X-Git-Url: http://source.jalview.org/gitweb/?a=blobdiff_plain;f=test%2Fjalview%2Fstructure%2FMapping.java;h=f1fecedd8c67474db176fc463c00143656d32374;hb=156ab6ab1046c02dc327c2ac986afa336f0bbf3b;hp=c057980b4b103a07885ef73420f22a3a1f7c2135;hpb=ab22918ab8fc67d30dad1fb1ae0f37e51f49df95;p=jalview.git diff --git a/test/jalview/structure/Mapping.java b/test/jalview/structure/Mapping.java index c057980..f1feced 100644 --- a/test/jalview/structure/Mapping.java +++ b/test/jalview/structure/Mapping.java @@ -1,3 +1,23 @@ +/* + * Jalview - A Sequence Alignment Editor and Viewer ($$Version-Rel$$) + * Copyright (C) $$Year-Rel$$ The Jalview Authors + * + * This file is part of Jalview. + * + * Jalview is free software: you can redistribute it and/or + * modify it under the terms of the GNU General Public License + * as published by the Free Software Foundation, either version 3 + * of the License, or (at your option) any later version. + * + * Jalview is distributed in the hope that it will be useful, but + * WITHOUT ANY WARRANTY; without even the implied warranty + * of MERCHANTABILITY or FITNESS FOR A PARTICULAR + * PURPOSE. See the GNU General Public License for more details. + * + * You should have received a copy of the GNU General Public License + * along with Jalview. If not, see . + * The Jalview Authors are detailed in the 'AUTHORS' file. + */ package jalview.structure; import static org.testng.AssertJUnit.assertEquals; @@ -8,18 +28,27 @@ import jalview.datamodel.Annotation; import jalview.datamodel.Sequence; import jalview.datamodel.SequenceI; import jalview.gui.AlignFrame; +import jalview.gui.JvOptionPane; +import jalview.io.DataSourceType; +import jalview.io.FileFormat; import jalview.io.FileLoader; -import jalview.io.FormatAdapter; +import jalview.io.StructureFile; import org.testng.Assert; import org.testng.AssertJUnit; +import org.testng.annotations.BeforeClass; import org.testng.annotations.Test; -import MCview.PDBfile; - public class Mapping { + @BeforeClass(alwaysRun = true) + public void setUpJvOptionPane() + { + JvOptionPane.setInteractiveMode(false); + JvOptionPane.setMockResponse(JvOptionPane.CANCEL_OPTION); + } + /* * more test data * @@ -27,8 +56,7 @@ public class Mapping * 115 in PDB Res Numbering secondary structure numbers in jmol seem to be in * msd numbering, not pdb res numbering. */ - @Test(groups = - { "Functional" }, enabled = false) + @Test(groups = { "Functional" }, enabled = false) public void pdbEntryPositionMap() throws Exception { Assert.fail("This test intentionally left to fail"); @@ -44,16 +72,15 @@ public class Mapping // original numbers taken from // http://www.ebi.ac.uk/pdbe-srv/view/entry/1qcf/secondary.html // these are in numbering relative to the subsequence above - int coils[] = - { 266, 275, 278, 287, 289, 298, 302, 316 }, helices[] = new int[] - { 303, 315 }, sheets[] = new int[] - { 267, 268, 269, 270 }; + int coils[] = { 266, 275, 278, 287, 289, 298, 302, 316 }, + helices[] = new int[] + { 303, 315 }, sheets[] = new int[] { 267, 268, 269, 270 }; StructureSelectionManager ssm = new jalview.structure.StructureSelectionManager(); - PDBfile pmap = ssm.setMapping(true, new SequenceI[] - { uprot }, new String[] - { "A" }, "test/jalview/ext/jmol/1QCF.pdb", - jalview.io.FormatAdapter.FILE); + StructureFile pmap = ssm.setMapping(true, new SequenceI[] { uprot }, + new String[] + { "A" }, "test/jalview/ext/jmol/1QCF.pdb", + DataSourceType.FILE); assertTrue(pmap != null); SequenceI protseq = pmap.getSeqsAsArray()[0]; AlignmentAnnotation pstra = protseq @@ -82,10 +109,10 @@ public class Mapping char expected = 'H'; for (int p : helices) { - Annotation a = ss.annotations[op = (uprot.findIndex(offset + p) - 1)]; - assertTrue( - "Expected a helix at position " + p + uprot.getCharAt(op) - + " but got coil", a != null); + Annotation a = ss.annotations[op = (uprot.findIndex(offset + p) + - 1)]; + assertTrue("Expected a helix at position " + p + + uprot.getCharAt(op) + " but got coil", a != null); assertEquals("Expected a helix at position " + p, a.secondaryStructure, expected); } @@ -93,8 +120,7 @@ public class Mapping for (int p : sheets) { Annotation a = ss.annotations[uprot.findIndex(offset + p) - 1]; - assertTrue( - "Expected a strand at position " + p + " but got coil", + assertTrue("Expected a strand at position " + p + " but got coil", a != null); assertEquals("Expected a strand at position " + p, a.secondaryStructure, expected); @@ -110,22 +136,20 @@ public class Mapping } } - @Test(groups = - { "Functional" }, enabled = false) + @Test(groups = { "Functional" }, enabled = false) public void testPDBentryMapping() throws Exception { Assert.fail("This test intentionally left to fail"); - Sequence sq = new Sequence( - "1GAQ A subseq 126 to 219", + Sequence sq = new Sequence("1GAQ A subseq 126 to 219", "EIVKGVCSNFLCDLQPGDNVQITGPVGKEMLMPKDPNATIIMLATGTGIAPFRSFLWKMFFEKHDDYKFNGLGWLFLGVPTSSSLLYKEEFGKM"); Sequence sq1 = new Sequence(sq); String inFile; StructureSelectionManager ssm = new jalview.structure.StructureSelectionManager(); // Associate the 1GAQ pdb file with the subsequence 'imported' from another // source - PDBfile pde = ssm.setMapping(true, new SequenceI[] - { sq }, new String[] - { "A" }, inFile = "examples/1gaq.txt", jalview.io.FormatAdapter.FILE); + StructureFile pde = ssm.setMapping(true, new SequenceI[] { sq }, + new String[] + { "A" }, inFile = "examples/1gaq.txt", DataSourceType.FILE); assertTrue("PDB File couldn't be found", pde != null); StructureMapping[] mp = ssm.getMapping(inFile); assertTrue("No mappings made.", mp != null && mp.length > 0); @@ -154,8 +178,8 @@ public class Mapping if (origMap.getSequence() == sq) { assertEquals("Mapping was incomplete.", sq.getLength() - 1, - (origMap.getPDBResNum(sq.getEnd()) - origMap - .getPDBResNum(sq.getStart()))); + (origMap.getPDBResNum(sq.getEnd()) + - origMap.getPDBResNum(sq.getStart()))); // sanity check - if this fails, mapping from first position in sequence // we want to transfer to is not where we expect assertEquals(1, origMap.getSeqPos(126)); @@ -174,8 +198,8 @@ public class Mapping { // walk along the pdb chain's jalview sequence int rseqpos; - int fpos = origMap.getSeqPos(rseqpos = firstChain - .findPosition(p)); + int fpos = origMap + .getSeqPos(rseqpos = firstChain.findPosition(p)); // only look at positions where there is a corresponding position in // mapping if (fpos < 1) @@ -193,10 +217,12 @@ public class Mapping break; } - Annotation a = transfer.annotations[tanpos], b = alan.annotations[p]; - assertEquals("Non-equivalent annotation element at " + p + "(" - + rseqpos + ")" + " expected at " + fpos + " (alIndex " - + tanpos + ")", + Annotation a = transfer.annotations[tanpos], + b = alan.annotations[p]; + assertEquals( + "Non-equivalent annotation element at " + p + "(" + + rseqpos + ")" + " expected at " + fpos + + " (alIndex " + tanpos + ")", a == null ? a : a.toString(), b == null ? b : b.toString()); System.out.print("(" + a + "|" + b + ")"); @@ -212,19 +238,17 @@ public class Mapping * transform * */ - @Test(groups ={ "Functional" }) + @Test(groups = { "Functional" }) public void mapFer1From3W5V() throws Exception { - AlignFrame seqf = new FileLoader(false) - .LoadFileWaitTillLoaded( - ">FER1_MAIZE/1-150 Ferredoxin-1, chloroplast precursor\nMATVLGSPRAPAFFFSSSSLRAAPAPTAVALPAAKVGIMGRSASSRRRLRAQATYNVKLITPEGEVELQVPD\nDVYILDQAEEDGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSYLDDGQIADGWVLTCHAYPTSDVVIETHKE\nEELTGA", - FormatAdapter.PASTE, "FASTA"); + AlignFrame seqf = new FileLoader(false).LoadFileWaitTillLoaded( + ">FER1_MAIZE/1-150 Ferredoxin-1, chloroplast precursor\nMATVLGSPRAPAFFFSSSSLRAAPAPTAVALPAAKVGIMGRSASSRRRLRAQATYNVKLITPEGEVELQVPD\nDVYILDQAEEDGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSYLDDGQIADGWVLTCHAYPTSDVVIETHKE\nEELTGA", + DataSourceType.PASTE, FileFormat.Fasta); SequenceI newseq = seqf.getViewport().getAlignment().getSequenceAt(0); StructureSelectionManager ssm = new jalview.structure.StructureSelectionManager(); - PDBfile pmap = ssm.setMapping(true, new SequenceI[] - { newseq }, new String[] - { null }, "examples/3W5V.pdb", - jalview.io.FormatAdapter.FILE); + StructureFile pmap = ssm.setMapping(true, new SequenceI[] { newseq }, + new String[] + { null }, "examples/3W5V.pdb", DataSourceType.FILE); if (pmap == null) { AssertJUnit.fail("Couldn't make a mapping for 3W5V to FER1_MAIZE"); @@ -235,12 +259,14 @@ public class Mapping * compare reference annotation for imported pdb sequence to identical * seuqence with transferred annotation from mapped pdb file */ - @Test(groups ={ "Functional" }) + @Test(groups = { "Functional" }) public void compareTransferredToRefPDBAnnot() throws Exception { - AlignFrame ref = new FileLoader(false) - .LoadFileWaitTillLoaded("test/jalview/ext/jmol/1QCF.pdb", - jalview.io.FormatAdapter.FILE); + StructureImportSettings.setProcessSecondaryStructure(true); + StructureImportSettings.setVisibleChainAnnotation(true); + StructureImportSettings.setShowSeqFeatures(true); + AlignFrame ref = new FileLoader(false).LoadFileWaitTillLoaded( + "test/jalview/ext/jmol/1QCF.pdb", DataSourceType.FILE); SequenceI refseq = ref.getViewport().getAlignment().getSequenceAt(0); SequenceI newseq = new Sequence(refseq.getName() + "Copy", refseq.getSequenceAsString()); @@ -250,10 +276,10 @@ public class Mapping StructureSelectionManager ssm = new jalview.structure.StructureSelectionManager(); ssm.setProcessSecondaryStructure(true); ssm.setAddTempFacAnnot(true); - PDBfile pmap = ssm.setMapping(true, new SequenceI[] - { newseq }, new String[] - { null }, "test/jalview/ext/jmol/1QCF.pdb", - jalview.io.FormatAdapter.FILE); + StructureFile pmap = ssm.setMapping(true, new SequenceI[] { newseq }, + new String[] + { null }, "test/jalview/ext/jmol/1QCF.pdb", + DataSourceType.FILE); assertTrue(pmap != null); assertEquals("Original and copied sequence of different lengths.", refseq.getLength(), newseq.getLength()); @@ -267,9 +293,10 @@ public class Mapping { for (int p = 0, pSize = refseq.getLength(); p < pSize; p++) { - Annotation orig = oannot.annotations[p], tran = tannot.annotations[p]; - assertTrue("Mismatch: coil and non coil site " + p, orig == tran - || orig != null && tran != null); + Annotation orig = oannot.annotations[p], + tran = tannot.annotations[p]; + assertTrue("Mismatch: coil and non coil site " + p, + orig == tran || orig != null && tran != null); if (tran != null) { assertEquals("Mismatch in secondary structure at site " + p,