X-Git-Url: http://source.jalview.org/gitweb/?a=blobdiff_plain;f=src%2Fjalview%2Fdatamodel%2FSeqCigar.java;h=9ed0388d8ce01d4669ee86bf4e9f148167749fa3;hb=58025959cd65fd79736adb061f2f381867b87738;hp=536e4eaed3480678db86ac1de18b64d0a79be74e;hpb=60508bc218cee42c6fa3405db19f7790acafabab;p=jalview.git diff --git a/src/jalview/datamodel/SeqCigar.java b/src/jalview/datamodel/SeqCigar.java index 536e4ea..9ed0388 100644 --- a/src/jalview/datamodel/SeqCigar.java +++ b/src/jalview/datamodel/SeqCigar.java @@ -1,83 +1,214 @@ +/* + * Jalview - A Sequence Alignment Editor and Viewer + * Copyright (C) 2007 AM Waterhouse, J Procter, G Barton, M Clamp, S Searle + * + * This program is free software; you can redistribute it and/or + * modify it under the terms of the GNU General Public License + * as published by the Free Software Foundation; either version 2 + * of the License, or (at your option) any later version. + * + * This program is distributed in the hope that it will be useful, + * but WITHOUT ANY WARRANTY; without even the implied warranty of + * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the + * GNU General Public License for more details. + * + * You should have received a copy of the GNU General Public License + * along with this program; if not, write to the Free Software + * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301, USA + */ package jalview.datamodel; -import jalview.analysis.AlignSeq; +import java.util.Hashtable; + +import jalview.analysis.*; +import jalview.util.*; public class SeqCigar extends CigarSimple { - - private SequenceI refseq=null; + /** + * start(inclusive) and end(exclusive) of subsequence on refseq + */ + private int start, end; + private SequenceI refseq = null; + private Hashtable seqProps; /** * Reference dataset sequence for the cigar string * @return SequenceI */ - public SequenceI getRefSeq() { + public SequenceI getRefSeq() + { return refseq; } + + /** + * + * @return int start index of cigar ops on refSeq + */ + public int getStart() + { + return start; + } + + /** + * + * @return int end index (exclusive) of cigar ops on refSeq + */ + public int getEnd() + { + return end; + } + /** * Returns sequence as a string with cigar operations applied to it * @return String */ public String getSequenceString(char GapChar) { - return (length==0) ? "" : (String) getSequenceAndDeletions(refseq.getSequence(), GapChar)[0]; + return (length == 0) ? "" : + (String) getSequenceAndDeletions(refseq.getSequenceAsString(start, end), + GapChar)[0]; } /** * recreates a gapped and edited version of RefSeq or null for an empty cigar string * @return SequenceI */ - public SequenceI getSeq(char GapChar) { + public SequenceI getSeq(char GapChar) + { Sequence seq; - if (refseq==null || length==0) + if (refseq == null || length == 0) + { return null; - Object[] edit_result=getSequenceAndDeletions(refseq.getSequence(), GapChar); - if (edit_result==null) - throw new Error("Implementation Error - unexpected null from getSequenceAndDeletions"); - - seq = new Sequence(refseq.getName(), (String) edit_result[0], refseq.getStart()+((int[]) edit_result[1])[0], refseq.getStart()+((int[]) edit_result[1])[2]); + } + Object[] edit_result = getSequenceAndDeletions(refseq.getSequenceAsString( + start, end), + GapChar); + if (edit_result == null) + { + throw new Error( + "Implementation Error - unexpected null from getSequenceAndDeletions"); + } + int bounds[] = (int[]) edit_result[1]; + seq = new Sequence(refseq.getName(), (String) edit_result[0], + refseq.getStart() + start + bounds[0], + refseq.getStart() + start + + ( (bounds[2] == 0) ? -1 : bounds[2])); + seq.setDescription(refseq.getDescription()); + int sstart = seq.getStart(), + send = seq.getEnd(); + // seq.checkValidRange(); probably not needed + // recover local properties if present + if (seqProps!