X-Git-Url: http://source.jalview.org/gitweb/?a=blobdiff_plain;f=test%2Fjalview%2Fdatamodel%2FAlignmentTest.java;h=30c0de41488e5db9c6e232405cf26a2538603657;hb=704baca645bf14c607a8a4bede678253a50e7123;hp=f64a652976969f18b6771bb91b2969c22e1c1bca;hpb=8f118c154e74caaef6bec19acd0466904ac424d4;p=jalview.git diff --git a/test/jalview/datamodel/AlignmentTest.java b/test/jalview/datamodel/AlignmentTest.java index f64a652..30c0de4 100644 --- a/test/jalview/datamodel/AlignmentTest.java +++ b/test/jalview/datamodel/AlignmentTest.java @@ -22,18 +22,34 @@ package jalview.datamodel; import static org.testng.AssertJUnit.assertEquals; import static org.testng.AssertJUnit.assertFalse; +import static org.testng.AssertJUnit.assertNotNull; +import static org.testng.AssertJUnit.assertNull; +import static org.testng.AssertJUnit.assertSame; import static org.testng.AssertJUnit.assertTrue; -import jalview.io.AppletFormatAdapter; -import jalview.io.FormatAdapter; -import jalview.util.MapList; - import java.io.IOException; +import java.util.Arrays; import java.util.Iterator; +import java.util.List; +import org.testng.Assert; +import org.testng.annotations.BeforeClass; import org.testng.annotations.BeforeMethod; import org.testng.annotations.Test; +import jalview.analysis.AlignmentGenerator; +import jalview.analysis.AlignmentUtils; +import jalview.analysis.CrossRef; +import jalview.datamodel.AlignedCodonFrame.SequenceToSequenceMapping; +import jalview.gui.JvOptionPane; +import jalview.io.DataSourceType; +import jalview.io.FastaFile; +import jalview.io.FileFormat; +import jalview.io.FileFormatI; +import jalview.io.FormatAdapter; +import jalview.util.Comparison; +import jalview.util.MapList; + /** * Unit tests for Alignment datamodel. * @@ -42,6 +58,14 @@ import org.testng.annotations.Test; */ public class AlignmentTest { + + @BeforeClass(alwaysRun = true) + public void setUpJvOptionPane() + { + JvOptionPane.setInteractiveMode(false); + JvOptionPane.setMockResponse(JvOptionPane.CANCEL_OPTION); + } + // @formatter:off private static final String TEST_DATA = "# STOCKHOLM 1.0\n" + @@ -57,22 +81,44 @@ public class AlignmentTest "//"; private static final String AA_SEQS_1 = - ">Seq1Name\n" + + ">Seq1Name/5-8\n" + "K-QY--L\n" + - ">Seq2Name\n" + + ">Seq2Name/12-15\n" + "-R-FP-W-\n"; private static final String CDNA_SEQS_1 = - ">Seq1Name\n" + + ">Seq1Name/100-111\n" + "AC-GG--CUC-CAA-CT\n" + - ">Seq2Name\n" + + ">Seq2Name/200-211\n" + "-CG-TTA--ACG---AAGT\n"; private static final String CDNA_SEQS_2 = - ">Seq1Name\n" + + ">Seq1Name/50-61\n" + "GCTCGUCGTACT\n" + - ">Seq2Name\n" + + ">Seq2Name/60-71\n" + "GGGTCAGGCAGT\n"; + + private static final String AA_SEQS_2 = + ">Seq1Name/5-8\n" + + "K-QY-L\n" + + ">Seq2Name/12-15\n" + + "-R-FPW\n"; + private static final String AA_SEQS_2_DS = + ">Seq1Name/5-8\n" + + "KQYL\n" + + ">Seq2Name/12-15\n" + + "RFPW\n"; + private static final String TD_SEQS_2_DS = + ">Seq1Name/5-8\n" + + "NMPR\n" + + ">Seq2Name/12-15\n" + + "VXYA\n"; + private static final String TD_SEQS_2 = + ">Seq1Name/5-8\n" + + "-NMP-R\n" + + ">Seq2Name/12-15\n" + + "VX--YA\n"; + // @formatter:on private AlignmentI al; @@ -86,15 +132,485 @@ public class AlignmentTest * @return * @throws IOException */ - protected AlignmentI loadAlignment(final String data, String format) + protected AlignmentI loadAlignment(final String data, FileFormatI format) throws IOException { - AlignmentI a = new FormatAdapter().readFile(data, - AppletFormatAdapter.PASTE, format); + AlignmentI a = new FormatAdapter().readFile(data, DataSourceType.PASTE, + format); a.setDataset(null); return a; } + /** + * assert wrapper: tests all references in the given alignment are consistent + * + * @param alignment + */ + public static void assertAlignmentDatasetRefs(AlignmentI alignment) + { + verifyAlignmentDatasetRefs(alignment, true, null); + } + + /** + * assert wrapper: tests all references in the given alignment are consistent + * + * @param alignment + * @param message + * - prefixed to any assert failed messages + */ + public static void assertAlignmentDatasetRefs(AlignmentI alignment, + String message) + { + verifyAlignmentDatasetRefs(alignment, true, message); + } + + /** + * verify sequence and dataset references are properly contained within + * dataset + * + * @param alignment + * - the alignmentI object to verify (either alignment or dataset) + * @param raiseAssert + * - when set, testng assertions are raised. + * @param message + * - null or a string message to prepend to the assert failed + * messages. + * @return true if alignment references were in order, otherwise false. + */ + public static boolean verifyAlignmentDatasetRefs(AlignmentI alignment, + boolean raiseAssert, String message) + { + if (message == null) + { + message = ""; + } + if (alignment == null) + { + if (raiseAssert) + { + Assert.fail(message + "Alignment for verification was null."); + } + return false; + } + if (alignment.getDataset() != null) + { + AlignmentI dataset = alignment.getDataset(); + // check all alignment sequences have their dataset within the dataset + for (SequenceI seq : alignment.getSequences()) + { + SequenceI seqds = seq.getDatasetSequence(); + if (seqds.getDatasetSequence() != null) + { + if (raiseAssert) + { + Assert.fail(message + + " Alignment contained a sequence who's dataset sequence has a second dataset reference."); + } + return false; + } + if (dataset.findIndex(seqds) == -1) + { + if (raiseAssert) + { + Assert.fail(message + + " Alignment contained a sequence who's dataset sequence was not in the dataset."); + } + return false; + } + } + return verifyAlignmentDatasetRefs(alignment.getDataset(), raiseAssert, + message); + } + else + { + int dsp = -1; + // verify all dataset sequences + for (SequenceI seqds : alignment.getSequences()) + { + dsp++; + if (seqds.getDatasetSequence() != null) + { + if (raiseAssert) + { + Assert.fail(message + + " Dataset contained a sequence with non-null dataset reference (ie not a dataset sequence!)"); + } + return false; + } + int foundp = alignment.findIndex(seqds); + if (foundp != dsp) + { + if (raiseAssert) + { + Assert.fail(message + + " Dataset sequence array contains a reference at " + + dsp + " to a sequence first seen at " + foundp + " (" + + seqds.toString() + ")"); + } + return false; + } + if (seqds.getDBRefs() != null) + { + for (DBRefEntry dbr : seqds.getDBRefs()) + { + if (dbr.getMap() != null) + { + SequenceI seqdbrmapto = dbr.getMap().getTo(); + if (seqdbrmapto != null) + { + if (seqdbrmapto.getDatasetSequence() != null) + { + if (raiseAssert) + { + Assert.fail(message + + " DBRefEntry for sequence in alignment had map to sequence which was not a dataset sequence"); + } + return false; + + } + if (alignment.findIndex(dbr.getMap().getTo()) == -1) + { + if (raiseAssert) + { + Assert.fail(message + " DBRefEntry " + dbr + + " for sequence " + seqds + + " in alignment has map to sequence not in dataset"); + } + return false; + } + } + } + } + } + } + // finally, verify codonmappings involve only dataset sequences. + if (alignment.getCodonFrames() != null) + { + for (AlignedCodonFrame alc : alignment.getCodonFrames()) + { + for (SequenceToSequenceMapping ssm : alc.getMappings()) + { + if (ssm.getFromSeq().getDatasetSequence() != null) + { + if (raiseAssert) + { + Assert.fail(message + + " CodonFrame-SSM-FromSeq is not a dataset sequence"); + } + return false; + } + if (alignment.findIndex(ssm.getFromSeq()) == -1) + { + + if (raiseAssert) + { + Assert.fail(message + + " CodonFrame-SSM-FromSeq is not contained in dataset"); + } + return false; + } + if (ssm.getMapping().getTo().getDatasetSequence() != null) + { + if (raiseAssert) + { + Assert.fail(message + + " CodonFrame-SSM-Mapping-ToSeq is not a dataset sequence"); + } + return false; + } + if (alignment.findIndex(ssm.getMapping().getTo()) == -1) + { + + if (raiseAssert) + { + Assert.fail(message + + " CodonFrame-SSM-Mapping-ToSeq is not contained in dataset"); + } + return false; + } + } + } + } + } + return true; // all relationships verified! + } + + /** + * call verifyAlignmentDatasetRefs with and without assertion raising enabled, + * to check expected pass/fail actually occurs in both conditions + * + * @param al + * @param expected + * @param msg + */ + private void assertVerifyAlignment(AlignmentI al, boolean expected, + String msg) + { + if (expected) + { + try + { + + Assert.assertTrue(verifyAlignmentDatasetRefs(al, true, null), + "Valid test alignment failed when raiseAsserts enabled:" + + msg); + } catch (AssertionError ae) + { + ae.printStackTrace(); + Assert.fail( + "Valid test alignment raised assertion errors when raiseAsserts enabled: " + + msg, + ae); + } + // also check validation passes with asserts disabled + Assert.assertTrue(verifyAlignmentDatasetRefs(al, false, null), + "Valid test alignment tested false when raiseAsserts disabled:" + + msg); + } + else + { + boolean assertRaised = false; + try + { + verifyAlignmentDatasetRefs(al, true, null); + } catch (AssertionError ae) + { + // expected behaviour + assertRaised = true; + } + if (!assertRaised) + { + Assert.fail( + "Invalid test alignment passed when raiseAsserts enabled:" + + msg); + } + // also check validation passes with asserts disabled + Assert.assertFalse(verifyAlignmentDatasetRefs(al, false, null), + "Invalid test alignment tested true when raiseAsserts disabled:" + + msg); + } + } + + @Test(groups = { "Functional" }) + public void testVerifyAlignmentDatasetRefs() + { + SequenceI sq1 = new Sequence("sq1", "ASFDD"), + sq2 = new Sequence("sq2", "TTTTTT"); + + // construct simple valid alignment dataset + Alignment al = new Alignment(new SequenceI[] { sq1, sq2 }); + // expect this to pass + assertVerifyAlignment(al, true, "Simple valid alignment didn't verify"); + + // check test for sequence->datasetSequence validity + sq1.setDatasetSequence(sq2); + assertVerifyAlignment(al, false, + "didn't detect dataset sequence with a dataset sequence reference."); + + sq1.setDatasetSequence(null); + assertVerifyAlignment(al, true, + "didn't reinstate validity after nulling dataset sequence dataset reference"); + + // now create dataset and check again + al.createDatasetAlignment(); + assertNotNull(al.getDataset()); + + assertVerifyAlignment(al, true, + "verify failed after createDatasetAlignment"); + + // create a dbref on sq1 with a sequence ref to sq2 + DBRefEntry dbrs1tos2 = new DBRefEntry("UNIPROT", "1", "Q111111"); + dbrs1tos2 + .setMap(new Mapping(sq2.getDatasetSequence(), new int[] + { 1, 5 }, new int[] { 2, 6 }, 1, 1)); + sq1.getDatasetSequence().addDBRef(dbrs1tos2); + assertVerifyAlignment(al, true, + "verify failed after addition of valid DBRefEntry/map"); + // now create a dbref on a new sequence which maps to another sequence + // outside of the dataset + SequenceI sqout = new Sequence("sqout", "ututututucagcagcag"), + sqnew = new Sequence("sqnew", "EEERRR"); + DBRefEntry sqnewsqout = new DBRefEntry("ENAFOO", "1", "R000001"); + sqnewsqout + .setMap(new Mapping(sqout, new int[] + { 1, 6 }, new int[] { 1, 18 }, 1, 3)); + al.getDataset().addSequence(sqnew); + + assertVerifyAlignment(al, true, + "verify failed after addition of new sequence to dataset"); + // now start checking exception conditions + sqnew.addDBRef(sqnewsqout); + assertVerifyAlignment(al, false, + "verify passed when a dbref with map to sequence outside of dataset was added"); + // make the verify pass by adding the outsider back in + al.getDataset().addSequence(sqout); + assertVerifyAlignment(al, true, + "verify should have passed after adding dbref->to sequence in to dataset"); + // and now the same for a codon mapping... + SequenceI sqanotherout = new Sequence("sqanotherout", + "aggtutaggcagcagcag"); + + AlignedCodonFrame alc = new AlignedCodonFrame(); + alc.addMap(sqanotherout, sqnew, + new MapList(new int[] + { 1, 6 }, new int[] { 1, 18 }, 3, 1)); + + al.addCodonFrame(alc); + Assert.assertEquals(al.getDataset().getCodonFrames().size(), 1); + + assertVerifyAlignment(al, false, + "verify passed when alCodonFrame mapping to sequence outside of dataset was added"); + // make the verify pass by adding the outsider back in + al.getDataset().addSequence(sqanotherout); + assertVerifyAlignment(al, true, + "verify should have passed once all sequences involved in alCodonFrame were added to dataset"); + al.getDataset().addSequence(sqanotherout); + assertVerifyAlignment(al, false, + "verify should have failed when a sequence was added twice to the dataset"); + al.getDataset().deleteSequence(sqanotherout); + assertVerifyAlignment(al, true, + "verify should have passed after duplicate entry for sequence was removed"); + } + + /** + * checks that the sequence data for an alignment's dataset is non-redundant. + * Fails if there are sequences with same id, sequence, start, and. + */ + + public static void assertDatasetIsNormalised(AlignmentI al) + { + assertDatasetIsNormalised(al, null); + } + + /** + * checks that the sequence data for an alignment's dataset is non-redundant. + * Fails if there are sequences with same id, sequence, start, and. + * + * @param al + * - alignment to verify + * @param message + * - null or message prepended to exception message. + */ + public static void assertDatasetIsNormalised(AlignmentI al, + String message) + { + if (al.getDataset() != null) + { + assertDatasetIsNormalised(al.getDataset(), message); + return; + } + /* + * look for pairs of sequences with same ID, start, end, and sequence + */ + List seqSet = al.getSequences(); + for (int p = 0; p < seqSet.size(); p++) + { + SequenceI pSeq = seqSet.get(p); + for (int q = p + 1; q < seqSet.size(); q++) + { + SequenceI qSeq = seqSet.get(q); + if (pSeq.getStart() != qSeq.getStart()) + { + continue; + } + if (pSeq.getEnd() != qSeq.getEnd()) + { + continue; + } + if (!pSeq.getName().equals(qSeq.getName())) + { + continue; + } + if (!Arrays.equals(pSeq.getSequence(), qSeq.getSequence())) + { + continue; + } + Assert.fail((message == null ? "" : message + " :") + + "Found similar sequences at position " + p + " and " + q + + "\n" + pSeq.toString()); + } + } + } + + @Test(groups = { "Functional", "Asserts" }) + public void testAssertDatasetIsNormalised() + { + Sequence sq1 = new Sequence("s1/1-4", "asdf"); + Sequence sq1shift = new Sequence("s1/2-5", "asdf"); + Sequence sq1seqd = new Sequence("s1/1-4", "asdt"); + Sequence sq2 = new Sequence("s2/1-4", "asdf"); + Sequence sq1dup = new Sequence("s1/1-4", "asdf"); + + Alignment al = new Alignment(new SequenceI[] { sq1 }); + al.setDataset(null); + + try + { + assertDatasetIsNormalised(al); + } catch (AssertionError ae) + { + Assert.fail("Single sequence should be valid normalised dataset."); + } + al.addSequence(sq2); + try + { + assertDatasetIsNormalised(al); + } catch (AssertionError ae) + { + Assert.fail( + "Two different sequences should be valid normalised dataset."); + } + /* + * now change sq2's name in the alignment. should still be valid + */ + al.findName(sq2.getName()).setName("sq1"); + try + { + assertDatasetIsNormalised(al); + } catch (AssertionError ae) + { + Assert.fail( + "Two different sequences in dataset, but same name in alignment, should be valid normalised dataset."); + } + + al.addSequence(sq1seqd); + try + { + assertDatasetIsNormalised(al); + } catch (AssertionError ae) + { + Assert.fail( + "sq1 and sq1 with different sequence should be distinct."); + } + + al.addSequence(sq1shift); + try + { + assertDatasetIsNormalised(al); + } catch (AssertionError ae) + { + Assert.fail( + "sq1 and sq1 with different start/end should be distinct."); + } + /* + * finally, the failure case + */ + al.addSequence(sq1dup); + boolean ssertRaised = false; + try + { + assertDatasetIsNormalised(al); + + } catch (AssertionError ae) + { + ssertRaised = true; + } + if (!ssertRaised) + { + Assert.fail("Expected identical sequence to raise exception."); + } + } + /* * Read in Stockholm format test data including secondary structure * annotations. @@ -102,7 +618,7 @@ public class AlignmentTest @BeforeMethod(alwaysRun = true) public void setUp() throws IOException { - al = loadAlignment(TEST_DATA, "STH"); + al = loadAlignment(TEST_DATA, FileFormat.Stockholm); int i = 0; for (AlignmentAnnotation ann : al.getAlignmentAnnotation()) { @@ -124,6 +640,84 @@ public class AlignmentTest AlignmentAnnotation ann = iter.next(); assertEquals("D.melanogaster.2", ann.sequenceRef.getName()); assertFalse(iter.hasNext()); + + // invalid id + anns = al.findAnnotation("CalcIdForD.melanogaster.?"); + assertFalse(iter.hasNext()); + anns = al.findAnnotation(null); + assertFalse(iter.hasNext()); + } + + /** + * Test method that returns annotations that match on reference sequence, + * label, or calcId. + */ + @Test(groups = { "Functional" }) + public void testFindAnnotations_bySeqLabelandorCalcId() + { + // TODO: finish testFindAnnotations_bySeqLabelandorCalcId test + /* Note - this is an incomplete test - need to check null or + * non-null [ matches, not matches ] behaviour for each of the three + * parameters..*/ + + // search for a single, unique calcId with wildcards on other params + Iterable anns = al.findAnnotations(null, + "CalcIdForD.melanogaster.2", null); + Iterator iter = anns.iterator(); + assertTrue(iter.hasNext()); + AlignmentAnnotation ann = iter.next(); + assertEquals("D.melanogaster.2", ann.sequenceRef.getName()); + assertFalse(iter.hasNext()); + + // save reference to test sequence reference parameter + SequenceI rseq = ann.sequenceRef; + + // search for annotation associated with a single sequence + anns = al.findAnnotations(rseq, null, null); + iter = anns.iterator(); + assertTrue(iter.hasNext()); + ann = iter.next(); + assertEquals("D.melanogaster.2", ann.sequenceRef.getName()); + assertFalse(iter.hasNext()); + + // search for annotation with a non-existant calcId + anns = al.findAnnotations(null, "CalcIdForD.melanogaster.?", null); + iter = anns.iterator(); + assertFalse(iter.hasNext()); + + // search for annotation with a particular label - expect three + anns = al.findAnnotations(null, null, "Secondary Structure"); + iter = anns.iterator(); + assertTrue(iter.hasNext()); + iter.next(); + assertTrue(iter.hasNext()); + iter.next(); + assertTrue(iter.hasNext()); + iter.next(); + // third found.. so + assertFalse(iter.hasNext()); + + // search for annotation on one sequence with a particular label - expect + // one + SequenceI sqfound; + anns = al.findAnnotations(sqfound = al.getSequenceAt(1), null, + "Secondary Structure"); + iter = anns.iterator(); + assertTrue(iter.hasNext()); + // expect reference to sequence 1 in the alignment + assertTrue(sqfound == iter.next().sequenceRef); + assertFalse(iter.hasNext()); + + // null on all parameters == find all annotations + anns = al.findAnnotations(null, null, null); + iter = anns.iterator(); + int n = al.getAlignmentAnnotation().length; + while (iter.hasNext()) + { + n--; + iter.next(); + } + assertTrue("Found " + n + " fewer annotations from search.", n == 0); } @Test(groups = { "Functional" }) @@ -168,25 +762,21 @@ public class AlignmentTest public void testAlignAs_dnaAsDna() throws IOException { // aligned cDNA: - AlignmentI al1 = loadAlignment(CDNA_SEQS_1, "FASTA"); + AlignmentI al1 = loadAlignment(CDNA_SEQS_1, FileFormat.Fasta); // unaligned cDNA: - AlignmentI al2 = loadAlignment(CDNA_SEQS_2, "FASTA"); + AlignmentI al2 = loadAlignment(CDNA_SEQS_2, FileFormat.Fasta); /* * Make mappings between sequences. The 'aligned cDNA' is playing the role * of what would normally be protein here. */ - AlignedCodonFrame acf = new AlignedCodonFrame(); - MapList ml = new MapList(new int[] { 1, 12 }, new int[] { 1, 12 }, 1, 1); - acf.addMap(al2.getSequenceAt(0), al1.getSequenceAt(0), ml); - acf.addMap(al2.getSequenceAt(1), al1.getSequenceAt(1), ml); - al1.addCodonFrame(acf); + makeMappings(al1, al2); ((Alignment) al2).alignAs(al1, false, true); - assertEquals("GC-TC--GUC-GTA-CT", al2.getSequenceAt(0) - .getSequenceAsString()); - assertEquals("-GG-GTC--AGG---CAGT", al2.getSequenceAt(1) - .getSequenceAsString()); + assertEquals("GC-TC--GUC-GTACT", + al2.getSequenceAt(0).getSequenceAsString()); + assertEquals("-GG-GTC--AGG--CAGT", + al2.getSequenceAt(1).getSequenceAsString()); } /** @@ -198,46 +788,235 @@ public class AlignmentTest public void testAlignAs_proteinAsCdna() throws