X-Git-Url: http://source.jalview.org/gitweb/?a=blobdiff_plain;f=test%2Fjalview%2Fdatamodel%2FAlignmentTest.java;h=30c0de41488e5db9c6e232405cf26a2538603657;hb=704baca645bf14c607a8a4bede678253a50e7123;hp=8aed11451f6051c95711a7fa81d3170f77bdbf7c;hpb=06476b6d02ef690bf684905cba39eb7b5db7525b;p=jalview.git diff --git a/test/jalview/datamodel/AlignmentTest.java b/test/jalview/datamodel/AlignmentTest.java index 8aed114..30c0de4 100644 --- a/test/jalview/datamodel/AlignmentTest.java +++ b/test/jalview/datamodel/AlignmentTest.java @@ -27,16 +27,6 @@ import static org.testng.AssertJUnit.assertNull; import static org.testng.AssertJUnit.assertSame; import static org.testng.AssertJUnit.assertTrue; -import jalview.analysis.AlignmentGenerator; -import jalview.datamodel.AlignedCodonFrame.SequenceToSequenceMapping; -import jalview.gui.JvOptionPane; -import jalview.io.DataSourceType; -import jalview.io.FileFormat; -import jalview.io.FileFormatI; -import jalview.io.FormatAdapter; -import jalview.util.Comparison; -import jalview.util.MapList; - import java.io.IOException; import java.util.Arrays; import java.util.Iterator; @@ -47,6 +37,19 @@ import org.testng.annotations.BeforeClass; import org.testng.annotations.BeforeMethod; import org.testng.annotations.Test; +import jalview.analysis.AlignmentGenerator; +import jalview.analysis.AlignmentUtils; +import jalview.analysis.CrossRef; +import jalview.datamodel.AlignedCodonFrame.SequenceToSequenceMapping; +import jalview.gui.JvOptionPane; +import jalview.io.DataSourceType; +import jalview.io.FastaFile; +import jalview.io.FileFormat; +import jalview.io.FileFormatI; +import jalview.io.FormatAdapter; +import jalview.util.Comparison; +import jalview.util.MapList; + /** * Unit tests for Alignment datamodel. * @@ -94,6 +97,28 @@ public class AlignmentTest "GCTCGUCGTACT\n" + ">Seq2Name/60-71\n" + "GGGTCAGGCAGT\n"; + + private static final String AA_SEQS_2 = + ">Seq1Name/5-8\n" + + "K-QY-L\n" + + ">Seq2Name/12-15\n" + + "-R-FPW\n"; + private static final String AA_SEQS_2_DS = + ">Seq1Name/5-8\n" + + "KQYL\n" + + ">Seq2Name/12-15\n" + + "RFPW\n"; + private static final String TD_SEQS_2_DS = + ">Seq1Name/5-8\n" + + "NMPR\n" + + ">Seq2Name/12-15\n" + + "VXYA\n"; + private static final String TD_SEQS_2 = + ">Seq1Name/5-8\n" + + "-NMP-R\n" + + ">Seq2Name/12-15\n" + + "VX--YA\n"; + // @formatter:on private AlignmentI al; @@ -193,8 +218,8 @@ public class AlignmentTest return false; } } - return verifyAlignmentDatasetRefs(alignment.getDataset(), - raiseAssert, message); + return verifyAlignmentDatasetRefs(alignment.getDataset(), raiseAssert, + message); } else { @@ -247,9 +272,8 @@ public class AlignmentTest { if (raiseAssert) { - Assert.fail(message - + " DBRefEntry " + dbr + " for sequence " - + seqds + Assert.fail(message + " DBRefEntry " + dbr + + " for sequence " + seqds + " in alignment has map to sequence not in dataset"); } return false; @@ -335,7 +359,8 @@ public class AlignmentTest ae.printStackTrace(); Assert.fail( "Valid test alignment raised assertion errors when raiseAsserts enabled: " - + msg, ae); + + msg, + ae); } // also check validation passes with asserts