X-Git-Url: http://source.jalview.org/gitweb/?a=blobdiff_plain;f=test%2Fjalview%2Fext%2Fensembl%2FEnsemblSeqProxyTest.java;h=69b2ad48a75b9c681b737e30c1078f468999fa3c;hb=05c12ef9626200844bf5067056f03e84090565b3;hp=3ca74b06ddacd399f6d141ed485e0b3369734728;hpb=b03ec66ae6238b44bd20d2403d1157cadc5f0e01;p=jalview.git diff --git a/test/jalview/ext/ensembl/EnsemblSeqProxyTest.java b/test/jalview/ext/ensembl/EnsemblSeqProxyTest.java index 3ca74b0..69b2ad4 100644 --- a/test/jalview/ext/ensembl/EnsemblSeqProxyTest.java +++ b/test/jalview/ext/ensembl/EnsemblSeqProxyTest.java @@ -1,25 +1,58 @@ +/* + * Jalview - A Sequence Alignment Editor and Viewer ($$Version-Rel$$) + * Copyright (C) $$Year-Rel$$ The Jalview Authors + * + * This file is part of Jalview. + * + * Jalview is free software: you can redistribute it and/or + * modify it under the terms of the GNU General Public License + * as published by the Free Software Foundation, either version 3 + * of the License, or (at your option) any later version. + * + * Jalview is distributed in the hope that it will be useful, but + * WITHOUT ANY WARRANTY; without even the implied warranty + * of MERCHANTABILITY or FITNESS FOR A PARTICULAR + * PURPOSE. See the GNU General Public License for more details. + * + * You should have received a copy of the GNU General Public License + * along with Jalview. If not, see . + * The Jalview Authors are detailed in the 'AUTHORS' file. + */ package jalview.ext.ensembl; -import jalview.datamodel.Alignment; +import static org.testng.AssertJUnit.assertEquals; +import static org.testng.AssertJUnit.assertSame; + import jalview.datamodel.AlignmentI; +import jalview.datamodel.SequenceFeature; import jalview.datamodel.SequenceI; -import jalview.io.AppletFormatAdapter; +import jalview.datamodel.features.SequenceFeatures; +import jalview.gui.JvOptionPane; +import jalview.io.DataSourceType; import jalview.io.FastaFile; -import jalview.io.FileParse; +import jalview.io.gff.SequenceOntologyFactory; +import jalview.io.gff.SequenceOntologyLite; import java.lang.reflect.Method; -import java.net.MalformedURLException; -import java.net.URL; import java.util.Arrays; import java.util.List; import org.testng.Assert; +import org.testng.annotations.AfterClass; +import org.testng.annotations.BeforeClass; import org.testng.annotations.DataProvider; import org.testng.annotations.Test; - public class EnsemblSeqProxyTest { + + @BeforeClass(alwaysRun = true) + public void setUpJvOptionPane() + { + JvOptionPane.setInteractiveMode(false); + JvOptionPane.setMockResponse(JvOptionPane.CANCEL_OPTION); + } + private static final Object[][] allSeqs = new Object[][] { { new EnsemblProtein(), @@ -91,7 +124,11 @@ public class EnsemblSeqProxyTest + "LKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPLTTHNFVRK\n" + "TFFTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVSKFFEHHPI\n" + "PQEEASLAETALTSGSSPSAPASDSIGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQR\n" - + "DRSSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSP\n" + + "DRSSSAPNVHINTIEPVNIDDLIRDQGFRGDG\n" + // ? insertion added in ENSP00000288602.11, not in P15056 + + "APLNQLMRCLRKYQSRTPSPLLHSVPSEIVFDFEPGPVFR\n" + // end insertion + + "GSTTGLSATPPASLPGSLTNVKALQKSP\n" + "GPQRERKSSSSSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDV\n" + "AVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHH\n" + "LHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATV\n" @@ -99,20 +136,16 @@ public class EnsemblSeqProxyTest + "NRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARS\n" + "LPKIHRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGAFPVH" } }; - @DataProvider(name = "queries") - public Object[][] createQueryData(Method m) + @BeforeClass(alwaysRun = true) + public void setUp() { - return new Object[][] { { "CCDS5863.1" }, { "ENSP00000288602" } }; + SequenceOntologyFactory.setInstance(new SequenceOntologyLite()); } - @Test(dataProvider = "queries") - public void testIsValidReference(String query) throws Exception + @AfterClass(alwaysRun = true) + public void tearDown() { - EnsemblSequenceFetcher esq = new EnsemblProtein(); - Assert.assertTrue(esq.isValidReference(query), - "Expected reference string " + query - + " to be valid for regex " - + esq.getAccessionValidator().toString()); + SequenceOntologyFactory.setInstance(null); } @DataProvider(name = "ens_seqs") @@ -123,23 +156,21 @@ public class EnsemblSeqProxyTest } @Test(dataProvider = "ens_seqs", suiteName = "live") - public void testGetOneSeqs(EnsemblRestClient proxy, String sq, String fastasq) - throws Exception + public void testGetSequenceRecords(EnsemblSeqProxy proxy, String sq, + String fastasq) throws Exception { - FileParse fp = proxy.getSequenceReader(Arrays - .asList(new String[] - { sq })); - SequenceI[] sqs = new FastaFile(fp).getSeqsAsArray(); - FastaFile