IOException { // see also AlignmentUtilsTests - AlignmentI al1 = loadAlignment(CDNA_SEQS_1, "FASTA"); - AlignmentI al2 = loadAlignment(AA_SEQS_1, "FASTA"); - AlignedCodonFrame acf = new AlignedCodonFrame(); - MapList ml = new MapList(new int[] { 1, 12 }, new int[] { 1, 4 }, 3, 1); - acf.addMap(al1.getSequenceAt(0), al2.getSequenceAt(0), ml); - acf.addMap(al1.getSequenceAt(1), al2.getSequenceAt(1), ml); - al2.addCodonFrame(acf); + AlignmentI al1 = loadAlignment(CDNA_SEQS_1, FileFormat.Fasta); + AlignmentI al2 = loadAlignment(AA_SEQS_1, FileFormat.Fasta); + makeMappings(al1, al2); + + // Fudge - alignProteinAsCdna expects mappings to be on protein + al2.getCodonFrames().addAll(al1.getCodonFrames()); ((Alignment) al2).alignAs(al1, false, true); assertEquals("K-Q-Y-L-", al2.getSequenceAt(0).getSequenceAsString()); assertEquals("-R-F-P-W", al2.getSequenceAt(1).getSequenceAsString()); } + /** - * Test aligning cdna as per protein alignment. + * Recover protein MSA from tdi msa + * + * @throws IOException + */ + @Test(groups = { "Functional" }) + public void testAlignAs_prot_tdi() throws Exception + { + // see also AlignmentUtilsTests + AlignmentI al1 = loadAlignment(TD_SEQS_2, FileFormat.Fasta); + AlignmentI al2 = loadAlignment(AA_SEQS_2_DS, FileFormat.Fasta); + al1.setDataset(null); + al2.setDataset(al1.getDataset()); + AlignmentI al1copy = new Alignment(al1); + AlignmentI al2copy = new Alignment(al2); + AlignmentUtils.map3diPeptideToProteinAligment(al2, al1); + if (al2.getCodonFrames().isEmpty()) {al2.getCodonFrames().addAll(al1.getCodonFrames()); } + else {al1.getCodonFrames().addAll(al2.getCodonFrames()); }; + + ((Alignment) al2).alignAs(al1); + assertEquals("-NMP-R", al1.getSequenceAt(0).getSequenceAsString()); + assertEquals("VX--YA", al1.getSequenceAt(1).getSequenceAsString()); + assertEquals("-KQY-L", al2.getSequenceAt(0).getSequenceAsString()); + assertEquals("RF--PW", al2.getSequenceAt(1).getSequenceAsString()); + + } + /** + * Recover TdI MSA from protein msa * * @throws IOException */ @Test(groups = { "Functional" }) + public void testAlignAs_tdi_prot() throws Exception + { + // see also AlignmentUtilsTests + AlignmentI al1 = loadAlignment(AA_SEQS_2, FileFormat.Fasta); + AlignmentI al2 = loadAlignment(TD_SEQS_2_DS, FileFormat.Fasta); + al1.setDataset(null); + al2.setDataset(al1.getDataset()); + AlignmentI al1copy = new Alignment(al1); + AlignmentI al2copy = new Alignment(al2); + AlignmentUtils.map3diPeptideToProteinAligment(al1, al2); + if (al2.getCodonFrames().isEmpty()) {al2.getCodonFrames().addAll(al1.getCodonFrames()); } + else {al1.getCodonFrames().addAll(al2.getCodonFrames()); }; + + ((Alignment) al2).alignAs(al1); + assertEquals("K-QY-L", al1.getSequenceAt(0).getSequenceAsString()); + assertEquals("-R-FPW", al1.getSequenceAt(1).getSequenceAsString()); + assertEquals("N-MP-R", al2.getSequenceAt(0).getSequenceAsString()); + assertEquals("-V-XYA", al2.getSequenceAt(1).getSequenceAsString()); + + } + /** + * Test aligning cdna as per protein alignment. + * + * @throws IOException + */ + @Test(groups = { "Functional" }, enabled = true) + // TODO review / update this test after redesign of alignAs method public void testAlignAs_cdnaAsProtein() throws IOException { /* * Load alignments and add mappings for cDNA to protein */ - AlignmentI al1 = loadAlignment(CDNA_SEQS_1, "FASTA"); - AlignmentI al2 = loadAlignment(AA_SEQS_1, "FASTA"); - AlignedCodonFrame acf = new AlignedCodonFrame(); - MapList ml = new MapList(new int[] { 1, 12 }, new int[] { 1, 4 }, 3, 1); - acf.addMap(al1.getSequenceAt(0), al2.getSequenceAt(0), ml); - acf.addMap(al1.getSequenceAt(1), al2.getSequenceAt(1), ml); - al2.addCodonFrame(acf); + AlignmentI al1 = loadAlignment(CDNA_SEQS_1, FileFormat.Fasta); + AlignmentI al2 = loadAlignment(AA_SEQS_1, FileFormat.Fasta); + makeMappings(al1, al2); /* * Realign DNA; currently keeping existing gaps in introns only */ ((Alignment) al1).alignAs(al2, false, true); - assertEquals("ACG---GCUCCA------ACT", al1.getSequenceAt(0) - .getSequenceAsString()); - assertEquals("---CGT---TAACGA---AGT", al1.getSequenceAt(1) - .getSequenceAsString()); + assertEquals("ACG---GCUCCA------ACT---", + al1.getSequenceAt(0).getSequenceAsString()); + assertEquals("---CGT---TAACGA---AGT---", + al1.getSequenceAt(1).getSequenceAsString()); + } + + /** + * Test aligning cdna as per protein - single sequences + * + * @throws IOException + */ + @Test(groups = { "Functional" }, enabled = true) + // TODO review / update this test after redesign of alignAs method + public void testAlignAs_cdnaAsProtein_singleSequence() throws IOException + { + /* + * simple case insert one gap + */ + verifyAlignAs(">dna\nCAAaaa\n", ">protein\nQ-K\n", "CAA---aaa"); + + /* + * simple case but with sequence offsets + */ + verifyAlignAs(">dna/5-10\nCAAaaa\n", ">protein/20-21\nQ-K\n", + "CAA---aaa"); + + /* + * insert gaps as per protein, drop gaps within codons + */ + verifyAlignAs(">dna/10-18\nCA-Aa-aa--AGA\n", ">aa/6-8\n-Q-K--R\n", + "---CAA---aaa------AGA"); + } + + /** + * test mapping between a protein and 3di sequence alignment. Assumes 1:1 + * @throws IOException + */ + @Test(groups={"Functional"},enabled=true) + public void testAlignAs_3di() throws IOException + { + String protAl = ">1ji5_A\n" + + "-----------------------------DQPVLLLLLLQLLLLLVLLLQQLVVCLVQAD\n" + + "DPCNVVSNVVSVVSSVVSVVSNVVSQVVCVVVVHHHDDDVSSVVRYPQDHHDPP--DYPL\n" + + "RSLVSLLVSLVVVLVSLVVSLVSCVVVVNVVSNVSSVVVSVVSVVSNVVSCVVVVD----\n" + + "---------------------------------------------------\n" + + ">1jig_A\n" + + "---------------------------DALLVVLLLLLLQLLLALVLLLQQLVLCLVLAD\n" + + "DPCNVVSNVVSVVVSVVSVVSNVVSQVVCVVSVHHHDDDVSSVVRYPQDHDDSP--DYPL\n" + + "RSLVSLLVSLVVLLVSLVVSLVSCVVNVNPVSNVSSVVSSVVSVVSNVVSVVVND-----\n" + + "---------------------------------------------------\n" + + "\n"; + String tdiAl = ">1ji5_A\n" + + "-----------------------------MNKQVIEVLNKQVADWSVLFTKLHNFHWYVK\n" + + "GPQFFTLHEKFEELYTESATHIDEIAERILAIGGKPVATKEYLEISSIQEAAYG--ETAE\n" + + "GMVEAIMKDYEMMLVELKKGMEIAQNSDDEMTSDLLLGIYTELEKHAWMLRAFLNQ----\n" + + "---------------------------------------------------\n" + + ">1jig_A\n" + + "---------------------------MSTKTNVVEVLNKQVANWNVLYVKLHNYHWYVT\n" + + "GPHFFTLHEKFEEFYNEAGTYIDELAERILALEGKPLATKEYLATSSVNEGTSK--ESAE\n" + + "EMVQTLVNDYSALIQELKEGMEVAGEAGDATSADMLLAIHTTLEQHVWMLSAFLK-----\n" + + "---------------------------------------------------\n" + ""; + AlignmentI prot = loadAlignment(protAl, FileFormat.Fasta); + ((Alignment) prot).createDatasetAlignment(); + + AlignmentI tdi = loadAlignment(tdiAl, FileFormat.Fasta); + assertTrue(AlignmentUtils.map3diPeptideToProteinAligment(prot, tdi)); + + AlignmentI newProt = new Alignment( + new SequenceI[] + { prot.getSequenceAt(0).getSubSequence(25, 