=null) + { + // this recovers dataset sequence reference as well as local features, names, start/end settings. + SeqsetUtils.SeqCharacterUnhash(seq, seqProps); + } + // ensure dataset sequence is up to date from local reference seq.setDatasetSequence(refseq); + seq.setStart(sstart); + seq.setEnd(send); return seq; } + /* - We don't allow this - refseq is given at construction time only + We don't allow this - refseq is given at construction time only public void setSeq(SequenceI seq) { this.seq = seq; - } - */ + } + */ /** * internal constructor - sets seq to a gapless sequence derived from seq * and prepends any 'D' operations needed to get to the first residue of seq. * @param seq SequenceI + * @param initialDeletion true to mark initial dataset sequence residues as deleted in subsequence + * @param _s index of first position in seq + * @param _e index after last position in (possibly gapped) seq * @return true if gaps are present in seq */ - private boolean _setSeq(SequenceI seq) { - boolean hasgaps=false; - - if (seq==null) - throw new Error("Implementation Error - _setSeq(null)"); - - // Find correct sequence to reference and add initial hidden offset + private boolean _setSeq(SequenceI seq, boolean initialDeletion, int _s, + int _e) + { + boolean hasgaps = false; + if (seq == null) + { + throw new Error("Implementation Error - _setSeq(null,...)"); + } + if (_s < 0) + { + throw new Error("Implementation Error: _s=" + _s); + } + String seq_string = seq.getSequenceAsString(); + if (_e == 0 || _e < _s || _e > seq_string.length()) + { + _e = seq_string.length(); + } + // resolve start and end positions relative to ungapped reference sequence + start = seq.findPosition(_s) - seq.getStart(); + end = seq.findPosition(_e) - seq.getStart(); + int l_ungapped = end - start; + // Find correct sequence to reference and correct start and end - if necessary SequenceI ds = seq.getDatasetSequence(); - if (ds==null) { - ds = new Sequence(seq.getName(), - AlignSeq.extractGaps(jalview.util.Comparison.GapChars, new String(seq.getSequence())), - seq.getStart(), - seq.getEnd()); - } - // check that we haven't just duplicated an ungapped sequence. - if (ds.getLength()==seq.getLength()) { + if (ds == null) + { + // make a new dataset sequence + String ungapped = AlignSeq.extractGaps(jalview.util.Comparison.GapChars, + new String(seq_string)); + l_ungapped = ungapped.length(); + // check that we haven't just duplicated an ungapped sequence. + if (l_ungapped == seq.getLength()) + { ds = seq; - } else { - hasgaps = true; } - this.refseq = ds; - // Adjust offset - if (ds.getStart() ds.getLength()) + { + throw new Error("SeqCigar: Possible implementation error: sequence is longer than dataset sequence"); +// end = ds.getLength(); + } + return hasgaps; } + /** * directly initialise a cigar object with a sequence of range, operation pairs and a sequence to apply it to. * operation and range should be relative to the seq.getStart()'th residue of the dataset seq resolved from seq. @@ -85,139 +216,169 @@ public class SeqCigar * @param operation char[] * @param range int[] */ - public SeqCigar(SequenceI seq, char operation[], int range[]) { + public SeqCigar(SequenceI seq, char operation[], int range[]) + { super(); - if (seq==null) + if (seq == null) + { throw new Error("Implementation Bug. Null seq !"); - if (operation.length!