disabled Assert.assertTrue(verifyAlignmentDatasetRefs(al, false, null), @@ -355,8 +380,9 @@ public class AlignmentTest } if (!assertRaised) { - Assert.fail("Invalid test alignment passed when raiseAsserts enabled:" - + msg); + Assert.fail( + "Invalid test alignment passed when raiseAsserts enabled:" + + msg); } // also check validation passes with asserts disabled Assert.assertFalse(verifyAlignmentDatasetRefs(al, false, null), @@ -368,8 +394,8 @@ public class AlignmentTest @Test(groups = { "Functional" }) public void testVerifyAlignmentDatasetRefs() { - SequenceI sq1 = new Sequence("sq1", "ASFDD"), sq2 = new Sequence("sq2", - "TTTTTT"); + SequenceI sq1 = new Sequence("sq1", "ASFDD"), + sq2 = new Sequence("sq2", "TTTTTT"); // construct simple valid alignment dataset Alignment al = new Alignment(new SequenceI[] { sq1, sq2 }); @@ -382,9 +408,7 @@ public class AlignmentTest "didn't detect dataset sequence with a dataset sequence reference."); sq1.setDatasetSequence(null); - assertVerifyAlignment( - al, - true, + assertVerifyAlignment(al, true, "didn't reinstate validity after nulling dataset sequence dataset reference"); // now create dataset and check again @@ -396,27 +420,27 @@ public class AlignmentTest // create a dbref on sq1 with a sequence ref to sq2 DBRefEntry dbrs1tos2 = new DBRefEntry("UNIPROT", "1", "Q111111"); - dbrs1tos2.setMap(new Mapping(sq2.getDatasetSequence(), - new int[] { 1, 5 }, new int[] { 2, 6 }, 1, 1)); + dbrs1tos2 + .setMap(new Mapping(sq2.getDatasetSequence(), new int[] + { 1, 5 }, new int[] { 2, 6 }, 1, 1)); sq1.getDatasetSequence().addDBRef(dbrs1tos2); assertVerifyAlignment(al, true, "verify failed after addition of valid DBRefEntry/map"); // now create a dbref on a new sequence which maps to another sequence // outside of the dataset - SequenceI sqout = new Sequence("sqout", "ututututucagcagcag"), sqnew = new Sequence( - "sqnew", "EEERRR"); + SequenceI sqout = new Sequence("sqout", "ututututucagcagcag"), + sqnew = new Sequence("sqnew", "EEERRR"); DBRefEntry sqnewsqout = new DBRefEntry("ENAFOO", "1", "R000001"); - sqnewsqout.setMap(new Mapping(sqout, new int[] { 1, 6 }, new int[] { 1, - 18 }, 1, 3)); + sqnewsqout + .setMap(new Mapping(sqout, new int[] + { 1, 6 }, new int[] { 1, 18 }, 1, 3)); al.getDataset().addSequence(sqnew); assertVerifyAlignment(al, true, "verify failed after addition of new sequence to dataset"); // now start checking exception conditions sqnew.addDBRef(sqnewsqout); - assertVerifyAlignment( - al, - false, + assertVerifyAlignment(al, false, "verify passed when a dbref with map to sequence outside of dataset was added"); // make the verify pass by adding the outsider back in al.getDataset().addSequence(sqout); @@ -427,21 +451,18 @@ public class AlignmentTest "aggtutaggcagcagcag"); AlignedCodonFrame alc = new AlignedCodonFrame(); - alc.addMap(sqanotherout, sqnew, new MapList(new int[] { 1, 6 }, - new int[] { 1, 18 }, 3, 1)); + alc.addMap(sqanotherout, sqnew, + new MapList(new int[] + { 1, 6 }, new int[] { 1, 18 }, 3, 1)); al.addCodonFrame(alc); Assert.assertEquals(al.getDataset().getCodonFrames().size(), 