35), + prot.getSequenceAt(1).getSubSequence(35, 45) }); + newProt.setDataset(prot.getDataset()); + + // TODO Find matching tdi sequence and construct alignment mirroring + // the protein alignment + // Alignment newTdi = new CrossRef(newProt.getSequencesArray(), + // newProt.getDataset()).findXrefSequences("", false); + // + // newTdi.alignAs(newProt); + // + // System.out.println("newProt - aa\n"+new + // FastaFile().print(newProt.getSequencesArray(), true)); + // System.out.println("newProt - 3di\n"+new + // FastaFile().print(newTdi.getSequencesArray(), true)); + + } + /** + * Helper method that makes mappings and then aligns the first alignment as + * the second + * + * @param fromSeqs + * @param toSeqs + * @param expected + * @throws IOException + */ + public void verifyAlignAs(String fromSeqs, String toSeqs, String expected) + throws IOException + { + /* + * Load alignments and add mappings from nucleotide to protein (or from + * first to second if both the same type) + */ + AlignmentI al1 = loadAlignment(fromSeqs, FileFormat.Fasta); + AlignmentI al2 = loadAlignment(toSeqs, FileFormat.Fasta); + makeMappings(al1, al2); + + /* + * Realign DNA; currently keeping existing gaps in introns only + */ + ((Alignment) al1).alignAs(al2, false, true); + assertEquals(expected, al1.getSequenceAt(0).getSequenceAsString()); + } + + /** + * Helper method to make mappings between sequences, and add the mappings to + * the 'mapped from' alignment. If alFrom.isNucleotide() == alTo.isNucleotide() then ratio is always 1:1 + * + * @param alFrom + * @param alTo + */ + public void makeMappings(AlignmentI alFrom, AlignmentI alTo) + { + int ratio = (alFrom.isNucleotide() == alTo.isNucleotide() ? 1 : 3); + + AlignedCodonFrame acf = new AlignedCodonFrame(); + + for (int i = 0; i < alFrom.getHeight(); i++) + { + SequenceI seqFrom = alFrom.getSequenceAt(i); + SequenceI seqTo = alTo.getSequenceAt(i); + MapList ml = new MapList( + new int[] + { seqFrom.getStart(), seqFrom.getEnd() }, + new int[] + { seqTo.getStart(), seqTo.getEnd() }, ratio, 1); + acf.addMap(seqFrom, seqTo, ml); + } + + /* + * not sure whether mappings 'belong' or protein or nucleotide + * alignment, so adding to both ;~) + */ + alFrom.addCodonFrame(acf); + alTo.addCodonFrame(acf); } /** @@ -246,7 +1025,8 @@ public class AlignmentTest * * @throws IOException */ - @Test(groups = { "Functional" }) + @Test(groups = { "Functional" }, enabled = false) + // TODO review / update this test after redesign of alignAs method public void testAlignAs_dnaAsProtein_withIntrons() throws IOException { /* @@ -254,18 +1034,21 @@ public class AlignmentTest */ String dna1 = "A-Aa-gG-GCC-cT-TT"; String dna2 = "c--CCGgg-TT--T-AA-A"; - AlignmentI al1 = loadAlignment(">Seq1\n" + dna1 + "\n>Seq2\n" + dna2 - + "\n", "FASTA"); - AlignmentI al2 = loadAlignment(">Seq1\n-P--YK\n>Seq2\nG-T--F\n", - "FASTA"); + AlignmentI al1 = loadAlignment( + ">Dna1/6-17\n" + dna1 + "\n>Dna2/20-31\n" + dna2 + "\n", + FileFormat.Fasta); + AlignmentI al2 = loadAlignment( + ">Pep1/7-9\n-P--YK\n>Pep2/11-13\nG-T--F\n", FileFormat.Fasta); AlignedCodonFrame acf = new AlignedCodonFrame(); // Seq1 has intron at dna positions 3,4,9 so splice is AAG GCC TTT // Seq2 has intron at dna positions 1,5,6 so splice is CCG TTT AAA - MapList ml1 = new MapList(new int[] { 1, 2, 5, 8, 10, 12 }, new int[] { - 1, 3 }, 3, 1); + MapList ml1 = new MapList(new int[] { 6, 7, 10, 13, 15, 17 }, + new int[] + { 7, 9 }, 3, 1); acf.addMap(al1.getSequenceAt(0), al2.getSequenceAt(0), ml1); - MapList ml2 = new MapList(new int[] { 2, 4, 7, 12 }, - new int[] { 1, 3 }, 3, 1); + MapList ml2 = new MapList(new int[] { 21, 23, 26, 31 }, + new int[] + { 11, 13 }, 3, 1); acf.addMap(al1.getSequenceAt(1), al2.getSequenceAt(1), ml2); al2.addCodonFrame(acf); @@ -273,11 +1056,11 @@ public class AlignmentTest * Align ignoring gaps in dna introns and exons */ ((Alignment) al1).alignAs(al2, false, false); - assertEquals("---AAagG------GCCcTTT", al1.getSequenceAt(0) - .getSequenceAsString()); + assertEquals("---AAagG------GCCcTTT", + al1.getSequenceAt(0).getSequenceAsString()); // note 1 gap in protein corresponds to 'gg-' in DNA (3 positions) - assertEquals("cCCGgg-TTT------AAA", al1.getSequenceAt(1) - .getSequenceAsString()); + assertEquals("cCCGgg-TTT------AAA", + al1.getSequenceAt(1).getSequenceAsString()); /* * Reset and realign, preserving gaps in dna introns and exons @@ -288,9 +1071,666 @@ public class AlignmentTest // String dna1 = "A-Aa-gG-GCC-cT-TT"; // String dna2 = "c--CCGgg-TT--T-AA-A"; // assumption: we include 'the greater of' protein/dna gap lengths, not both - assertEquals("---A-Aa-gG------GCC-cT-TT", al1.getSequenceAt(0) - .getSequenceAsString()); - assertEquals("c--CCGgg-TT--T------AA-A", al1.getSequenceAt(1) - .getSequenceAsString()); + assertEquals("---A-Aa-gG------GCC-cT-TT", + al1.getSequenceAt(0).getSequenceAsString()); + assertEquals("c--CCGgg-TT--T------AA-A", + al1.getSequenceAt(1).getSequenceAsString()); + } + + @Test(groups = "Functional") + public void testCopyConstructor() throws IOException + { + AlignmentI protein = loadAlignment(AA_SEQS_1, FileFormat.Fasta); + // create sequence and alignment datasets + protein.setDataset(null); + AlignedCodonFrame acf = new AlignedCodonFrame(); + List acfList = Arrays + .asList(new AlignedCodonFrame[] + { acf }); + protein.getDataset().setCodonFrames(acfList); + AlignmentI copy = new Alignment(protein); + + /* + * copy has different aligned sequences but the same dataset sequences + */ + assertFalse(copy.getSequenceAt(0) == protein.getSequenceAt(0)); + assertFalse(copy.getSequenceAt(1) == protein.getSequenceAt(1)); + assertSame(copy.getSequenceAt(0).getDatasetSequence(), + protein.getSequenceAt(0).getDatasetSequence()); + assertSame(copy.getSequenceAt(1).getDatasetSequence(), + protein.getSequenceAt(1).getDatasetSequence()); + + // TODO should the copy constructor copy the dataset? + // or make a new one referring to the same dataset sequences?? + assertNull(copy.getDataset()); + // TODO test metadata is copied when AlignmentI is a dataset + + // assertArrayEquals(copy.getDataset().getSequencesArray(), protein + // .getDataset().getSequencesArray()); + } + + /** + * Test behaviour of createDataset + * + * @throws IOException + */ + @Test(groups = "Functional") + public void testCreateDatasetAlignment() throws IOException + { + AlignmentI protein = new FormatAdapter().readFile(AA_SEQS_1, + DataSourceType.PASTE, FileFormat.Fasta); + /* + * create a dataset sequence on first sequence + * leave the second without one + */ + protein.getSequenceAt(0).createDatasetSequence(); + assertNotNull(protein.getSequenceAt(0).getDatasetSequence()); + assertNull(protein.getSequenceAt(1).getDatasetSequence()); + + /* + * add a mapping to the alignment + */ + AlignedCodonFrame acf = new AlignedCodonFrame(); + protein.addCodonFrame(acf); + assertNull(protein.getDataset()); + assertTrue(protein.getCodonFrames().contains(acf)); + + /* + * create the alignment dataset + * note this creates sequence datasets where missing + * as a side-effect (in this case, on seq2 + */ + // TODO promote this method to AlignmentI + ((Alignment) protein).createDatasetAlignment(); + + AlignmentI ds = protein.getDataset(); + + // side-effect: dataset created on second sequence + assertNotNull(protein.getSequenceAt(1).getDatasetSequence()); + // dataset alignment has references to dataset sequences + assertEquals(ds.getSequenceAt(0), + protein.getSequenceAt(0).getDatasetSequence()); + assertEquals(ds.getSequenceAt(1), + protein.getSequenceAt(1).getDatasetSequence()); + + // codon frames should have been moved to the dataset + // getCodonFrames() should delegate to the dataset: + assertTrue(protein.getCodonFrames().contains(acf)); + // prove the codon frames are indeed on the dataset: + assertTrue(ds.getCodonFrames().contains(acf)); + } + + /** + * tests the addition of *all* sequences referred to by a sequence being added + * to the dataset + */ + @Test(groups = "Functional") + public void testCreateDatasetAlignmentWithMappedToSeqs() + { + // Alignment with two sequences, gapped. + SequenceI sq1 = new Sequence("sq1", "A--SDF"); + SequenceI sq2 = new Sequence("sq2", "G--TRQ"); + + // cross-references to two more sequences. + DBRefEntry dbr = new DBRefEntry("SQ1", "", "sq3"); + SequenceI sq3 = new Sequence("sq3", "VWANG"); + dbr.setMap( + new Mapping(sq3, new MapList(new int[] + { 1, 4 }, new int[] { 2, 5 }, 1, 1))); + sq1.addDBRef(dbr); + + SequenceI sq4 = new Sequence("sq4", "ERKWI"); + DBRefEntry dbr2 = new DBRefEntry("SQ2", "", "sq4"); + dbr2.setMap( + new Mapping(sq4, new MapList(new int[] + { 1, 4 }, new int[] { 2, 5 }, 1, 1))); + sq2.addDBRef(dbr2); + // and a 1:1 codonframe mapping between them. + AlignedCodonFrame alc = new AlignedCodonFrame(); + alc.addMap(sq1, sq2, + new MapList(new int[] + { 1, 4 }, new int[] { 1, 4 }, 1, 1)); + + AlignmentI protein = new Alignment(new SequenceI[] { sq1, sq2 }); + + /* + * create the alignment dataset + * note this creates sequence datasets where missing + * as a side-effect (in this case, on seq2 + */ + + // TODO promote this method to AlignmentI + ((Alignment) protein).createDatasetAlignment(); + + AlignmentI ds = protein.getDataset(); + + // should be 4 sequences in dataset - two materialised, and two propagated + // from dbref + assertEquals(4, ds.getHeight()); + assertTrue(ds.getSequences().contains(sq1.getDatasetSequence())); + assertTrue(ds.getSequences().contains(sq2.getDatasetSequence())); + assertTrue(ds.getSequences().contains(sq3)); + assertTrue(ds.getSequences().contains(sq4)); + // Should have one codon frame mapping between sq1 and sq2 via dataset + // sequences + assertEquals(ds.getCodonFrame(sq1.getDatasetSequence()), + ds.getCodonFrame(sq2.getDatasetSequence())); + } + + @Test(groups = "Functional") + public void testAddCodonFrame() + { + AlignmentI align = new Alignment(new SequenceI[] {}); + AlignedCodonFrame acf = new AlignedCodonFrame(); + align.addCodonFrame(acf); + assertEquals(1, align.getCodonFrames().size()); + assertTrue(align.getCodonFrames().contains(acf)); + // can't add the same object twice: + align.addCodonFrame(acf); + assertEquals(1, align.getCodonFrames().size()); + + // create dataset alignment - mappings move to dataset + ((Alignment) align).createDatasetAlignment(); + assertSame(align.getCodonFrames(), align.getDataset().getCodonFrames()); + assertEquals(1, align.getCodonFrames().size()); + + AlignedCodonFrame acf2 = new AlignedCodonFrame(); + align.addCodonFrame(acf2); + assertTrue(align.getDataset().getCodonFrames().contains(acf)); + } + + @Test(groups = "Functional") + public void testAddSequencePreserveDatasetIntegrity() + { + Sequence seq = new Sequence("testSeq", "ABCDEFGHIJKLMNOPQRSTUVWXYZ"); + Alignment align = new Alignment(new SequenceI[] { seq }); + align.createDatasetAlignment(); + AlignmentI ds = align.getDataset(); + SequenceI copy = new Sequence(seq); + copy.insertCharAt(3, 5, '-'); + align.addSequence(copy); + Assert.assertEquals(align.getDataset().getHeight(), 1, + "Dataset shouldn't have more than one sequence."); + + Sequence seq2 = new Sequence("newtestSeq", + "ABCDEFGHIJKLMNOPQRSTUVWXYZ"); + align.addSequence(seq2); + Assert.assertEquals(align.getDataset().getHeight(), 2, + "Dataset should now have two sequences."); + + assertAlignmentDatasetRefs(align, + "addSequence broke dataset reference integrity"); + } + + /** + * Tests that dbrefs with mappings to sequence get updated if the sequence + * acquires a dataset sequence + */ + @Test(groups = "Functional") + public void testCreateDataset_updateDbrefMappings() + { + SequenceI pep = new Sequence("pep", "ASD"); + SequenceI dna = new Sequence("dna", "aaaGCCTCGGATggg"); + SequenceI cds = new Sequence("cds", "GCCTCGGAT"); + + // add dbref from dna to peptide + DBRefEntry dbr = new DBRefEntry("UNIPROT", "", "pep"); + dbr.setMap( + new Mapping(pep, new MapList(new int[] + { 4, 15 }, new int[] { 1, 4 }, 3, 1))); + dna.addDBRef(dbr); + + // add dbref from dna to peptide + DBRefEntry dbr2 = new DBRefEntry("UNIPROT", "", "pep"); + dbr2.setMap( + new Mapping(pep, new MapList(new int[] + { 1, 12 }, new int[] { 1, 4 }, 3, 1))); + cds.addDBRef(dbr2); + + // add dbref from peptide to dna + DBRefEntry dbr3 = new DBRefEntry("EMBL", "", "dna"); + dbr3.setMap( + new Mapping(dna, new MapList(new int[] + { 1, 4 }, new int[] { 4, 15 }, 1, 3))); + pep.addDBRef(dbr3); + + // add dbref from peptide to cds + DBRefEntry dbr4 = new DBRefEntry("EMBLCDS", "", "cds"); + dbr4.setMap( + new Mapping(cds, new MapList(new int[] + { 1, 4 }, new int[] { 1, 12 }, 1, 3))); + pep.addDBRef(dbr4); + + AlignmentI protein = new Alignment(new SequenceI[] { pep }); + + /* + * create the alignment dataset + */ + ((Alignment) protein).createDatasetAlignment(); + + AlignmentI ds = protein.getDataset(); + + // should be 3 sequences in dataset + assertEquals(3, ds.getHeight()); + assertTrue(ds.getSequences().contains(pep.getDatasetSequence())); + assertTrue(ds.getSequences().contains(dna)); + assertTrue(ds.getSequences().contains(cds)); + + /* + * verify peptide.cdsdbref.peptidedbref is now mapped to peptide dataset + */ + List dbRefs = pep.getDBRefs(); + assertEquals(2, dbRefs.size()); + assertSame(dna, dbRefs.get(0).map.to); + assertSame(cds, dbRefs.get(1).map.to); + assertEquals(1, dna.getDBRefs().size()); + assertSame(pep.getDatasetSequence(), dna.getDBRefs().get(0).map.to); + assertEquals(1, cds.getDBRefs().size()); + assertSame(pep.getDatasetSequence(), cds.getDBRefs().get(0).map.to); + } + + @Test(groups = { "Functional" }) + public void testFindGroup() + { + SequenceI seq1 = new Sequence("seq1", "ABCDEF---GHI"); + SequenceI seq2 = new Sequence("seq2", "---JKLMNO---"); + AlignmentI a = new Alignment(new SequenceI[] { seq1, seq2 }); + + assertNull(a.findGroup(null, 0)); + assertNull(a.findGroup(seq1, 1)); + assertNull(a.findGroup(seq1, -1)); + + /* + * add a group consisting of just "DEF" + */ + SequenceGroup sg1 = new SequenceGroup(); + sg1.addSequence(seq1, false); + sg1.setStartRes(3); + sg1.setEndRes(5); + a.addGroup(sg1); + + assertNull(a.findGroup(seq1, 2)); // position not in group + assertNull(a.findGroup(seq1, 6)); // position not in group + assertNull(a.findGroup(seq2, 5)); // sequence not in group + assertSame(a.findGroup(seq1, 3), sg1); // yes + assertSame(a.findGroup(seq1, 4), sg1); + assertSame(a.findGroup(seq1, 5), sg1); + + /* + * add a group consisting of + * EF-- + * KLMN + */ + SequenceGroup sg2 = new SequenceGroup(); + sg2.addSequence(seq1, false); + sg2.addSequence(seq2, false); + sg2.setStartRes(4); + sg2.setEndRes(7); + a.addGroup(sg2); + + assertNull(a.findGroup(seq1, 2)); // unchanged + assertSame(a.findGroup(seq1, 3), sg1); // unchanged + /* + * if a residue is in more than one group, method returns + * the first found (in order groups were added) + */ + assertSame(a.findGroup(seq1, 4), sg1); + assertSame(a.findGroup(seq1, 5), sg1); + + /* + * seq2 only belongs to the second group + */ + assertSame(a.findGroup(seq2, 4), sg2); + assertSame(a.findGroup(seq2, 5), sg2); + assertSame(a.findGroup(seq2, 6), sg2); + assertSame(a.findGroup(seq2, 7), sg2); + assertNull(a.findGroup(seq2, 3)); + assertNull(a.findGroup(seq2, 8)); + } + + @Test(groups = { "Functional" }) + public void testDeleteSequenceByIndex() + { + // create random alignment + AlignmentGenerator gen = new AlignmentGenerator(false); + AlignmentI a = gen.generate(20, 15, 123, 5, 5); + + // delete sequence 10, alignment reduced by 1 + int height = a.getAbsoluteHeight(); + a.deleteSequence(10); + assertEquals(a.getAbsoluteHeight(), height - 1); + + // try to delete -ve index, nothing happens + a.deleteSequence(-1); + assertEquals(a.getAbsoluteHeight(), height - 1); + + // try to delete beyond end of alignment, nothing happens + a.deleteSequence(14); + assertEquals(a.getAbsoluteHeight(), height - 1); + } + + @Test(groups = { "Functional" }) + public void testDeleteSequenceBySeq() + { + // create random alignment + AlignmentGenerator gen = new AlignmentGenerator(false); + AlignmentI a = gen.generate(20, 15, 123, 5, 5); + + // delete sequence 10, alignment reduced by 1 + int height = a.getAbsoluteHeight(); + SequenceI seq = a.getSequenceAt(10); + a.deleteSequence(seq); + assertEquals(a.getAbsoluteHeight(), height - 1); + + // try to delete non-existent sequence, nothing happens + seq = new Sequence("cds", "GCCTCGGAT"); + assertEquals(a.getAbsoluteHeight(), height - 1); + } + + @Test(groups = { "Functional" }) + public void testDeleteHiddenSequence() + { + // create random alignment + AlignmentGenerator gen = new AlignmentGenerator(false); + AlignmentI a = gen.generate(20, 15, 123, 5, 5); + + // delete a sequence which is hidden, check it is NOT removed from hidden + // sequences + int height = a.getAbsoluteHeight(); + SequenceI seq = a.getSequenceAt(2); + a.getHiddenSequences().hideSequence(seq); + assertEquals(a.getHiddenSequences().getSize(), 1); + a.deleteSequence(2); + assertEquals(a.getAbsoluteHeight(), height - 1); + assertEquals(a.getHiddenSequences().getSize(), 1); + + // delete a sequence which is not hidden, check hiddenSequences are not + // affected + a.deleteSequence(10); + assertEquals(a.getAbsoluteHeight(), height - 2); + assertEquals(a.getHiddenSequences().getSize(), 1); + } + + @Test( + groups = "Functional", + expectedExceptions = + { IllegalArgumentException.class }) + public void testSetDataset_selfReference() + { + SequenceI seq = new Sequence("a", "a"); + AlignmentI alignment = new Alignment(new SequenceI[] { seq }); + alignment.setDataset(alignment); + } + + @Test(groups = "Functional") + public void testAppend() + { + SequenceI seq = new Sequence("seq1", "FRMLPSRT-A--L-"); + AlignmentI alignment = new Alignment(new SequenceI[] { seq }); + alignment.setGapCharacter('-'); + SequenceI seq2 = new Sequence("seq1", "KP..L.FQII."); + AlignmentI alignment2 = new Alignment(new SequenceI[] { seq2 }); + alignment2.setGapCharacter('.'); + + alignment.append(alignment2); + + assertEquals('-', alignment.getGapCharacter()); + assertSame(seq, alignment.getSequenceAt(0)); + assertEquals("KP--L-FQII-", + alignment.getSequenceAt(1).getSequenceAsString()); + + // todo test coverage for annotations, mappings, groups, + // hidden sequences, properties + } + + /** + * test that calcId == null on findOrCreate doesn't raise an NPE, and yields + * an annotation with a null calcId + * + */ + @Test(groups = "Functional") + public void testFindOrCreateForNullCalcId() + { + SequenceI seq = new Sequence("seq1", "FRMLPSRT-A--L-"); + AlignmentI alignment = new Alignment(new SequenceI[] { seq }); + + AlignmentAnnotation ala = alignment.findOrCreateAnnotation( + "Temperature Factor", null, false, seq, null); + assertNotNull(ala); + assertEquals(seq, ala.sequenceRef); + assertEquals("", ala.calcId); + } + + @Test(groups = "Functional") + public void testPropagateInsertions() + { + // create an alignment with no gaps - this will be the profile seq and other + // JPRED seqs + AlignmentGenerator gen = new AlignmentGenerator(false); + AlignmentI al = gen.generate(25, 10, 1234, 0, 0); + + // get the profileseq + SequenceI profileseq = al.getSequenceAt(0); + SequenceI gappedseq = new Sequence(profileseq); + gappedseq.insertCharAt(5, al.getGapCharacter()); + gappedseq.insertCharAt(6, al.getGapCharacter()); + gappedseq.insertCharAt(7, al.getGapCharacter()); + gappedseq.insertCharAt(8, al.getGapCharacter()); + + // force different kinds of padding + al.getSequenceAt(3).deleteChars(2, 23); + al.getSequenceAt(4).deleteChars(2, 27); + al.getSequenceAt(5).deleteChars(10, 27); + + // create an alignment view with the gapped sequence + SequenceI[] seqs = new SequenceI[1]; + seqs[0] = gappedseq; + AlignmentI newal = new Alignment(seqs); + HiddenColumns hidden = new HiddenColumns(); + hidden.hideColumns(15, 17); + + AlignmentView view = new AlignmentView(newal, hidden, null, true, false, + false); + + // confirm that original contigs are as expected + Iterator visible = hidden.getVisContigsIterator(0, 25, false); + int[] region = visible.next(); + assertEquals("[0, 14]", Arrays.toString(region)); + region = visible.next(); + assertEquals("[18, 24]", Arrays.toString(region)); + + // propagate insertions + HiddenColumns result = al.propagateInsertions(profileseq, view); + + // confirm