i].start + bounds[0], ref.getStart() + + alseqs[i].start + (bounds[2] == 0 ? -1 : bounds[2])); seqs[i].setDatasetSequence(ref); seqs[i].setDescription(ref.getDescription()); } @@ -470,10 +528,10 @@ public class SeqCigar { for (int i = 0; i < segments.length; i += 3) { - //int start=shifts.shift(segments[i]-1)+1; - //int end=shifts.shift(segments[i]+segments[i+1]-1)-1; - colsel.hideColumns(segments[i + 1], - segments[i + 1] + segments[i + 2] - 1); + // int start=shifts.shift(segments[i]-1)+1; + // int end=shifts.shift(segments[i]+segments[i+1]-1)-1; + colsel.hideColumns(segments[i + 1], segments[i + 1] + + segments[i + 2] - 1); } } return seqs; @@ -483,9 +541,11 @@ public class SeqCigar * non rigorous testing */ /** - * - * @param seq Sequence - * @param ex_cs_gapped String + * + * @param seq + * Sequence + * @param ex_cs_gapped + * String * @return String */ public static String testCigar_string(Sequence seq, String ex_cs_gapped) @@ -494,71 +554,69 @@ public class SeqCigar String cs_gapped = c_sgapped.getCigarstring(); if (!cs_gapped.equals(ex_cs_gapped)) { - System.err.println("Failed getCigarstring: incorect string '" + cs_gapped + - "' != " + ex_cs_gapped); + System.err.println("Failed getCigarstring: incorect string '" + + cs_gapped + "' != " + ex_cs_gapped); } return cs_gapped; } public static boolean testSeqRecovery(SeqCigar gen_sgapped, - SequenceI s_gapped) + SequenceI s_gapped) { - // this is non-rigorous - start and end recovery is not tested. + // this is non-rigorous - start and end recovery is not tested. SequenceI gen_sgapped_s = gen_sgapped.getSeq('-'); if (!gen_sgapped_s.getSequence().equals(s_gapped.getSequence())) { - System.err.println("Couldn't reconstruct sequence.\n" + - gen_sgapped_s.getSequenceAsString() + "\n" + - s_gapped.getSequenceAsString()); + System.err.println("Couldn't reconstruct sequence.\n" + + gen_sgapped_s.getSequenceAsString() + "\n" + + s_gapped.getSequenceAsString()); return false; } return true; } - public static void main(String argv[]) - throws Exception + public static void main(String argv[]) throws Exception { String o_seq; Sequence s = new Sequence("MySeq", - o_seq = - "asdfktryasdtqwrtsaslldddptyipqqwaslchvhttt", - 39, 80); + o_seq = "asdfktryasdtqwrtsaslldddptyipqqwaslchvhttt", 39, 80); String orig_gapped; - Sequence s_gapped = new Sequence("MySeq", - orig_gapped = - "----asdf------ktryas---dtqwrtsasll----dddptyipqqwa----slchvhttt", - 39, 80); + Sequence s_gapped = new Sequence( + "MySeq", + orig_gapped = "----asdf------ktryas---dtqwrtsasll----dddptyipqqwa----slchvhttt", + 39, 80); String ex_cs_gapped = "4I4M6I6M3I11M4I12M4I9M"; s_gapped.setDatasetSequence(s); String sub_gapped_s; - Sequence s_subsequence_gapped = new Sequence("MySeq", - sub_gapped_s = - "------ktryas---dtqwrtsasll----dddptyipqqwa----slchvh", - 43, 77); + Sequence s_subsequence_gapped = new Sequence( + "MySeq", + sub_gapped_s = "------ktryas---dtqwrtsasll----dddptyipqqwa----slchvh", + 43, 77); s_subsequence_gapped.setDatasetSequence(s); SeqCigar c_null = new SeqCigar(s); String cs_null = c_null.getCigarstring(); if (!cs_null.equals("42M")) { - System.err.println( - "Failed to recover ungapped sequence cigar operations:" + - ( (cs_null == "") ? "empty string" : cs_null)); + System.err + .println("Failed to recover ungapped sequence cigar operations:" + + ((cs_null == "") ? "empty string" : cs_null)); } testCigar_string(s_gapped, ex_cs_gapped); SeqCigar gen_sgapped = SeqCigar.parseCigar(s, ex_cs_gapped); if (!gen_sgapped.getCigarstring().equals(ex_cs_gapped)) { - System.err.println("Failed parseCigar(" + ex_cs_gapped + - ")->getCigarString()->'" + gen_sgapped.getCigarstring() + - "'"); + System.err.println("Failed parseCigar(" + ex_cs_gapped + + ")->getCigarString()->'" + gen_sgapped.getCigarstring() + + "'"); } testSeqRecovery(gen_sgapped, s_gapped); // Test dataset resolution SeqCigar sub_gapped = new SeqCigar(s_subsequence_gapped); if (!testSeqRecovery(sub_gapped, s_subsequence_gapped)) { - System.err.println("Failed recovery for subsequence of dataset sequence"); + System.err + .println("Failed recovery for subsequence of dataset sequence"); } // width functions if (sub_gapped.getWidth() != sub_gapped_s.length()) @@ -575,14 +633,13 @@ public class SeqCigar