1); - assertVerifyAlignment( - al, - false, + assertVerifyAlignment(al, false, "verify passed when alCodonFrame mapping to sequence outside of dataset was added"); // make the verify pass by adding the outsider back in al.getDataset().addSequence(sqanotherout); - assertVerifyAlignment( - al, - true, + assertVerifyAlignment(al, true, "verify should have passed once all sequences involved in alCodonFrame were added to dataset"); al.getDataset().addSequence(sqanotherout); assertVerifyAlignment(al, false, @@ -470,7 +491,8 @@ public class AlignmentTest * @param message * - null or message prepended to exception message. */ - public static void assertDatasetIsNormalised(AlignmentI al, String message) + public static void assertDatasetIsNormalised(AlignmentI al, + String message) { if (al.getDataset() != null) { @@ -535,7 +557,8 @@ public class AlignmentTest assertDatasetIsNormalised(al); } catch (AssertionError ae) { - Assert.fail("Two different sequences should be valid normalised dataset."); + Assert.fail( + "Two different sequences should be valid normalised dataset."); } /* * now change sq2's name in the alignment. should still be valid @@ -546,7 +569,8 @@ public class AlignmentTest assertDatasetIsNormalised(al); } catch (AssertionError ae) { - Assert.fail("Two different sequences in dataset, but same name in alignment, should be valid normalised dataset."); + Assert.fail( + "Two different sequences in dataset, but same name in alignment, should be valid normalised dataset."); } al.addSequence(sq1seqd); @@ -555,7 +579,8 @@ public class AlignmentTest assertDatasetIsNormalised(al); } catch (AssertionError ae) { - Assert.fail("sq1 and sq1 with different sequence should be distinct."); + Assert.fail( + "sq1 and sq1 with different sequence should be distinct."); } al.addSequence(sq1shift); @@ -564,7 +589,8 @@ public class AlignmentTest assertDatasetIsNormalised(al); } catch (AssertionError ae) { - Assert.fail("sq1 and sq1 with different start/end should be distinct."); + Assert.fail( + "sq1 and sq1 with different start/end should be distinct."); } /* * finally, the failure case @@ -747,10 +773,10 @@ public class AlignmentTest makeMappings(al1, al2); ((Alignment) al2).alignAs(al1, false, true); - assertEquals("GC-TC--GUC-GTACT", al2.getSequenceAt(0) - .getSequenceAsString()); - assertEquals("-GG-GTC--AGG--CAGT", al2.getSequenceAt(1) - .getSequenceAsString()); + assertEquals("GC-TC--GUC-GTACT", + al2.getSequenceAt(0).getSequenceAsString()); + assertEquals("-GG-GTC--AGG--CAGT", + al2.getSequenceAt(1).getSequenceAsString()); } /** @@ -774,6 +800,59 @@ public class AlignmentTest assertEquals("-R-F-P-W", al2.getSequenceAt(1).getSequenceAsString()); } + + /** + * Recover protein MSA from tdi msa + * + * @throws IOException + */ + @Test(groups = { "Functional" }) + public void testAlignAs_prot_tdi() throws Exception + { + // see also AlignmentUtilsTests + AlignmentI al1 = loadAlignment(TD_SEQS_2, FileFormat.Fasta); + AlignmentI al2 = loadAlignment(AA_SEQS_2_DS, FileFormat.Fasta); + al1.setDataset(null); + al2.setDataset(al1.getDataset()); + AlignmentI al1copy = new Alignment(al1); + AlignmentI al2copy = new