X-Git-Url: http://source.jalview.org/gitweb/?a=blobdiff_plain;f=test%2Fjalview%2Fio%2FJSONFileTest.java;h=0fe721a879332e31d7861055676ed3ddd0c4e1e7;hb=refs%2Fheads%2Fimprovement%2FJAL-3847_some_attempts_to_set_gradle_and_groovy_versions;hp=92b172c13920386288b8997dc49efc03d387c46a;hpb=e2d6753e8cf3c5eaf8bccf34f4f5e9d651e9cb8e;p=jalview.git diff --git a/test/jalview/io/JSONFileTest.java b/test/jalview/io/JSONFileTest.java index 92b172c..0fe721a 100644 --- a/test/jalview/io/JSONFileTest.java +++ b/test/jalview/io/JSONFileTest.java @@ -1,51 +1,109 @@ +/* + * Jalview - A Sequence Alignment Editor and Viewer ($$Version-Rel$$) + * Copyright (C) $$Year-Rel$$ The Jalview Authors + * + * This file is part of Jalview. + * + * Jalview is free software: you can redistribute it and/or + * modify it under the terms of the GNU General Public License + * as published by the Free Software Foundation, either version 3 + * of the License, or (at your option) any later version. + * + * Jalview is distributed in the hope that it will be useful, but + * WITHOUT ANY WARRANTY; without even the implied warranty + * of MERCHANTABILITY or FITNESS FOR A PARTICULAR + * PURPOSE. See the GNU General Public License for more details. + * + * You should have received a copy of the GNU General Public License + * along with Jalview. If not, see . + * The Jalview Authors are detailed in the 'AUTHORS' file. + */ package jalview.io; +import static org.testng.AssertJUnit.assertNotNull; -import static org.junit.Assert.assertNotNull; +import jalview.api.AlignExportSettingsI; +import jalview.datamodel.AlignExportSettingsAdapter; import jalview.datamodel.Alignment; import jalview.datamodel.AlignmentAnnotation; import jalview.datamodel.AlignmentI; import jalview.datamodel.Annotation; +import jalview.datamodel.HiddenColumns; import jalview.datamodel.Sequence; import jalview.datamodel.SequenceFeature; import jalview.datamodel.SequenceGroup; import jalview.datamodel.SequenceI; +import jalview.datamodel.features.SequenceFeatures; import jalview.gui.AlignFrame; -import jalview.gui.AlignmentPanel; +import jalview.gui.JvOptionPane; +import jalview.json.binding.biojson.v1.ColourSchemeMapper; import jalview.schemes.ColourSchemeI; -import jalview.viewmodel.seqfeatures.FeaturesDisplayed; +import jalview.schemes.ResidueColourScheme; import java.io.IOException; import java.util.ArrayList; import java.util.HashMap; - -import org.junit.After; -import org.junit.Assert; -import org.junit.Before; -import org.junit.Test; +import java.util.Iterator; +import java.util.List; +import java.util.Map; + +import org.testng.Assert; +import org.testng.AssertJUnit; +import org.testng.annotations.AfterTest; +import org.testng.annotations.BeforeClass; +import org.testng.annotations.BeforeMethod; +import org.testng.annotations.BeforeTest; +import org.testng.annotations.Test; public class JSONFileTest { + @BeforeClass(alwaysRun = true) + public void setUpJvOptionPane() + { + JvOptionPane.setInteractiveMode(false); + JvOptionPane.setMockResponse(JvOptionPane.CANCEL_OPTION); + } + private int TEST_SEQ_HEIGHT = 0; private int TEST_GRP_HEIGHT = 0; private int TEST_ANOT_HEIGHT = 0; - private AlignFrame af; + private int TEST_CS_HEIGHT = 0; + + private String TEST_JSON_FILE = "examples/example.json"; + + private Alignment alignment; + + private HashMap expectedSeqs = new HashMap<>(); - AlignmentI alignment; + private HashMap expectedAnnots = new HashMap<>(); - AlignmentPanel alignPanel; + private HashMap expectedGrps = new HashMap<>(); - HashMap testSeqs = new HashMap(); - HashMap testAnnots = new HashMap(); - HashMap testGrps = new