X-Git-Url: http://source.jalview.org/gitweb/?a=blobdiff_plain;f=test%2Fjalview%2Fext%2Fensembl%2FEnsemblSeqProxyTest.java;h=e97723369c5813ebb55afab8097c32cde61b7dfe;hb=6b90cce63b09fca914a35d49a1b6883664e48a29;hp=71f0212a2cc07d3a7aad3a26e45d3434374c5a85;hpb=0ae70dbd95d7eb6932c1ec1252628f58f0989668;p=jalview.git diff --git a/test/jalview/ext/ensembl/EnsemblSeqProxyTest.java b/test/jalview/ext/ensembl/EnsemblSeqProxyTest.java index 71f0212..e977233 100644 --- a/test/jalview/ext/ensembl/EnsemblSeqProxyTest.java +++ b/test/jalview/ext/ensembl/EnsemblSeqProxyTest.java @@ -1,3 +1,23 @@ +/* + * Jalview - A Sequence Alignment Editor and Viewer ($$Version-Rel$$) + * Copyright (C) $$Year-Rel$$ The Jalview Authors + * + * This file is part of Jalview. + * + * Jalview is free software: you can redistribute it and/or + * modify it under the terms of the GNU General Public License + * as published by the Free Software Foundation, either version 3 + * of the License, or (at your option) any later version. + * + * Jalview is distributed in the hope that it will be useful, but + * WITHOUT ANY WARRANTY; without even the implied warranty + * of MERCHANTABILITY or FITNESS FOR A PARTICULAR + * PURPOSE. See the GNU General Public License for more details. + * + * You should have received a copy of the GNU General Public License + * along with Jalview. If not, see . + * The Jalview Authors are detailed in the 'AUTHORS' file. + */ package jalview.ext.ensembl; import static org.testng.AssertJUnit.assertEquals; @@ -6,20 +26,17 @@ import static org.testng.AssertJUnit.assertTrue; import static org.testng.internal.junit.ArrayAsserts.assertArrayEquals; import jalview.datamodel.Alignment; -import jalview.datamodel.AlignmentI; import jalview.datamodel.SequenceFeature; import jalview.datamodel.SequenceI; -import jalview.io.AppletFormatAdapter; +import jalview.gui.JvOptionPane; +import jalview.io.DataSourceType; import jalview.io.FastaFile; import jalview.io.FileParse; import jalview.io.gff.SequenceOntologyFactory; import jalview.io.gff.SequenceOntologyLite; import java.lang.reflect.Method; -import java.net.MalformedURLException; -import java.net.URL; import java.util.Arrays; -import java.util.List; import org.testng.Assert; import org.testng.annotations.AfterClass; @@ -27,9 +44,16 @@ import org.testng.annotations.BeforeClass; import org.testng.annotations.DataProvider; import org.testng.annotations.Test; - public class EnsemblSeqProxyTest { + + @BeforeClass(alwaysRun = true) + public void setUpJvOptionPane() + { + JvOptionPane.setInteractiveMode(false); + JvOptionPane.setMockResponse(JvOptionPane.CANCEL_OPTION); + } + private static final Object[][] allSeqs = new Object[][] { { new EnsemblProtein(), @@ -109,13 +133,13 @@ public class EnsemblSeqProxyTest + "NRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARS\n" + "LPKIHRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGAFPVH" } }; - @BeforeClass + @BeforeClass(alwaysRun = true) public void setUp() { SequenceOntologyFactory.setInstance(new SequenceOntologyLite()); } - @AfterClass + @AfterClass(alwaysRun = true) public void tearDown() { SequenceOntologyFactory.setInstance(null); @@ -129,14 +153,13 @@ public class EnsemblSeqProxyTest } @Test(dataProvider = "ens_seqs", suiteName = "live") - public void testGetOneSeqs(EnsemblRestClient proxy, String sq, String fastasq) - throws Exception + public void testGetOneSeqs(EnsemblRestClient proxy, String sq, + String fastasq) throws Exception { FileParse fp = proxy.getSequenceReader(Arrays - .asList(new String[] - { sq })); + .asList(new String[] { sq })); SequenceI[] sqs = new FastaFile(fp).getSeqsAsArray(); - FastaFile trueRes = new FastaFile(fastasq, AppletFormatAdapter.PASTE); + FastaFile trueRes = new FastaFile(fastasq, DataSourceType.PASTE); SequenceI[] trueSqs = trueRes.getSeqsAsArray(); Assert.assertEquals(sqs.length, trueSqs.length, "Different number of sequences retrieved for query " + sq); @@ -156,63 +179,8 @@ public class EnsemblSeqProxyTest "Sequences differ for " + tr.getName() + "\n" + "Exp:" + tr.getSequenceAsString() + "\n" + "Got:" + rseq[0].getSequenceAsString()); - - } - } - - @Test(suiteName = "live") - public void testLiveCheckEnsembl() - { - EnsemblRestClient sf = new EnsemblRestClient() - { - - @Override - public String getDbName() - { - // TODO Auto-generated method stub - return null; - } - @Override - public AlignmentI getSequenceRecords(String queries) throws Exception - { - // TODO Auto-generated method stub - return null; - } - - @Override - protected URL getUrl(List ids) throws MalformedURLException - { - // TODO Auto-generated method stub - return null; - } - - @Override - protected boolean useGetRequest() - { - // TODO Auto-generated method stub - return false; - } - - @Override - protected String getRequestMimeType(boolean b) - { - // TODO Auto-generated method stub - return null; - } - - @Override - protected String getResponseMimeType() - { - // TODO Auto-generated method stub - return null; - } - - }; - boolean isAvailable = sf.isEnsemblAvailable(); - System.out.println("Ensembl is " - + (isAvailable ? "UP!" - : "DOWN or unreachable ******************* BAD!")); + } } @Test(groups = "Functional") @@ -312,4 +280,4 @@ public class EnsemblSeqProxyTest EnsemblSeqProxy.sortFeatures(sfs, false); assertArrayEquals(new SequenceFeature[] { sf1, sf3, sf2, sf4 }, sfs); } -} \ No newline at end of file +}