Alignment(al2); + AlignmentUtils.map3diPeptideToProteinAligment(al2, al1); + if (al2.getCodonFrames().isEmpty()) {al2.getCodonFrames().addAll(al1.getCodonFrames()); } + else {al1.getCodonFrames().addAll(al2.getCodonFrames()); }; + + ((Alignment) al2).alignAs(al1); + assertEquals("-NMP-R", al1.getSequenceAt(0).getSequenceAsString()); + assertEquals("VX--YA", al1.getSequenceAt(1).getSequenceAsString()); + assertEquals("-KQY-L", al2.getSequenceAt(0).getSequenceAsString()); + assertEquals("RF--PW", al2.getSequenceAt(1).getSequenceAsString()); + + } + /** + * Recover TdI MSA from protein msa + * + * @throws IOException + */ + @Test(groups = { "Functional" }) + public void testAlignAs_tdi_prot() throws Exception + { + // see also AlignmentUtilsTests + AlignmentI al1 = loadAlignment(AA_SEQS_2, FileFormat.Fasta); + AlignmentI al2 = loadAlignment(TD_SEQS_2_DS, FileFormat.Fasta); + al1.setDataset(null); + al2.setDataset(al1.getDataset()); + AlignmentI al1copy = new Alignment(al1); + AlignmentI al2copy = new Alignment(al2); + AlignmentUtils.map3diPeptideToProteinAligment(al1, al2); + if (al2.getCodonFrames().isEmpty()) {al2.getCodonFrames().addAll(al1.getCodonFrames()); } + else {al1.getCodonFrames().addAll(al2.getCodonFrames()); }; + + ((Alignment) al2).alignAs(al1); + assertEquals("K-QY-L", al1.getSequenceAt(0).getSequenceAsString()); + assertEquals("-R-FPW", al1.getSequenceAt(1).getSequenceAsString()); + assertEquals("N-MP-R", al2.getSequenceAt(0).getSequenceAsString()); + assertEquals("-V-XYA", al2.getSequenceAt(1).getSequenceAsString()); + + } /** * Test aligning cdna as per protein alignment. * @@ -794,10 +873,10 @@ public class AlignmentTest * Realign DNA; currently keeping existing gaps in introns only */ ((Alignment) al1).alignAs(al2, false, true); - assertEquals("ACG---GCUCCA------ACT---", al1.getSequenceAt(0) - .getSequenceAsString()); - assertEquals("---CGT---TAACGA---AGT---", al1.getSequenceAt(1) - .getSequenceAsString()); + assertEquals("ACG---GCUCCA------ACT---", + al1.getSequenceAt(0).getSequenceAsString()); + assertEquals("---CGT---TAACGA---AGT---", + al1.getSequenceAt(1).getSequenceAsString()); } /** @@ -828,6 +907,59 @@ public class AlignmentTest } /** + * test mapping between a protein and 3di sequence alignment. Assumes 1:1 + * @throws IOException + */ + @Test(groups={"Functional"},enabled=true) + public void testAlignAs_3di() throws IOException + { + String protAl = ">1ji5_A\n" + + "-----------------------------DQPVLLLLLLQLLLLLVLLLQQLVVCLVQAD\n" + + "DPCNVVSNVVSVVSSVVSVVSNVVSQVVCVVVVHHHDDDVSSVVRYPQDHHDPP--DYPL\n" + + "RSLVSLLVSLVVVLVSLVVSLVSCVVVVNVVSNVSSVVVSVVSVVSNVVSCVVVVD----\n" + + "---------------------------------------------------\n" + + ">1jig_A\n" + + "---------------------------DALLVVLLLLLLQLLLALVLLLQQLVLCLVLAD\n" + + "DPCNVVSNVVSVVVSVVSVVSNVVSQVVCVVSVHHHDDDVSSVVRYPQDHDDSP--DYPL\n" + + "RSLVSLLVSLVVLLVSLVVSLVSCVVNVNPVSNVSSVVSSVVSVVSNVVSVVVND-----\n" + + "---------------------------------------------------\n" + + "\n"; + String tdiAl = ">1ji5_A\n" + + "-----------------------------MNKQVIEVLNKQVADWSVLFTKLHNFHWYVK\n" + + "GPQFFTLHEKFEELYTESATHIDEIAERILAIGGKPVATKEYLEISSIQEAAYG--ETAE\n" + + "GMVEAIMKDYEMMLVELKKGMEIAQNSDDEMTSDLLLGIYTELEKHAWMLRAFLNQ----\n" + + "---------------------------------------------------\n" + + ">1jig_A\n" + + "---------------------------MSTKTNVVEVLNKQVANWNVLYVKLHNYHWYVT\n" + + "GPHFFTLHEKFEEFYNEAGTYIDELAERILALEGKPLATKEYLATSSVNEGTSK--ESAE\n" + + "EMVQTLVNDYSALIQELKEGMEVAGEAGDATSADMLLAIHTTLEQHVWMLSAFLK-----\n" + + "---------------------------------------------------\n" + ""; + AlignmentI prot = loadAlignment(protAl, FileFormat.Fasta); + ((Alignment) prot).createDatasetAlignment(); + + AlignmentI tdi = loadAlignment(tdiAl, FileFormat.Fasta); + assertTrue(AlignmentUtils.map3diPeptideToProteinAligment(prot, tdi)); + + AlignmentI newProt = new Alignment( + new SequenceI[] + { prot.getSequenceAt(0).getSubSequence(25, 35), + prot.getSequenceAt(1).getSubSequence(35, 45) }); + newProt.setDataset(prot.getDataset()); + + // TODO Find matching tdi sequence and construct alignment mirroring + // the protein alignment + // Alignment newTdi = new CrossRef(newProt.getSequencesArray(), + // newProt.getDataset()).findXrefSequences("", false); + // + // newTdi.alignAs(newProt); + // + // System.out.println("newProt - aa\n"+new + // FastaFile().print(newProt.getSequencesArray(), true)); + // System.out.println("newProt - 3di\n"+new + // FastaFile().print(newTdi.getSequencesArray(), true)); + + } + /** * Helper method that makes mappings and then aligns the first alignment as * the second * @@ -856,7 +988,7 @@ public class AlignmentTest /** * Helper method to make mappings between sequences, and add the mappings to - * the 'mapped from' alignment + * the 'mapped from' alignment. If alFrom.isNucleotide() == alTo.isNucleotide() then ratio is always 1:1 * * @param alFrom * @param alTo @@ -871,9 +1003,11 @@ public class AlignmentTest { SequenceI seqFrom = alFrom.getSequenceAt(i); SequenceI seqTo = alTo.getSequenceAt(i); - MapList ml = new MapList(new int[] { seqFrom.getStart(), - seqFrom.getEnd() }, - new int[] { seqTo.getStart(), seqTo.getEnd() }, ratio, 1); + MapList ml = new MapList( + new int[] + { seqFrom.getStart(), seqFrom.getEnd() }, + new int[] + { seqTo.getStart(), seqTo.getEnd() }, ratio, 1); acf.addMap(seqFrom, seqTo, ml); } @@ -900,18 +1034,21 @@ public class AlignmentTest */ String dna1 = "A-Aa-gG-GCC-cT-TT"; String dna2 = "c--CCGgg-TT--T-AA-A"; - AlignmentI al1 = loadAlignment(">Dna1/6-17\n" + dna1 - + "\n>Dna2/20-31\n" + dna2 + "\n", FileFormat.Fasta); + AlignmentI al1 = loadAlignment( + ">Dna1/6-17\n" + dna1 + "\n>Dna2/20-31\n" + dna2 + "\n", + FileFormat.Fasta); AlignmentI al2 = loadAlignment( ">Pep1/7-9\n-P--YK\n>Pep2/11-13\nG-T--F\n", FileFormat.Fasta); AlignedCodonFrame acf = new AlignedCodonFrame(); // Seq1 has intron at dna positions 3,4,9 so splice is AAG GCC TTT // Seq2 has intron at dna positions 1,5,6 so splice is CCG TTT AAA - MapList ml1 = new MapList(new int[] { 6, 7, 10, 13, 15, 17 }, new int[] - { 7, 9 }, 3, 1); + MapList ml1 = new MapList(new int[] { 6, 7, 10, 13, 15, 17 }, + new int[] + { 7, 9 }, 3, 1); acf.addMap(al1.getSequenceAt(0), al2.getSequenceAt(0), ml1); - MapList ml2 = new MapList(new int[] { 21, 23, 26, 31 }, new int[] { 11, - 