HashMap(); + private HiddenColumns expectedColSel = new HiddenColumns(); - @Before + private SequenceI[] expectedHiddenSeqs = new SequenceI[1]; + + private AlignmentI testAlignment; + + private int passedCount; + + private JSONFile testJsonFile; + + private JSONFile jf; + + private AlignExportSettingsI exportSettings; + + @BeforeTest(alwaysRun = true) public void setup() throws Exception { + /* + * construct expected values + * nb this have to match the data in examples/example.json + */ // create and add sequences Sequence[] seqs = new Sequence[5]; seqs[0] = new Sequence("FER_CAPAN", @@ -59,43 +117,46 @@ public class JSONFileTest seqs[4] = new Sequence("Q7XA98_TRIPR", "ALYGTAVSTSFMRRQPVPMSV-ATTTTTKAFPSGF", 6, 39); + SequenceI hiddenSeq = new Sequence("FER_TOCH", + "FILGTMISKSFLFRKPAVTSL-KAISNVGE--ALF", 3, 34); + expectedHiddenSeqs[0] = hiddenSeq; + // create and add sequence features SequenceFeature seqFeature2 = new SequenceFeature("feature_x", - "desciption", "status", 6, 15, "Jalview"); + "theDesc", 6, 15, "Jalview"); SequenceFeature seqFeature3 = new SequenceFeature("feature_x", - "desciption", "status", 9, 18, "Jalview"); + "theDesc", 9, 18, "Jalview"); SequenceFeature seqFeature4 = new SequenceFeature("feature_x", - "desciption", "status", 9, 18, "Jalview"); + "theDesc", 9, 18, "Jalview"); + // non-positional feature: + SequenceFeature seqFeature5 = new SequenceFeature("Domain", + "My description", 0, 0, "Pfam"); seqs[2].addSequenceFeature(seqFeature2); seqs[3].addSequenceFeature(seqFeature3); seqs[4].addSequenceFeature(seqFeature4); - - // add created features to features displayed - FeaturesDisplayed fDis = new FeaturesDisplayed(); - fDis.setVisible("feature_x"); - // jsonFile.setDisplayedFeatures(fDis); - // jsonFile.setShowSeqFeatures(true); + seqs[2].addSequenceFeature(seqFeature5); for (Sequence seq : seqs) { - seq.setDatasetSequence(seq); - testSeqs.put(seq.getName(), seq); - // jsonFile.seqs.add(seq); + seq.createDatasetSequence(); + expectedSeqs.put(seq.getName(), seq); } - // create and add sequence groups - ArrayList grpSeqs = new ArrayList(); + // create and add a sequence group + List grpSeqs = new ArrayList<>(); grpSeqs.add(seqs[1]); grpSeqs.add(seqs[2]); grpSeqs.add(seqs[3]); grpSeqs.add(seqs[4]); - ColourSchemeI scheme = JSONFile.getJalviewColorScheme("zappo"); SequenceGroup seqGrp = new SequenceGroup(grpSeqs, "JGroup:1883305585", - scheme, true, true, false, 21, 29); + null, true, true, false, 21, 29); + ColourSchemeI scheme = ColourSchemeMapper + .getJalviewColourScheme("zappo", seqGrp); + seqGrp.cs.setColourScheme(scheme); seqGrp.setShowNonconserved(false); seqGrp.setDescription(null); - // jsonFile.seqGroups.add(seqGrp); - testGrps.put(seqGrp.getName(), seqGrp); + + expectedGrps.put(seqGrp.getName(), seqGrp); // create and add annotation Annotation[] annot = new Annotation[35]; @@ -137,73 +198,214 @@ public class JSONFileTest AlignmentAnnotation alignAnnot = new AlignmentAnnotation( "Secondary Structure", "New description", annot); - // jsonFile.annotations.add(alignAnnot); - testAnnots.put(alignAnnot.label, alignAnnot); + expectedAnnots.put(alignAnnot.label, alignAnnot); - // Alignment al = new Alignment(seqs); - TEST_SEQ_HEIGHT = testSeqs.size(); - TEST_GRP_HEIGHT = testGrps.size(); - TEST_ANOT_HEIGHT = testAnnots.size(); - } + expectedColSel.hideColumns(32, 33); + expectedColSel.hideColumns(34, 34); - @After - public void tearDown() throws Exception - { - } + TEST_SEQ_HEIGHT = expectedSeqs.size(); + TEST_GRP_HEIGHT = expectedGrps.size(); + TEST_ANOT_HEIGHT = expectedAnnots.size(); + TEST_CS_HEIGHT = expectedColSel.getNumberOfRegions(); - @Test - public void testParse() - { - String jsonFile = "examples/example.json"; - AppletFormatAdapter rf = new AppletFormatAdapter(); - Alignment al = null; + exportSettings = new AlignExportSettingsAdapter(true); + + AppletFormatAdapter formatAdapter = new AppletFormatAdapter(); try { - al = rf.readFile(jsonFile, AppletFormatAdapter.FILE, - JSONFile.FILE_DESC); + alignment = (Alignment) formatAdapter.readFile(TEST_JSON_FILE, + DataSourceType.FILE, FileFormat.Json); + jf = (JSONFile) formatAdapter.getAlignFile(); + + AlignFrame af = new AlignFrame(alignment, jf.getHiddenSequences(), + jf.getHiddenColumns(), AlignFrame.DEFAULT_WIDTH, + AlignFrame.DEFAULT_HEIGHT); + af.getViewport().setShowSequenceFeatures(jf.isShowSeqFeatures()); + String colourSchemeName = jf.getGlobalColourScheme(); + ColourSchemeI cs = ColourSchemeMapper + .getJalviewColourScheme(colourSchemeName, alignment); + af.changeColour(cs); + af.getViewport().setFeaturesDisplayed(jf.getDisplayedFeatures()); + + formatAdapter = new AppletFormatAdapter(af.alignPanel, + exportSettings); + String jsonOutput = formatAdapter.formatSequences(FileFormat.Json, + af.alignPanel.getAlignment(), false); + + formatAdapter = new AppletFormatAdapter(); + testAlignment = formatAdapter.readFile(jsonOutput, + DataSourceType.PASTE, FileFormat.Json); + testJsonFile = (JSONFile) formatAdapter.getAlignFile(); + System.out.println(jsonOutput); } catch (IOException e) { e.printStackTrace(); } - assertNotNull("Couldn't read supplied alignment data.", al); - int passedCount = 0; - for (SequenceI seq : al.getSequences()) + } + + @BeforeMethod(alwaysRun = true) + public void methodSetup() + { + passedCount = 0; + } + + @AfterTest(alwaysRun = true) + public void tearDown() throws Exception + { + testJsonFile = null; + alignment = null; + expectedSeqs = null; + expectedAnnots = null; + expectedGrps = null; + testAlignment = null; + jf = null; + } + + @Test(groups = { "Functional" }) + public void roundTripTest() + { + assertNotNull("JSON roundtrip test failed!", testJsonFile); + } + + @Test(groups = { "Functional" }) + public void testSeqParsed() + { + assertNotNull("Couldn't read supplied alignment data.", testAlignment); + Assert.assertNotNull(testAlignment.getSequences()); + for (SequenceI seq : testAlignment.getSequences()) { - SequenceI expectedSeq = testSeqs.get(seq.getName()); - Assert.assertTrue("Failed Sequence Test for >>> " + seq.getName(), + SequenceI expectedSeq = expectedSeqs.get(seq.getName()); + AssertJUnit.assertTrue( + "Failed Sequence Test for >>> " + seq.getName(), isSeqMatched(expectedSeq, seq)); passedCount++; } - Assert.assertEquals("Some Sequences did not pass the test", + AssertJUnit.assertEquals("Some Sequences did not pass the test", TEST_SEQ_HEIGHT, passedCount); + } - passedCount = 0; - for (SequenceGroup seqGrp : al.getGroups()) + @Test(groups = { "Functional" }) + public void hiddenColsTest() + { + HiddenColumns cs = testJsonFile.getHiddenColumns(); + Assert.assertNotNull(cs); + + Iterator it = cs.iterator(); + Iterator colselit = expectedColSel.iterator(); + Assert.assertTrue(it.hasNext()); + Assert.assertEquals(cs.getNumberOfRegions(), TEST_CS_HEIGHT); + Assert.assertEquals(it.next(), colselit.next(), + "Mismatched hidden columns!"); + } + + @Test(groups = { "Functional" }) + public void hiddenSeqsTest() + { + Assert.assertNotNull(testJsonFile.getHiddenSequences(), + "Hidden sequence Expected but found Null"); + Assert.assertEquals(jf.getHiddenSequences().length, 1, + "Hidden sequence"); + } + + @Test(groups = { "Functional" }) + public void