=range.length) { + } + if (operation.length != range.length) + { throw new Error("Implementation Bug. Cigar Operation list!= range list"); } - if (operation!=null) { - this.operation = new char[operation.length+_inc_length]; - this.range = new int[operation.length+_inc_length]; + if (operation != null) + { + this.operation = new char[operation.length + _inc_length]; + this.range = new int[operation.length + _inc_length]; - if (_setSeq(seq)) { + if (_setSeq(seq, false, 0, 0)) + { throw new Error("NOT YET Implemented: Constructing a Cigar object from a cigar string and a gapped sequence."); } - for (int i = this.length, j=0; j < operation.length; i++,j++) + for (int i = this.length, j = 0; j < operation.length; i++, j++) { char op = operation[j]; if (op != M && op != I && op != D) { throw new Error( - "Implementation Bug. Cigar Operation '"+j+"' '"+op+"' not one of '"+M+"', '"+I+"', or '"+D+"'."); + "Implementation Bug. Cigar Operation '" + j + "' '" + op + + "' not one of '" + M + "', '" + I + "', or '" + D + "'."); } this.operation[i] = op; this.range[i] = range[j]; } - this.length+=operation.length; - } else { + this.length += operation.length; + } + else + { this.operation = null; this.range = null; - this.length=0; - if (_setSeq(seq)) { + this.length = 0; + if (_setSeq(seq, false, 0, 0)) + { throw new Error("NOT YET Implemented: Constructing a Cigar object from a cigar string and a gapped sequence."); } } } + /** * add range matched residues to cigar string * @param range int */ - public void addMatch(int range) { + public void addMatch(int range) + { this.addOperation(M, range); } + /** - * Deleted regions mean that there will be discontinuous sequence numbering in the - * sequence returned by getSeq(char). - * @return true if there are non-terminal deletions + * Adds + * insertion and match operations based on seq to the cigar up to + * the endpos column of seq. + * + * @param cigar CigarBase + * @param seq SequenceI + * @param startpos int + * @param endpos int + * @param initialDeletions if true then initial deletions will be added from start of seq to startpos */ - public boolean hasDeletedRegions() { - for (int i=1, l=length-1; i 0 && op != I) + if (isGap) { - cigar.addOperation(op, range); - range = 0; + if (range > 0 && op != I) + { + cigar.addOperation(op, range); + range = 0; + } + op = I; + range++; + } + else + { + if (range > 0 && op != M) + { + cigar.addOperation(op, range); + range = 0; + } + op = M; + range++; } - op = I; - range++; } else { - if (range > 0 && op != M) + if (!isGap) { - cigar.addOperation(op, range); - range = 0; + if (range > 0 && op != D) + { + cigar.addOperation(op, range); + range = 0; + } + op = D; + range++; } - op = M; - range++; - } - } - else - { - if (!isGap) - { - if (range > 0 && op != D) + else { - cigar.addOperation(op, range); - range = 0; + // do nothing - insertions are not made in flanking regions } - op = D; - range++; - } - else - { - // do nothing - insertions are not recorded in flanking regions. } + p++; + } + if (range > 0) + { + cigar.addOperation(op, range); } } - if (range > 0) - { - cigar.addOperation(op, range); - } - } + /** * create a cigar string for given sequence * @param seq SequenceI */ - public SeqCigar(SequenceI seq) { + public SeqCigar(SequenceI seq) + { super(); if (seq == null) - throw new Error("Implementation