that the contigs have changed to account for the gaps + visible = result.getVisContigsIterator(0, 25, false); + region = visible.next(); + assertEquals("[0, 10]", Arrays.toString(region)); + region = visible.next(); + assertEquals("[14, 24]", Arrays.toString(region)); + + // confirm the alignment has been changed so that the other sequences have + // gaps inserted where the columns are hidden + assertFalse(Comparison.isGap(al.getSequenceAt(1).getSequence()[10])); + assertTrue(Comparison.isGap(al.getSequenceAt(1).getSequence()[11])); + assertTrue(Comparison.isGap(al.getSequenceAt(1).getSequence()[12])); + assertTrue(Comparison.isGap(al.getSequenceAt(1).getSequence()[13])); + assertFalse(Comparison.isGap(al.getSequenceAt(1).getSequence()[14])); + + } + + @Test(groups = "Functional") + public void testPropagateInsertionsOverlap() + { + // test propagateInsertions where gaps and hiddenColumns overlap + + // create an alignment with no gaps - this will be the profile seq and other + // JPRED seqs + AlignmentGenerator gen = new AlignmentGenerator(false); + AlignmentI al = gen.generate(20, 10, 1234, 0, 0); + + // get the profileseq + SequenceI profileseq = al.getSequenceAt(0); + SequenceI gappedseq = new Sequence(profileseq); + gappedseq.insertCharAt(5, al.getGapCharacter()); + gappedseq.insertCharAt(6, al.getGapCharacter()); + gappedseq.insertCharAt(7, al.getGapCharacter()); + gappedseq.insertCharAt(8, al.getGapCharacter()); + + // create an alignment view with the gapped sequence + SequenceI[] seqs = new SequenceI[1]; + seqs[0] = gappedseq; + AlignmentI newal = new Alignment(seqs); + + // hide columns so that some overlap with the gaps + HiddenColumns hidden = new HiddenColumns(); + hidden.hideColumns(7, 10); + + AlignmentView view = new AlignmentView(newal, hidden, null, true, false, + false); + + // confirm that original contigs are as expected + Iterator visible = hidden.getVisContigsIterator(0, 20, false); + int[] region = visible.next(); + assertEquals("[0, 6]", Arrays.toString(region)); + region = visible.next(); + assertEquals("[11, 19]", Arrays.toString(region)); + assertFalse(visible.hasNext()); + + // propagate insertions + HiddenColumns result = al.propagateInsertions(profileseq, view); + + // confirm that the contigs have changed to account for the gaps + visible = result.getVisContigsIterator(0, 20, false); + region = visible.next(); + assertEquals("[0, 4]", Arrays.toString(region)); + region = visible.next(); + assertEquals("[7, 19]", Arrays.toString(region)); + assertFalse(visible.hasNext()); + + // confirm the alignment has been changed so that the other sequences have + // gaps inserted where the columns are hidden + assertFalse(Comparison.isGap(al.getSequenceAt(1).getSequence()[4])); + assertTrue(Comparison.isGap(al.getSequenceAt(1).getSequence()[5])); + assertTrue(Comparison.isGap(al.getSequenceAt(1).getSequence()[6])); + assertFalse(Comparison.isGap(al.getSequenceAt(1).getSequence()[7])); + } + + @Test(groups = { "Functional" }) + public void testPadGaps() + { + SequenceI seq1 = new Sequence("seq1", "ABCDEF--"); + SequenceI seq2 = new Sequence("seq2", "-JKLMNO--"); + SequenceI seq3 = new Sequence("seq2", "-PQR"); + AlignmentI a = new Alignment(new SequenceI[] { seq1, seq2, seq3 }); + a.setGapCharacter('.'); // this replaces existing gaps + assertEquals("ABCDEF..", seq1.getSequenceAsString()); + a.padGaps(); + // trailing gaps are pruned, short sequences padded with gap character + assertEquals("ABCDEF.", seq1.getSequenceAsString()); + assertEquals(".JKLMNO", seq2.getSequenceAsString()); + assertEquals(".PQR...", seq3.getSequenceAsString()); + } + + /** + * Test for setHiddenColumns, to check it returns true if the hidden columns + * have changed, else false + */ + @Test(groups = { "Functional" }) + public void testSetHiddenColumns() + { + AlignmentI al = new Alignment(new SequenceI[] {}); + assertFalse(al.getHiddenColumns().hasHiddenColumns()); + + HiddenColumns hc = new HiddenColumns(); + assertFalse(al.setHiddenColumns(hc)); // no change + assertSame(hc, al.getHiddenColumns()); + + hc.hideColumns(2, 4); + assertTrue(al.getHiddenColumns().hasHiddenColumns()); + + /* + * set a different object but with the same columns hidden + */ + HiddenColumns hc2 = new HiddenColumns(); + hc2.hideColumns(2, 4); + assertFalse(al.setHiddenColumns(hc2)); // no change + assertSame(hc2, al.getHiddenColumns()); + + assertTrue(al.setHiddenColumns(null)); + assertNull(al.getHiddenColumns()); + assertTrue(al.setHiddenColumns(hc)); + assertSame(hc, al.getHiddenColumns()); + + al.getHiddenColumns().hideColumns(10, 12); + hc2.hideColumns(10, 12); + assertFalse(al.setHiddenColumns(hc2)); // no change + + /* + * hide columns 15-16 then 17-18 in hc + * hide columns 15-18 in hc2 + * these are not now 'equal' objects even though they + * represent the same set of columns + */ + assertSame(hc2, al.getHiddenColumns()); + hc.hideColumns(15, 16); + hc.hideColumns(17, 18); + hc2.hideColumns(15, 18); + assertFalse(hc.equals(hc2)); + assertTrue(al.setHiddenColumns(hc)); // 'changed' + } + + @Test(groups = { "Functional" }) + public void testGetWidth() + { + SequenceI seq1 = new Sequence("seq1", "ABCDEF--"); + SequenceI seq2 = new Sequence("seq2", "-JKLMNO--"); + SequenceI seq3 = new Sequence("seq2", "-PQR"); + AlignmentI a = new Alignment(new SequenceI[] { seq1, seq2, seq3 }); + + assertEquals(9, a.getWidth()); + + // width includes hidden columns + a.getHiddenColumns().hideColumns(2, 5); + assertEquals(9, a.getWidth()); + } + + @Test(groups = { "Functional" }) + public void testGetVisibleWidth() + { + SequenceI seq1 = new Sequence("seq1", "ABCDEF--"); + SequenceI seq2 = new Sequence("seq2", "-JKLMNO--"); + SequenceI seq3 = new Sequence("seq2", "-PQR"); + AlignmentI a = new Alignment(new SequenceI[] { seq1, seq2, seq3 }); + + assertEquals(9, a.getVisibleWidth()); + + // width excludes hidden columns + a.getHiddenColumns().hideColumns(2, 5); + assertEquals(5, a.getVisibleWidth()); + } + + @Test(groups = { "Functional" }) + public void testGetContactMap() + { + // TODO + // 1. test adding/removing/manipulating contact maps with/without associated + // sequence(s) or groups + // 2. For sequence associated - ensure that inserting a gap in sequence + // results in the contact map being relocated accordingly + // 3. RENDERER QUESTION - should contact maps reflect gaps in the alignment + // ? + + } + + @Test(groups = { "Functional" }) + public void testEquals() + { + SequenceI seq1 = new Sequence("seq1", "ABCDEF--"); + SequenceI seq2 = new Sequence("seq2", "-JKLMNO--"); + SequenceI seq3 = new Sequence("seq2", "-PQR"); + AlignmentI a = new Alignment(new SequenceI[] { seq1, seq2, seq3 }); + a.setDataset(null); + assertEquals(a.getDataset(), a.getDataset()); } }