13 }, 3, 1); + MapList ml2 = new MapList(new int[] { 21, 23, 26, 31 }, + new int[] + { 11, 13 }, 3, 1); acf.addMap(al1.getSequenceAt(1), al2.getSequenceAt(1), ml2); al2.addCodonFrame(acf); @@ -919,11 +1056,11 @@ public class AlignmentTest * Align ignoring gaps in dna introns and exons */ ((Alignment) al1).alignAs(al2, false, false); - assertEquals("---AAagG------GCCcTTT", al1.getSequenceAt(0) - .getSequenceAsString()); + assertEquals("---AAagG------GCCcTTT", + al1.getSequenceAt(0).getSequenceAsString()); // note 1 gap in protein corresponds to 'gg-' in DNA (3 positions) - assertEquals("cCCGgg-TTT------AAA", al1.getSequenceAt(1) - .getSequenceAsString()); + assertEquals("cCCGgg-TTT------AAA", + al1.getSequenceAt(1).getSequenceAsString()); /* * Reset and realign, preserving gaps in dna introns and exons @@ -934,10 +1071,10 @@ public class AlignmentTest // String dna1 = "A-Aa-gG-GCC-cT-TT"; // String dna2 = "c--CCGgg-TT--T-AA-A"; // assumption: we include 'the greater of' protein/dna gap lengths, not both - assertEquals("---A-Aa-gG------GCC-cT-TT", al1.getSequenceAt(0) - .getSequenceAsString()); - assertEquals("c--CCGgg-TT--T------AA-A", al1.getSequenceAt(1) - .getSequenceAsString()); + assertEquals("---A-Aa-gG------GCC-cT-TT", + al1.getSequenceAt(0).getSequenceAsString()); + assertEquals("c--CCGgg-TT--T------AA-A", + al1.getSequenceAt(1).getSequenceAsString()); } @Test(groups = "Functional") @@ -947,8 +1084,9 @@ public class AlignmentTest // create sequence and alignment datasets protein.setDataset(null); AlignedCodonFrame acf = new AlignedCodonFrame(); - List acfList = Arrays.asList(new AlignedCodonFrame[] - { acf }); + List acfList = Arrays + .asList(new AlignedCodonFrame[] + { acf }); protein.getDataset().setCodonFrames(acfList); AlignmentI copy = new Alignment(protein); @@ -957,10 +1095,10 @@ public class AlignmentTest */ assertFalse(copy.getSequenceAt(0) == protein.getSequenceAt(0)); assertFalse(copy.getSequenceAt(1) == protein.getSequenceAt(1)); - assertSame(copy.getSequenceAt(0).getDatasetSequence(), protein - .getSequenceAt(0).getDatasetSequence()); - assertSame(copy.getSequenceAt(1).getDatasetSequence(), protein - .getSequenceAt(1).getDatasetSequence()); + assertSame(copy.getSequenceAt(0).getDatasetSequence(), + protein.getSequenceAt(0).getDatasetSequence()); + assertSame(copy.getSequenceAt(1).getDatasetSequence(), + protein.getSequenceAt(1).getDatasetSequence()); // TODO should the copy constructor copy the dataset? // or make a new one referring to the same dataset sequences?? @@ -1010,10 +1148,10 @@ public class AlignmentTest // side-effect: dataset created on second sequence assertNotNull(protein.getSequenceAt(1).getDatasetSequence()); // dataset alignment has references to dataset sequences - assertEquals(ds.getSequenceAt(0), protein.getSequenceAt(0) - .getDatasetSequence()); - assertEquals(ds.getSequenceAt(1), protein.getSequenceAt(1) - .getDatasetSequence()); + assertEquals(ds.getSequenceAt(0), + protein.getSequenceAt(0).getDatasetSequence()); + assertEquals(ds.getSequenceAt(1), + protein.getSequenceAt(1).getDatasetSequence()); // codon frames should have been moved