trueRes = new FastaFile(fastasq, AppletFormatAdapter.PASTE); - SequenceI[] trueSqs = trueRes.getSeqsAsArray(); - Assert.assertEquals(sqs.length, trueSqs.length, + FastaFile trueRes = new FastaFile(fastasq, DataSourceType.PASTE); + SequenceI[] expected = trueRes.getSeqsAsArray(); + AlignmentI retrieved = proxy.getSequenceRecords(sq); + + Assert.assertEquals(retrieved.getHeight(), expected.length, "Different number of sequences retrieved for query " + sq); - Alignment ral = new Alignment(sqs); - for (SequenceI tr : trueSqs) + + for (SequenceI tr : expected) { SequenceI[] rseq; Assert.assertNotNull( - rseq = ral.findSequenceMatch(tr.getName()), + rseq = retrieved.findSequenceMatch(tr.getName()), "Couldn't find sequences matching expected sequence " + tr.getName()); Assert.assertEquals(rseq.length, 1, @@ -150,62 +181,83 @@ public class EnsemblSeqProxyTest "Sequences differ for " + tr.getName() + "\n" + "Exp:" + tr.getSequenceAsString() + "\n" + "Got:" + rseq[0].getSequenceAsString()); - } } - @Test(suiteName = "live") - public void testLiveCheckEnsembl() + @Test(groups = "Functional") + public void getGenomicRangesFromFeatures() { - EnsemblRestClient sf = new EnsemblRestClient() - { - @Override - public String getDbName() - { - // TODO Auto-generated method stub - return null; - } + } - @Override - public AlignmentI getSequenceRecords(String queries) throws Exception - { - // TODO Auto-generated method stub - return null; - } + /** + * Test the method that appends a single allele's reverse complement to a + * string buffer + */ + @Test(groups = "Functional") + public void testReverseComplementAllele() + { + StringBuilder sb = new StringBuilder(); + EnsemblSeqProxy.reverseComplementAllele(sb, "G"); // comp=C + EnsemblSeqProxy.reverseComplementAllele(sb, "g"); // comp=c + EnsemblSeqProxy.reverseComplementAllele(sb, "C"); // comp=G + EnsemblSeqProxy.reverseComplementAllele(sb, "T"); // comp=A + EnsemblSeqProxy.reverseComplementAllele(sb, "A"); // comp=T + assertEquals("C,c,G,A,T", sb.toString()); - @Override - protected URL getUrl(List ids) throws MalformedURLException - { - // TODO Auto-generated method stub - return null; - } + sb = new StringBuilder(); + EnsemblSeqProxy.reverseComplementAllele(sb, "-GATt"); // revcomp=aATC- + EnsemblSeqProxy.reverseComplementAllele(sb, "hgmd_mutation"); + EnsemblSeqProxy.reverseComplementAllele(sb, "PhenCode_variation"); + assertEquals("aATC-,hgmd_mutation,PhenCode_variation", sb.toString()); + } - @Override - public boolean useGetRequest() - { - // TODO Auto-generated method stub - return false; - } + /** + * Test the method that computes the reverse complement of the alleles in a + * sequence_variant feature + */ + @Test(groups = "Functional") + public void testReverseComplementAlleles() + { + String alleles = "C,G,-TAC,HGMD_MUTATION,gac"; + SequenceFeature sf = new SequenceFeature("sequence_variant", alleles, + 1, 2, 0f, null); + sf.setValue("alleles", alleles); + sf.setAttributes("x=y,z;alleles=" + alleles + ";a=b,c"); - @Override - public String getRequestMimeType() - { - // TODO Auto-generated method stub - return null; - } + EnsemblSeqProxy.reverseComplementAlleles(sf); + String revcomp = "G,C,GTA-,HGMD_MUTATION,gtc"; + // verify description is updated with reverse complement + assertEquals(revcomp, sf.getDescription()); + // verify alleles attribute is updated with reverse complement + assertEquals(revcomp, sf.getValue("alleles")); + // verify attributes string is updated with reverse complement + assertEquals("x=y,z;alleles=" + revcomp + ";a=b,c", sf.getAttributes()); + } - @Override - public String getResponseMimeType() - { - // TODO Auto-generated method stub - return null; - } - - }; - boolean isAvailable = sf.isEnsemblAvailable(); - System.out.println("Ensembl is " - + (isAvailable ? "UP!" - : "DOWN or unreachable ******************* BAD!")); + @Test(groups = "Functional") + public void testSortFeatures() + { + SequenceFeature sf1 = new SequenceFeature("", "", 10, 15, 0f, null); + SequenceFeature sf2 = new SequenceFeature("", "", 8, 12, 0f, null); + SequenceFeature sf3 = new SequenceFeature("", "", 8, 13, 0f, null); + SequenceFeature sf4 = new SequenceFeature("", "", 11, 11, 0f, null); + List sfs = Arrays.asList(new SequenceFeature[] { sf1, + sf2, sf3, sf4 }); + + // sort by start position ascending (forward strand) + // sf2 and sf3 tie and should not be reordered by sorting + SequenceFeatures.sortFeatures(sfs, true); + assertSame(sfs.get(0), sf2); + assertSame(sfs.get(1), sf3); + assertSame(sfs.get(2), sf1); + assertSame(sfs.get(3), sf4); + + // sort by end position descending (reverse strand) + SequenceFeatures.sortFeatures(sfs, false); + assertSame(sfs.get(0), sf1); + assertSame(sfs.get(1), sf3); + assertSame(sfs.get(2), sf2); + assertSame(sfs.get(3), sf4); } -} \ No newline at end of file +}