error for new Cigar(SequenceI)"); - if (_setSeq(seq)) { - // there is still work to do - addSequenceOps(this, seq, 0, seq.getLength()); + throw new Error("Implementation error for new Cigar(SequenceI)"); } + _setSeq(seq, false, 0, 0); + // there is still work to do + addSequenceOps(this, seq, 0, seq.getLength() - 1, false); } - public SeqCigar(SequenceI seq, int start, int end) { + + /** + * Create Cigar from a range of gaps and residues on a sequence object + * @param seq SequenceI + * @param start int - first column in range + * @param end int - last column in range + */ + public SeqCigar(SequenceI seq, int start, int end) + { super(); if (seq == null) - throw new Error("Implementation error for new Cigar(SequenceI)"); - if (_setSeq(seq)) { - // there is still work to do - addSequenceOps(this, seq, start, end); + throw new Error("Implementation error for new Cigar(SequenceI)"); } + _setSeq(seq, false, start, end + 1); + // there is still work to do + addSequenceOps(this, seq, start, end, false); } /** @@ -233,6 +394,106 @@ public class SeqCigar Object[] opsandrange = parseCigarString(cigarString); return new SeqCigar(seq, (char[]) opsandrange[0], (int[]) opsandrange[1]); } + + /** + * createAlignment + * + * @param alseqs SeqCigar[] + * @param gapCharacter char + * @return SequenceI[] + */ + public static SequenceI[] createAlignmentSequences(SeqCigar[] alseqs, + char gapCharacter, ColumnSelection colsel, int[] segments) + { + SequenceI[] seqs = new SequenceI[alseqs.length]; + StringBuffer[] g_seqs = new StringBuffer[alseqs.length]; + String[] alseqs_string = new String[alseqs.length]; + Object[] gs_regions = new Object[alseqs.length]; + for (int i = 0; i < alseqs.length; i++) + { + alseqs_string[i] = alseqs[i].getRefSeq(). + getSequenceAsString(alseqs[i].start, alseqs[i].end); + gs_regions[i] = alseqs[i].getSequenceAndDeletions(alseqs_string[i], + gapCharacter); // gapped sequence, {start, start col, end. endcol}, hidden regions {{start, end, col}}) + if (gs_regions[i] == null) + { + throw new Error("Implementation error: " + i + + "'th sequence Cigar has no operations."); + } + g_seqs[i] = new StringBuffer( (String) ( (Object[]) gs_regions[i])[0]); // the visible gapped sequence + } + // Now account for insertions. (well - deletions) + // this is complicated because we must keep track of shifted positions in each sequence + ShiftList shifts = new ShiftList(); + for (int i = 0; i < alseqs.length; i++) + { + Object[] gs_region = ( (Object[]) ( (Object[]) gs_regions[i])[2]); + if (gs_region != null) + + { + for (int hr = 0; hr < gs_region.length; hr++) + { + int[] region = (int[]) gs_region[hr]; + char[] insert = new char[region[1] - region[0] + 1]; + for (int s = 0; s < insert.length; s++) + { + insert[s] = gapCharacter; + } + int inspos = shifts.shift(region[2]); // resolve insertion position in current alignment frame of reference + for (int s = 0; s < alseqs.length; s++) + { + if (s != i) + { + if (g_seqs[s].length() <= inspos) + { + // prefix insertion with more gaps. + for (int l = inspos - g_seqs[s].length(); l > 0; l--) + { + g_seqs[s].append(gapCharacter); // to debug - use a diffferent gap character here + } + } + g_seqs[s].insert(inspos, insert); + } + else + { + g_seqs[s].insert(inspos, + alseqs_string[i].substring(region[0], + region[1] + 1)); + } + } + shifts.addShift(region[2], insert.length); // update shift in alignment frame of reference + if (segments == null) + { + // add a hidden column for this deletion + colsel.hideColumns(inspos, inspos + insert.length - 1); + } + } + } + } + for (int i = 0; i < alseqs.length; i++) + { + int[] bounds = ( (int[]) ( (Object[]) gs_regions[i])[1]); + SequenceI ref = alseqs[i].getRefSeq(); + seqs[i] = new Sequence(ref.getName(), g_seqs[i].toString(), + ref.getStart() + alseqs[i].start + bounds[0], + ref.getStart() + alseqs[i].start + + (bounds[2] == 0 ? -1 : bounds[2])); + seqs[i].setDatasetSequence(ref); + seqs[i].setDescription(ref.getDescription()); + } + if (segments != null) + { + for (int i = 0; i < segments.length; i += 3) + { + //int start=shifts.shift(segments[i]-1)+1; + //int end=shifts.shift(segments[i]+segments[i+1]-1)-1; + colsel.hideColumns(segments[i + 1], + segments[i + 1] + segments[i + 2] - 1); + } + } + return seqs; + } + /** * non rigorous testing */ @@ -242,58 +503,149 @@ public class SeqCigar * @param ex_cs_gapped String * @return String */ - public static String testCigar_string(Sequence seq, String ex_cs_gapped) { + public static String testCigar_string(Sequence seq, String ex_cs_gapped) + { SeqCigar c_sgapped = new SeqCigar(seq); String cs_gapped = c_sgapped.getCigarstring(); if (!cs_gapped.equals(ex_cs_gapped)) - System.err.println("Failed getCigarstring: incorect string '"+cs_gapped+"' != "+ex_cs_gapped); + { + System.err.println("Failed getCigarstring: incorect string '" + cs_gapped + + "' != " + ex_cs_gapped); + } return cs_gapped; } - public static boolean testSeqRecovery(SeqCigar gen_sgapped, SequenceI s_gapped) { + + public static boolean testSeqRecovery(SeqCigar gen_sgapped, + SequenceI s_gapped) + { + // this is non-rigorous - start and end recovery is not tested. SequenceI gen_sgapped_s = gen_sgapped.getSeq('-'); - if (!gen_sgapped_s.getSequence().equals(s_gapped.getSequence())) { + if (!gen_sgapped_s.getSequence().equals(s_gapped.getSequence())) + { System.err.println("Couldn't reconstruct sequence.\n" + - gen_sgapped_s.getSequence() + "\n" + - s_gapped.getSequence()); + gen_sgapped_s.getSequenceAsString() + "\n" + + s_gapped.getSequenceAsString()); return false; } return true; } - public static void main(String argv[]) throws Exception { - Sequence s=new Sequence("MySeq", "asdfktryasdtqwrtsaslldddptyipqqwaslchvhttt",39,80); + + public static void main(String argv[]) + throws Exception + { + String o_seq; + Sequence s = new Sequence("MySeq", + o_seq = + "asdfktryasdtqwrtsaslldddptyipqqwaslchvhttt", + 39, 80); String orig_gapped; - Sequence s_gapped=new Sequence("MySeq", orig_gapped="----asdf------ktryas---dtqwrtsasll----dddptyipqqwa----slchvhttt", 39,80); - String ex_cs_gapped="4I4M6I6M3I11M4I12M4I9M"; + Sequence s_gapped = new Sequence("MySeq", + orig_gapped = + "----asdf------ktryas---dtqwrtsasll----dddptyipqqwa----slchvhttt", + 39, 80); + String ex_cs_gapped = "4I4M6I6M3I11M4I12M4I9M"; s_gapped.setDatasetSequence(s); String sub_gapped_s; - Sequence s_subsequence_gapped=new Sequence("MySeq", sub_gapped_s="------ktryas---dtqwrtsasll----dddptyipqqwa----slchvh", 43,77); + Sequence s_subsequence_gapped = new Sequence("MySeq", + sub_gapped_s = + "------ktryas---dtqwrtsasll----dddptyipqqwa----slchvh", + 43, 77); s_subsequence_gapped.setDatasetSequence(s); SeqCigar c_null = new SeqCigar(s); String cs_null = c_null.getCigarstring(); - if (cs_null.length()>0) - System.err.println("Failed getCigarstring: Unexpected cigar operations:"+cs_null); + if (!cs_null.equals("42M")) + { + System.err.println( + "Failed to recover ungapped sequence cigar operations:" + + ( (cs_null == "") ? "empty