to the dataset // getCodonFrames() should delegate to the dataset: @@ -1036,19 +1174,22 @@ public class AlignmentTest // cross-references to two more sequences. DBRefEntry dbr = new DBRefEntry("SQ1", "", "sq3"); SequenceI sq3 = new Sequence("sq3", "VWANG"); - dbr.setMap(new Mapping(sq3, new MapList(new int[] { 1, 4 }, new int[] { - 2, 5 }, 1, 1))); + dbr.setMap( + new Mapping(sq3, new MapList(new int[] + { 1, 4 }, new int[] { 2, 5 }, 1, 1))); sq1.addDBRef(dbr); SequenceI sq4 = new Sequence("sq4", "ERKWI"); DBRefEntry dbr2 = new DBRefEntry("SQ2", "", "sq4"); - dbr2.setMap(new Mapping(sq4, new MapList(new int[] { 1, 4 }, new int[] { - 2, 5 }, 1, 1))); + dbr2.setMap( + new Mapping(sq4, new MapList(new int[] + { 1, 4 }, new int[] { 2, 5 }, 1, 1))); sq2.addDBRef(dbr2); // and a 1:1 codonframe mapping between them. AlignedCodonFrame alc = new AlignedCodonFrame(); - alc.addMap(sq1, sq2, new MapList(new int[] { 1, 4 }, - new int[] { 1, 4 }, 1, 1)); + alc.addMap(sq1, sq2, + new MapList(new int[] + { 1, 4 }, new int[] { 1, 4 }, 1, 1)); AlignmentI protein = new Alignment(new SequenceI[] { sq1, sq2 }); @@ -1111,7 +1252,8 @@ public class AlignmentTest Assert.assertEquals(align.getDataset().getHeight(), 1, "Dataset shouldn't have more than one sequence."); - Sequence seq2 = new Sequence("newtestSeq", "ABCDEFGHIJKLMNOPQRSTUVWXYZ"); + Sequence seq2 = new Sequence("newtestSeq", + "ABCDEFGHIJKLMNOPQRSTUVWXYZ"); align.addSequence(seq2); Assert.assertEquals(align.getDataset().getHeight(), 2, "Dataset should now have two sequences."); @@ -1133,26 +1275,30 @@ public class AlignmentTest // add dbref from dna to peptide DBRefEntry dbr = new DBRefEntry("UNIPROT", "", "pep"); - dbr.setMap(new Mapping(pep, new MapList(new int[] { 4, 15 }, new int[] { - 1, 4 }, 3, 1))); + dbr.setMap( + new Mapping(pep, new MapList(new int[] + { 4, 15 }, new int[] { 1, 4 }, 3, 1))); dna.addDBRef(dbr); // add dbref from dna to peptide DBRefEntry dbr2 = new DBRefEntry("UNIPROT", "", "pep"); - dbr2.setMap(new Mapping(pep, new MapList(new int[] { 1, 12 }, new int[] - { 1, 4 }, 3, 1))); + dbr2.setMap( + new Mapping(pep, new MapList(new int[] + { 1, 12 }, new int[] { 1, 4 }, 3, 1))); cds.addDBRef(dbr2); // add dbref from peptide to dna DBRefEntry dbr3 = new DBRefEntry("EMBL", "", "dna"); - dbr3.setMap(new Mapping(dna, new MapList(new int[] { 1, 4 }, new int[] { - 4, 15 }, 1, 3))); + dbr3.setMap( + new Mapping(dna, new MapList(new int[] + { 1, 4 }, new int[] { 4, 15 }, 1, 3))); pep.addDBRef(dbr3); // add dbref from peptide to cds DBRefEntry dbr4 = new DBRefEntry("EMBLCDS", "", "cds"); - dbr4.setMap(new Mapping(cds, new MapList(new int[] { 1, 4 }, new int[] { - 1, 12 }, 1, 3))); + dbr4.setMap( + new Mapping(cds, new MapList(new int[] + { 1, 4 }, new int[] { 1, 12 }, 1, 3))); pep.addDBRef(dbr4); AlignmentI protein = new Alignment(new SequenceI[] { pep }); @@ -1173,14 +1319,14 @@ public class AlignmentTest /* * verify peptide.cdsdbref.peptidedbref is now mapped to peptide dataset */ - DBRefEntry[] dbRefs = pep.getDBRefs(); - assertEquals(2, dbRefs.length); - assertSame(dna, dbRefs[0].map.to); - assertSame(cds, dbRefs[1].map.to); - assertEquals(1, dna.getDBRefs().length); - assertSame(pep.getDatasetSequence(), dna.getDBRefs()[0].map.to); - assertEquals(1, cds.getDBRefs().length); - assertSame(pep.getDatasetSequence(), cds.getDBRefs()[0].map.to); + List dbRefs = pep.getDBRefs(); + assertEquals(2, dbRefs.size()); + assertSame(dna, dbRefs.get(0).map.to); + assertSame(cds, dbRefs.get(1).map.to); + assertEquals(1, dna.getDBRefs().size()); + assertSame(pep.getDatasetSequence(), dna.getDBRefs().get(0).map.to); + assertEquals(1, cds.getDBRefs().size()); + assertSame(pep.getDatasetSequence(), cds.getDBRefs().get(0).map.to); } @Test(groups = { "Functional" }) @@ -1307,7 +1453,8 @@ public class AlignmentTest @Test( groups = "Functional", - expectedExceptions = { IllegalArgumentException.class }) + expectedExceptions = + { IllegalArgumentException.class }) public void testSetDataset_selfReference() { SequenceI seq = new Sequence("a", "a"); @@ -1329,8 +1476,8 @@ public class AlignmentTest assertEquals('-', alignment.getGapCharacter()); assertSame(seq, alignment.getSequenceAt(0)); - assertEquals("KP--L-FQII-", alignment.getSequenceAt(1) - .getSequenceAsString()); + assertEquals("KP--L-FQII-", + alignment.getSequenceAt(1).getSequenceAsString()); // todo test coverage for annotations, mappings, groups, // hidden sequences, properties @@ -1532,4 +1679,58 @@ public class AlignmentTest assertFalse(hc.equals(hc2)); assertTrue(al.setHiddenColumns(hc)); // 'changed' } + + @Test(groups = { "Functional" }) + public void testGetWidth() + { + SequenceI seq1 = new Sequence("seq1", "ABCDEF--"); + SequenceI seq2 = new Sequence("seq2", "-JKLMNO--"); + SequenceI seq3 = new Sequence("seq2", "-PQR"); + AlignmentI a = new Alignment(new SequenceI[] { seq1, seq2, seq3 }); + + assertEquals(9, a.getWidth()); + + // width includes hidden columns + a.getHiddenColumns().hideColumns(2, 5); + assertEquals(9, a.getWidth()); + } + + @Test(groups = { "Functional" }) + public void testGetVisibleWidth() + { + SequenceI seq1 = new Sequence("seq1", "ABCDEF--"); + SequenceI seq2 = new Sequence("seq2", "-JKLMNO--"); + SequenceI seq3 = new Sequence("seq2", "-PQR"); + AlignmentI a = new Alignment(new SequenceI[] { seq1, seq2, seq3 }); + + assertEquals(9, a.getVisibleWidth()); + + // width excludes hidden columns + a.getHiddenColumns().hideColumns(2, 5); + assertEquals(5, a.getVisibleWidth()); + } + + @Test(groups = { "Functional" }) + public void testGetContactMap() + { + // TODO + // 1. test adding/removing/manipulating contact maps with/without associated + // sequence(s) or groups + // 2. For sequence associated - ensure that inserting a gap in sequence + // results in the contact map being relocated accordingly + // 3. RENDERER QUESTION - should contact maps reflect gaps in the alignment + // ? + + } + + @Test(groups = { "Functional" }) + public void testEquals() + { + SequenceI seq1 = new Sequence("seq1", "ABCDEF--"); + SequenceI seq2 = new Sequence("seq2", "-JKLMNO--"); + SequenceI seq3 = new Sequence("seq2", "-PQR"); + AlignmentI a = new Alignment(new SequenceI[] { seq1, seq2, seq3 }); + a.setDataset(null); + assertEquals(a.getDataset(), a.getDataset()); + } }