colorSchemeTest() + { + Assert.assertNotNull(testJsonFile.getGlobalColourScheme(), + "Colourscheme is null, parsing failed!"); + Assert.assertEquals(testJsonFile.getGlobalColourScheme(), "Zappo", + "Zappo colour scheme expected!"); + } + + /** + * Test for bug JAL-2489, NPE when exporting BioJSON with global colour + * scheme, and a group colour scheme, set as 'None' + */ + @Test(groups = { "Functional" }) + public void testBioJSONRoundTripWithColourSchemeNone() + { + AppletFormatAdapter formatAdapter = new AppletFormatAdapter(); + + Alignment _alignment; + try + { + // load example BioJSON file + _alignment = (Alignment) formatAdapter.readFile(TEST_JSON_FILE, + DataSourceType.FILE, FileFormat.Json); + JSONFile bioJsonFile = (JSONFile) formatAdapter.getAlignFile(); + AlignFrame alignFrame = new AlignFrame(_alignment, + bioJsonFile.getHiddenSequences(), + bioJsonFile.getHiddenColumns(), AlignFrame.DEFAULT_WIDTH, + AlignFrame.DEFAULT_HEIGHT); + + /* + * Create a group on the alignment; + * Change global and group colour scheme to 'None' and perform round trip + */ + SequenceGroup sg = new SequenceGroup(); + sg.addSequence(_alignment.getSequenceAt(0), false); + sg.setColourScheme(null); + ColourSchemeI cs = ColourSchemeMapper + .getJalviewColourScheme(ResidueColourScheme.NONE, _alignment); + alignFrame.changeColour(cs); + alignFrame.getViewport() + .setFeaturesDisplayed(bioJsonFile.getDisplayedFeatures()); + formatAdapter = new AppletFormatAdapter(alignFrame.alignPanel, + exportSettings); + // export BioJSON string + String jsonOutput = formatAdapter.formatSequences(FileFormat.Json, + alignFrame.alignPanel.getAlignment(), false); + // read back Alignment from BioJSON string + formatAdapter = new AppletFormatAdapter(); + formatAdapter.readFile(jsonOutput, DataSourceType.PASTE, + FileFormat.Json); + // assert 'None' colour scheme is retained after round trip + JSONFile _bioJsonFile = (JSONFile) formatAdapter.getAlignFile(); + Assert.assertEquals(_bioJsonFile.getGlobalColourScheme(), + ResidueColourScheme.NONE); + } catch (IOException e) + { + e.printStackTrace(); + } + } + + @Test(groups = { "Functional" }) + public void isShowSeqFeaturesSet() + { + Assert.assertTrue(testJsonFile.isShowSeqFeatures(), + "Sequence feature isDisplayed setting expected to be true"); + } + + @Test(groups = { "Functional" }) + public void testGrpParsed() + { + Assert.assertNotNull(testAlignment.getGroups()); + for (SequenceGroup seqGrp : testAlignment.getGroups()) { - SequenceGroup expectedGrp = testGrps.get(seqGrp.getName()); - Assert.assertTrue( + SequenceGroup expectedGrp = expectedGrps.get(seqGrp.getName()); + AssertJUnit.assertTrue( "Failed SequenceGroup Test for >>> " + seqGrp.getName(), isGroupMatched(expectedGrp, seqGrp)); passedCount++; } - Assert.assertEquals("Some SequenceGroups did not pass the test", + AssertJUnit.assertEquals("Some SequenceGroups did not pass the test", TEST_GRP_HEIGHT, passedCount); + } - passedCount = 0; - for (AlignmentAnnotation annot : al.getAlignmentAnnotation()) + @Test(groups = { "Functional" }) + public void testAnnotationParsed() + { + Assert.assertNotNull(testAlignment.getAlignmentAnnotation()); + for (AlignmentAnnotation annot : testAlignment.getAlignmentAnnotation()) { - AlignmentAnnotation expectedAnnot = testAnnots.get(annot.label); - Assert.assertTrue("Failed AlignmentAnnotation Test for >>> " - + annot.label, isAnnotationMatched(expectedAnnot, annot)); + AlignmentAnnotation expectedAnnot = expectedAnnots.get(annot.label); + AssertJUnit.assertTrue( + "Failed AlignmentAnnotation Test for >>> " + annot.label, + isAnnotationMatched(expectedAnnot, annot)); passedCount++; } - Assert.assertEquals("Some