X-Git-Url: http://source.jalview.org/gitweb/?a=blobdiff_plain;f=test%2Fjalview%2Fdatamodel%2FSeqCigarTest.java;h=8d3c878a5a37eb09139d2ff1836d987d7da09f51;hb=bee12714a66f2586e674ca2470efb6d8de79df58;hp=b8748b64c4631ed7b0128f1e7a24efb35523c307;hpb=3412b273e964fb1a9d22564b04a5f0c827ec2461;p=jalview.git diff --git a/test/jalview/datamodel/SeqCigarTest.java b/test/jalview/datamodel/SeqCigarTest.java index b8748b6..8d3c878 100644 --- a/test/jalview/datamodel/SeqCigarTest.java +++ b/test/jalview/datamodel/SeqCigarTest.java @@ -1,8 +1,30 @@ +/* + * Jalview - A Sequence Alignment Editor and Viewer ($$Version-Rel$$) + * Copyright (C) $$Year-Rel$$ The Jalview Authors + * + * This file is part of Jalview. + * + * Jalview is free software: you can redistribute it and/or + * modify it under the terms of the GNU General Public License + * as published by the Free Software Foundation, either version 3 + * of the License, or (at your option) any later version. + * + * Jalview is distributed in the hope that it will be useful, but + * WITHOUT ANY WARRANTY; without even the implied warranty + * of MERCHANTABILITY or FITNESS FOR A PARTICULAR + * PURPOSE. See the GNU General Public License for more details. + * + * You should have received a copy of the GNU General Public License + * along with Jalview. If not, see . + * The Jalview Authors are detailed in the 'AUTHORS' file. + */ package jalview.datamodel; import static org.testng.AssertJUnit.assertEquals; import static org.testng.AssertJUnit.assertFalse; +import jalview.util.Comparison; + import org.testng.annotations.Test; /** @@ -10,12 +32,35 @@ import org.testng.annotations.Test; */ public class SeqCigarTest { + @Test(groups = { "Functional" }) + public void testFindPosition() + { + SequenceI oseq = new Sequence("MySeq", "ASD---ASD---ASD", 37, 45); + oseq.createDatasetSequence(); + SeqCigar cs = new SeqCigar(oseq); + assertEquals(oseq.getSequenceAsString(), cs.getSequenceString('-')); + for (int c = 0, cLen = oseq.getLength(); c < cLen; c++) + { + int os_p = oseq.findPosition(c); + int cigar_p = cs.findPosition(c); + if (Comparison.isGap(oseq.getCharAt(c))) + { + assertEquals("Expected gap at position " + os_p + " column " + c, + -1, cigar_p); + } + else + { + assertEquals("Positions don't match for at column " + c, os_p, + cigar_p); + } + } + } /* * refactored 'as is' from main method * * TODO: split into separate tests */ - @Test + @Test(groups = { "Functional" }) public void testSomething() throws Exception { String o_seq = "asdfktryasdtqwrtsaslldddptyipqqwaslchvhttt"; @@ -51,7 +96,7 @@ public class SeqCigarTest */ assertEquals("Failed getWidth", sub_gapped_s.length(), sub_gapped.getWidth()); - + sub_gapped.getFullWidth(); assertFalse("hasDeletedRegions is incorrect", sub_gapped.hasDeletedRegions()); @@ -86,9 +131,8 @@ public class SeqCigarTest } } - SeqCigar[] set = new SeqCigar[] - { new SeqCigar(s), new SeqCigar(s_subsequence_gapped, 8, 48), - new SeqCigar(s_gapped) }; + SeqCigar[] set = new SeqCigar[] { new SeqCigar(s), + new SeqCigar(s_subsequence_gapped, 8, 48), new SeqCigar(s_gapped) }; Alignment al = new Alignment(set); for (int i = 0; i < al.getHeight(); i++) { @@ -99,9 +143,8 @@ public class SeqCigarTest } System.out.println("Gapped."); - set = new SeqCigar[] - { new SeqCigar(s), new SeqCigar(s_subsequence_gapped, 8, 48), - new SeqCigar(s_gapped) }; + set = new SeqCigar[] { new SeqCigar(s), + new SeqCigar(s_subsequence_gapped, 8, 48), new SeqCigar(s_gapped) }; set[0].deleteRange(20, 25); al = new Alignment(set); for (int i = 0; i < al.getHeight(); i++) @@ -126,18 +169,14 @@ public class SeqCigarTest * @return String */ - protected void testCigar_string(Sequence seq, String ex_cs_gapped) { SeqCigar c_sgapped = new SeqCigar(seq); String cs_gapped = c_sgapped.getCigarstring(); - assertEquals("Failed getCigarstring", ex_cs_gapped, - cs_gapped); + assertEquals("Failed getCigarstring", ex_cs_gapped, cs_gapped); } - - protected void testSeqRecovery(SeqCigar gen_sgapped, - SequenceI s_gapped) + protected void testSeqRecovery(SeqCigar gen_sgapped, SequenceI s_gapped) { // this is non-rigorous - start and end recovery is not tested. SequenceI gen_sgapped_s = gen_sgapped.getSeq('-');