SeqCigar sub_se_gp = new SeqCigar(s_subsequence_gapped, 8, 48); if (sub_se_gp.getWidth() != 41) { - System.err.println( - "SeqCigar(seq, start, end) not properly clipped alignsequence."); + System.err + .println("SeqCigar(seq, start, end) not properly clipped alignsequence."); } - System.out.println("Original sequence align:\n" + sub_gapped_s + - "\nReconstructed window from 8 to 48\n" - + "XXXXXXXX" + sub_se_gp.getSequenceString('-') + "..." - + "\nCigar String:" + sub_se_gp.getCigarstring() + "\n" - ); + System.out.println("Original sequence align:\n" + sub_gapped_s + + "\nReconstructed window from 8 to 48\n" + "XXXXXXXX" + + sub_se_gp.getSequenceString('-') + "..." + "\nCigar String:" + + sub_se_gp.getCigarstring() + "\n"); SequenceI ssgp = sub_se_gp.getSeq('-'); System.out.println("\t " + ssgp.getSequenceAsString()); for (int r = 0; r < 10; r++) @@ -601,36 +658,107 @@ public class SeqCigar } { SeqCigar[] set = new SeqCigar[] - { - new SeqCigar(s), new SeqCigar(s_subsequence_gapped, 8, 48), - new SeqCigar(s_gapped)}; + { new SeqCigar(s), new SeqCigar(s_subsequence_gapped, 8, 48), + new SeqCigar(s_gapped) }; Alignment al = new Alignment(set); for (int i = 0; i < al.getHeight(); i++) { - System.out.println("" + al.getSequenceAt(i).getName() + "\t" + - al.getSequenceAt(i).getStart() + "\t" + - al.getSequenceAt(i).getEnd() + "\t" + - al.getSequenceAt(i).getSequenceAsString()); + System.out.println("" + al.getSequenceAt(i).getName() + "\t" + + al.getSequenceAt(i).getStart() + "\t" + + al.getSequenceAt(i).getEnd() + "\t" + + al.getSequenceAt(i).getSequenceAsString()); } } { System.out.println("Gapped."); SeqCigar[] set = new SeqCigar[] - { - new SeqCigar(s), new SeqCigar(s_subsequence_gapped, 8, 48), - new SeqCigar(s_gapped)}; + { new SeqCigar(s), new SeqCigar(s_subsequence_gapped, 8, 48), + new SeqCigar(s_gapped) }; set[0].deleteRange(20, 25); Alignment al = new Alignment(set); for (int i = 0; i < al.getHeight(); i++) { - System.out.println("" + al.getSequenceAt(i).getName() + "\t" + - al.getSequenceAt(i).getStart() + "\t" + - al.getSequenceAt(i).getEnd() + "\t" + - al.getSequenceAt(i).getSequenceAsString()); + System.out.println("" + al.getSequenceAt(i).getName() + "\t" + + al.getSequenceAt(i).getStart() + "\t" + + al.getSequenceAt(i).getEnd() + "\t" + + al.getSequenceAt(i).getSequenceAsString()); } } -// if (!ssgapedseq.equals("ryas---dtqqwa----slchvh")) -// System.err.println("Subseqgaped\n------ktryas---dtqwrtsasll----dddptyipqqwa----slchvhryas---dtqwrtsasll--qwa----slchvh\n"+ssgapedseq+"\n"+sub_se_gp.getCigarstring()); + // if (!ssgapedseq.equals("ryas---dtqqwa----slchvh")) + // System.err.println("Subseqgaped\n------ktryas---dtqwrtsasll----dddptyipqqwa----slchvhryas---dtqwrtsasll--qwa----slchvh\n"+ssgapedseq+"\n"+sub_se_gp.getCigarstring()); + } + + /** + * references to entities that this sequence cigar is associated with. + */ + private Hashtable selGroups = null; + + public void setGroupMembership(Object group) + { + if (selGroups == null) + { + selGroups = new Hashtable(); + } + selGroups.put(group, new int[0]); } + /** + * Test for and if present remove association to group. + * + * @param group + * @return true if group was associated and it was removed + */ + public boolean removeGroupMembership(Object group) + { + if (selGroups != null && selGroups.containsKey(group)) + { + selGroups.remove(group); + return true; + } + return false; + } + + /** + * forget all associations for this sequence. + */ + public void clearMemberships() + { + if (selGroups != null) + { + selGroups.clear(); + } + selGroups = null; + } + + /** + * + * @return null or array of all associated entities + */ + public Object[] getAllMemberships() + { + if (selGroups == null) + { + return null; + } + Object[] mmbs = new Object[selGroups.size()]; + Enumeration en = selGroups.keys(); + for (int i = 0; en.hasMoreElements(); i++) + { + mmbs[i] = en.nextElement(); + } + return mmbs; + } + + /** + * Test for group membership + * + * @param sgr + * - a selection group or some other object that may be associated + * with seqCigar + * @return true if sgr is associated with this seqCigar + */ + public boolean isMemberOf(Object sgr) + { + return (selGroups != null) && selGroups.get(sgr) != null; + } }