Sequences did not pass the test", + AssertJUnit.assertEquals("Some Sequences did not pass the test", TEST_ANOT_HEIGHT, passedCount); - - // af = new AlignFrame(al, 700, 500); - // AlignViewport viewport = af.getViewport(); - // alignPanel = new AlignmentPanel(af, viewport); } public boolean isAnnotationMatched(AlignmentAnnotation eAnnot, @@ -231,13 +433,13 @@ public class JSONFileTest return true; } - public boolean isSeqMatched(SequenceI expectedSeq, SequenceI actualSeq) + boolean isSeqMatched(SequenceI expectedSeq, SequenceI actualSeq) { System.out.println("Testing >>> " + actualSeq.getName()); if (expectedSeq.getName().equals(actualSeq.getName()) - && expectedSeq.getSequenceAsString().equals( - actualSeq.getSequenceAsString()) + && expectedSeq.getSequenceAsString() + .equals(actualSeq.getSequenceAsString()) && expectedSeq.getStart() == actualSeq.getStart() && expectedSeq.getEnd() == actualSeq.getEnd() && featuresMatched(expectedSeq, actualSeq)) @@ -261,19 +463,25 @@ public class JSONFileTest + actualGrp.getIgnoreGapsConsensus()); System.out.println(expectedGrp.getSequences().size() + " | " + actualGrp.getSequences().size()); - System.out.println(expectedGrp.getStartRes() + " | " - + actualGrp.getStartRes()); - System.out.println(expectedGrp.getEndRes() + " | " - + actualGrp.getEndRes()); - + System.out.println( + expectedGrp.getStartRes() + " | " + actualGrp.getStartRes()); + System.out.println( + expectedGrp.getEndRes() + " | " + actualGrp.getEndRes()); + System.out.println(expectedGrp.cs.getColourScheme() + " | " + + actualGrp.cs.getColourScheme()); + + boolean colourSchemeMatches = (expectedGrp.cs.getColourScheme() == null + && actualGrp.cs.getColourScheme() == null) + || expectedGrp.cs.getColourScheme().getClass() + .equals(actualGrp.cs.getColourScheme().getClass()); if (expectedGrp.getName().equals(actualGrp.getName()) && expectedGrp.getColourText() == actualGrp.getColourText() && expectedGrp.getDisplayBoxes() == actualGrp.getDisplayBoxes() && expectedGrp.getIgnoreGapsConsensus() == actualGrp .getIgnoreGapsConsensus() - && expectedGrp.cs.equals(actualGrp.cs) - && expectedGrp.getSequences().size() == actualGrp - .getSequences().size() + && colourSchemeMatches + && expectedGrp.getSequences().size() == actualGrp.getSequences() + .size() && expectedGrp.getStartRes() == actualGrp.getStartRes() && expectedGrp.getEndRes() == actualGrp.getEndRes()) { @@ -284,7 +492,6 @@ public class JSONFileTest private boolean featuresMatched(SequenceI seq1, SequenceI seq2) { - boolean matched = false; try { if (seq1 == null && seq2 == null) @@ -292,51 +499,137 @@ public class JSONFileTest return true; } - SequenceFeature[] inFeature = seq1.getSequenceFeatures(); - SequenceFeature[] outFeature = seq2.getSequenceFeatures(); + List inFeature = seq1.getFeatures().getAllFeatures(); + List outFeature = seq2.getFeatures() + .getAllFeatures(); - if (inFeature == null && outFeature == null) - { - return true; - } - else if ((inFeature == null && outFeature != null) - || (inFeature != null && outFeature == null)) + if (inFeature.size() != outFeature.size()) { + System.err.println("Feature count in: " + inFeature.size() + + ", out: " + outFeature.size()); return false; } - int testSize = inFeature.length; - int matchedCount = 0; + SequenceFeatures.sortFeatures(inFeature, true); + SequenceFeatures.sortFeatures(outFeature, true); + int i = 0; for (SequenceFeature in : inFeature) { - for (SequenceFeature out : outFeature) + SequenceFeature out = outFeature.get(i); + /* + System.out.println(out.getType() + " | " + in.getType()); + System.out.println(out.getBegin() + " | " + in.getBegin()); + System.out.println(out.getEnd() + " | " + in.getEnd()); + */ + if (!in.equals(out)) { - System.out.println(out.getType() + " | " + in.getType()); - System.out.println(out.getBegin() + " | " + in.getBegin()); - System.out.println(out.getEnd() + " | " + in.getEnd()); - - if (inFeature.length == outFeature.length - && in.getBegin() == out.getBegin() - && in.getEnd() == out.getEnd() - && in.getScore() == out.getScore() - && in.getFeatureGroup().equals(out.getFeatureGroup()) - && in.getType().equals(out.getType())) - { - - ++matchedCount; - } + System.err.println( + "Mismatch of " + in.toString() + " " + out.toString()); + return false; } - } - System.out.println("matched count >>>>>> " + matchedCount); - if (testSize == matchedCount) - { - matched = true; + /* + if (in.getBegin() == out.getBegin() && in.getEnd() == out.getEnd() + && in.getScore() == out.getScore() + && in.getFeatureGroup().equals(out.getFeatureGroup()) + && in.getType().equals(out.getType()) + && mapsMatch(in.otherDetails, out.otherDetails)) + { + } + else + { + System.err.println("Feature[" + i + "] mismatch, in: " + + in.toString() + ", out: " + + outFeature.get(i).toString()); + return false; + } + */ + i++; } } catch (Exception e) { e.printStackTrace(); } // System.out.println(">>>>>>>>>>>>>> features matched : " + matched); - return matched; + return true; + } + + boolean mapsMatch(Map m1, Map m2) + { + if (m1 == null || m2 == null) + { + if (m1 != null || m2 != null) + { + System.err.println( + "only one SequenceFeature.otherDetails is not null"); + return false; + } + else + { + return true; + } + } + if (m1.size() != m2.size()) + { + System.err.println("otherDetails map different sizes"); + return false; + } + for (String key : m1.keySet()) + { + if (!m2.containsKey(key)) + { + System.err.println(key + " in only one otherDetails"); + return false; + } + if (m1.get(key) == null && m2.get(key) != null + || m1.get(key) != null && m2.get(key) == null + || !m1.get(key).equals(m2.get(key))) + { + System.err.println(key + " values in otherDetails don't match"); + return false; + } + } + return true; + } + + /** + * Test group roundtrip with null (None) group colour scheme + * + * @throws IOException + */ + @Test(groups = { "Functional" }) + public void testGrpParsed_colourNone() throws IOException + { + AlignmentI copy = new Alignment(testAlignment); + SequenceGroup sg = testAlignment.getGroups().get(0); + SequenceGroup copySg = new SequenceGroup(new ArrayList(), + sg.getName(), null, sg.getDisplayBoxes(), sg.getDisplayText(), + sg.getColourText(), sg.getStartRes(), sg.getEndRes()); + for (SequenceI seq : sg.getSequences()) + { + int seqIndex = testAlignment.findIndex(seq); + copySg.addSequence(copy.getSequenceAt(seqIndex), false); + } + copy.addGroup(copySg); + + AlignFrame af = new AlignFrame(copy, copy.getWidth(), copy.getHeight()); + AppletFormatAdapter formatAdapter = new AppletFormatAdapter( + af.alignPanel); + String jsonOutput = formatAdapter.formatSequences(FileFormat.Json, copy, + false); + formatAdapter = new AppletFormatAdapter(); + AlignmentI newAlignment = formatAdapter.readFile(jsonOutput, + DataSourceType.PASTE, FileFormat.Json); + + Assert.assertNotNull(newAlignment.getGroups()); + for (SequenceGroup seqGrp : newAlignment.getGroups()) + { + SequenceGroup expectedGrp = copySg; + AssertJUnit.assertTrue( + "Failed SequenceGroup Test for >>> " + seqGrp.getName(), + isGroupMatched(expectedGrp, seqGrp)); + passedCount++; + } + AssertJUnit.assertEquals("Some SequenceGroups did not pass the test", + TEST_GRP_HEIGHT, passedCount); } }