string" : cs_null)); + } testCigar_string(s_gapped, ex_cs_gapped); SeqCigar gen_sgapped = SeqCigar.parseCigar(s, ex_cs_gapped); if (!gen_sgapped.getCigarstring().equals(ex_cs_gapped)) - System.err.println("Failed parseCigar("+ex_cs_gapped+")->getCigarString()->'"+gen_sgapped.getCigarstring()+"'"); + { + System.err.println("Failed parseCigar(" + ex_cs_gapped + + ")->getCigarString()->'" + gen_sgapped.getCigarstring() + + "'"); + } testSeqRecovery(gen_sgapped, s_gapped); // Test dataset resolution SeqCigar sub_gapped = new SeqCigar(s_subsequence_gapped); if (!testSeqRecovery(sub_gapped, s_subsequence_gapped)) - System.err.println("Failed recovery for subsequence of dataset sequence"); + { + System.err.println("Failed recovery for subsequence of dataset sequence"); + } // width functions - if (sub_gapped.getWidth()!=sub_gapped_s.length()) + if (sub_gapped.getWidth() != sub_gapped_s.length()) + { System.err.println("Failed getWidth()"); + } sub_gapped.getFullWidth(); if (sub_gapped.hasDeletedRegions()) + { System.err.println("hasDeletedRegions is incorrect."); + } // Test start-end region SeqCigar - SeqCigar sub_se_gp= new SeqCigar(s_subsequence_gapped, 8, 48); - if (sub_se_gp.getWidth()!=40) - System.err.println("SeqCigar(seq, start, end) not properly clipped alignsequence."); - System.out.println("Original sequence align:\n"+sub_gapped_s+"\nReconstructed window from 8 to 48\n"+"XXXXXXXX"+sub_se_gp.getSequenceString('-')+"...."+"\nCigar String:"+sub_se_gp.getCigarstring()+""); + SeqCigar sub_se_gp = new SeqCigar(s_subsequence_gapped, 8, 48); + if (sub_se_gp.getWidth() != 41) + { + System.err.println( + "SeqCigar(seq, start, end) not properly clipped alignsequence."); + } + System.out.println("Original sequence align:\n" + sub_gapped_s + + "\nReconstructed window from 8 to 48\n" + + "XXXXXXXX" + sub_se_gp.getSequenceString('-') + "..." + + "\nCigar String:" + sub_se_gp.getCigarstring() + "\n" + ); + SequenceI ssgp = sub_se_gp.getSeq('-'); + System.out.println("\t " + ssgp.getSequenceAsString()); + for (int r = 0; r < 10; r++) + { + sub_se_gp = new SeqCigar(s_subsequence_gapped, 8, 48); + int sl = sub_se_gp.getWidth(); + int st = sl - 1 - r; + for (int rs = 0; rs < 10; rs++) + { + int e = st + rs; + sub_se_gp.deleteRange(st, e); + String ssgapedseq = sub_se_gp.getSeq('-').getSequenceAsString(); + System.out.println(st + "," + e + "\t:" + ssgapedseq); + st -= 3; + } + } + { + SeqCigar[] set = new SeqCigar[] + { + new SeqCigar(s), new SeqCigar(s_subsequence_gapped, 8, 48), + new SeqCigar(s_gapped)}; + Alignment al = new Alignment(set); + for (int i = 0; i < al.getHeight(); i++) + { + System.out.println("" + al.getSequenceAt(i).getName() + "\t" + + al.getSequenceAt(i).getStart() + "\t" + + al.getSequenceAt(i).getEnd() + "\t" + + al.getSequenceAt(i).getSequenceAsString()); + } + } + { + System.out.println("Gapped."); + SeqCigar[] set = new SeqCigar[] + { + new SeqCigar(s), new SeqCigar(s_subsequence_gapped, 8, 48), + new SeqCigar(s_gapped)}; + set[0].deleteRange(20, 25); + Alignment al = new Alignment(set); + for (int i = 0; i < al.getHeight(); i++) + { + System.out.println("" + al.getSequenceAt(i).getName() + "\t" + + al.getSequenceAt(i).getStart() + "\t" + + al.getSequenceAt(i).getEnd() + "\t" + + al.getSequenceAt(i).getSequenceAsString()); + } + } +// if (!ssgapedseq.equals("ryas---dtqqwa----slchvh")) +// System.err.println("Subseqgaped\n------ktryas---dtqwrtsasll----dddptyipqqwa----slchvhryas---dtqwrtsasll--qwa----slchvh\n"+ssgapedseq+"\n"+sub_se_gp.getCigarstring()); } }