X-Git-Url: http://source.jalview.org/gitweb/?a=blobdiff_plain;f=test%2Fjalview%2Fdatamodel%2FAlignmentTest.java;h=30c0de41488e5db9c6e232405cf26a2538603657;hb=704baca645bf14c607a8a4bede678253a50e7123;hp=1c27420c21aea5abd091c0e7542b708782dfbc0c;hpb=4b7d3640209c4434d569c746672cf9eed4250ace;p=jalview.git diff --git a/test/jalview/datamodel/AlignmentTest.java b/test/jalview/datamodel/AlignmentTest.java index 1c27420..30c0de4 100644 --- a/test/jalview/datamodel/AlignmentTest.java +++ b/test/jalview/datamodel/AlignmentTest.java @@ -38,9 +38,12 @@ import org.testng.annotations.BeforeMethod; import org.testng.annotations.Test; import jalview.analysis.AlignmentGenerator; +import jalview.analysis.AlignmentUtils; +import jalview.analysis.CrossRef; import jalview.datamodel.AlignedCodonFrame.SequenceToSequenceMapping; import jalview.gui.JvOptionPane; import jalview.io.DataSourceType; +import jalview.io.FastaFile; import jalview.io.FileFormat; import jalview.io.FileFormatI; import jalview.io.FormatAdapter; @@ -94,6 +97,28 @@ public class AlignmentTest "GCTCGUCGTACT\n" + ">Seq2Name/60-71\n" + "GGGTCAGGCAGT\n"; + + private static final String AA_SEQS_2 = + ">Seq1Name/5-8\n" + + "K-QY-L\n" + + ">Seq2Name/12-15\n" + + "-R-FPW\n"; + private static final String AA_SEQS_2_DS = + ">Seq1Name/5-8\n" + + "KQYL\n" + + ">Seq2Name/12-15\n" + + "RFPW\n"; + private static final String TD_SEQS_2_DS = + ">Seq1Name/5-8\n" + + "NMPR\n" + + ">Seq2Name/12-15\n" + + "VXYA\n"; + private static final String TD_SEQS_2 = + ">Seq1Name/5-8\n" + + "-NMP-R\n" + + ">Seq2Name/12-15\n" + + "VX--YA\n"; + // @formatter:on private AlignmentI al; @@ -775,6 +800,59 @@ public class AlignmentTest assertEquals("-R-F-P-W", al2.getSequenceAt(1).getSequenceAsString()); } + + /** + * Recover protein MSA from tdi msa + * + * @throws IOException + */ + @Test(groups = { "Functional" }) + public void testAlignAs_prot_tdi() throws Exception + { + // see also AlignmentUtilsTests + AlignmentI al1 = loadAlignment(TD_SEQS_2, FileFormat.Fasta); + AlignmentI al2 = loadAlignment(AA_SEQS_2_DS, FileFormat.Fasta); + al1.setDataset(null); + al2.setDataset(al1.getDataset()); + AlignmentI al1copy = new Alignment(al1); + AlignmentI al2copy = new Alignment(al2); + AlignmentUtils.map3diPeptideToProteinAligment(al2, al1); + if (al2.getCodonFrames().isEmpty()) {al2.getCodonFrames().addAll(al1.getCodonFrames()); } + else {al1.getCodonFrames().addAll(al2.getCodonFrames()); }; + + ((Alignment) al2).alignAs(al1); + assertEquals("-NMP-R", al1.getSequenceAt(0).getSequenceAsString()); + assertEquals("VX--YA", al1.getSequenceAt(1).getSequenceAsString()); + assertEquals("-KQY-L", al2.getSequenceAt(0).getSequenceAsString()); + assertEquals("RF--PW", al2.getSequenceAt(1).getSequenceAsString()); + + } + /** + * Recover TdI MSA from protein msa + * + * @throws IOException + */ + @Test(groups = { "Functional" }) + public void testAlignAs_tdi_prot() throws Exception + { + // see also AlignmentUtilsTests + AlignmentI al1 = loadAlignment(AA_SEQS_2, FileFormat.Fasta); + AlignmentI al2 = loadAlignment(TD_SEQS_2_DS, FileFormat.Fasta); + al1.setDataset(null); + al2.setDataset(al1.getDataset()); + AlignmentI al1copy = new Alignment(al1); + AlignmentI al2copy = new Alignment(al2); + AlignmentUtils.map3diPeptideToProteinAligment(al1, al2); + if (al2.getCodonFrames().isEmpty()) {al2.getCodonFrames().addAll(al1.getCodonFrames()); } + else {al1.getCodonFrames().addAll(al2.getCodonFrames()); }; + + ((Alignment) al2).alignAs(al1); + assertEquals("K-QY-L", al1.getSequenceAt(0).getSequenceAsString()); + assertEquals("-R-FPW", al1.getSequenceAt(1).getSequenceAsString()); + assertEquals("N-MP-R", al2.getSequenceAt(0).getSequenceAsString()); + assertEquals("-V-XYA", al2.getSequenceAt(1).getSequenceAsString()); + + } /** * Test aligning cdna as per protein alignment. * @@ -829,6 +907,59 @@ public class AlignmentTest } /** + * test mapping between a protein and 3di sequence alignment. Assumes 1:1 + * @throws IOException + */ + @Test(groups={"Functional"},enabled=true) + public void testAlignAs_3di() throws IOException + { + String protAl = ">1ji5_A\n" + + "-----------------------------DQPVLLLLLLQLLLLLVLLLQQLVVCLVQAD\n" + + "DPCNVVSNVVSVVSSVVSVVSNVVSQVVCVVVVHHHDDDVSSVVRYPQDHHDPP--DYPL\n" + + "RSLVSLLVSLVVVLVSLVVSLVSCVVVVNVVSNVSSVVVSVVSVVSNVVSCVVVVD----\n" + + "---------------------------------------------------\n" + + ">1jig_A\n" + + "---------------------------DALLVVLLLLLLQLLLALVLLLQQLVLCLVLAD\n" + + "DPCNVVSNVVSVVVSVVSVVSNVVSQVVCVVSVHHHDDDVSSVVRYPQDHDDSP--DYPL\n" + + "RSLVSLLVSLVVLLVSLVVSLVSCVVNVNPVSNVSSVVSSVVSVVSNVVSVVVND-----\n" + + "---------------------------------------------------\n" + + "\n"; + String tdiAl = ">1ji5_A\n" + + "-----------------------------MNKQVIEVLNKQVADWSVLFTKLHNFHWYVK\n" + + "GPQFFTLHEKFEELYTESATHIDEIAERILAIGGKPVATKEYLEISSIQEAAYG--ETAE\n" + + "GMVEAIMKDYEMMLVELKKGMEIAQNSDDEMTSDLLLGIYTELEKHAWMLRAFLNQ----\n" + + "---------------------------------------------------\n" + + ">1jig_A\n" + + "---------------------------MSTKTNVVEVLNKQVANWNVLYVKLHNYHWYVT\n" + + "GPHFFTLHEKFEEFYNEAGTYIDELAERILALEGKPLATKEYLATSSVNEGTSK--ESAE\n" + + "EMVQTLVNDYSALIQELKEGMEVAGEAGDATSADMLLAIHTTLEQHVWMLSAFLK-----\n" + + "---------------------------------------------------\n" + ""; + AlignmentI prot = loadAlignment(protAl, FileFormat.Fasta); + ((Alignment) prot).createDatasetAlignment(); + + AlignmentI tdi = loadAlignment(tdiAl, FileFormat.Fasta); + assertTrue(AlignmentUtils.map3diPeptideToProteinAligment(prot, tdi)); + + AlignmentI newProt = new Alignment( + new SequenceI[] + { prot.getSequenceAt(0).getSubSequence(25, 35), + prot.getSequenceAt(1).getSubSequence(35, 45) }); + newProt.setDataset(prot.getDataset()); + + // TODO Find matching tdi sequence and construct alignment mirroring + // the protein alignment + // Alignment newTdi = new CrossRef(newProt.getSequencesArray(), + // newProt.getDataset()).findXrefSequences("", false); + // + // newTdi.alignAs(newProt); + // + // System.out.println("newProt - aa\n"+new + // FastaFile().print(newProt.getSequencesArray(), true)); + // System.out.println("newProt - 3di\n"+new + // FastaFile().print(newTdi.getSequencesArray(), true)); + + } + /** * Helper method that makes mappings and then aligns the first alignment as * the second * @@ -857,7 +988,7 @@ public class AlignmentTest /** * Helper method to make mappings between sequences, and add the mappings to - * the 'mapped from' alignment + * the 'mapped from' alignment. If alFrom.isNucleotide() == alTo.isNucleotide() then ratio is always 1:1 * * @param alFrom * @param alTo