X-Git-Url: http://source.jalview.org/gitweb/?a=blobdiff_plain;f=test%2Fjalview%2Fstructure%2FMapping.java;h=f8461f8a3fc1b299affda9a7edd8fe84620622b5;hb=a8e0667a62546cdd95d44a45cf14a629cfa416a6;hp=5397c48778d16a10cd8b914632a267f2a5f11b00;hpb=838e4f91d4a53dd315640dbc9ff6ef7a815ee576;p=jalview.git diff --git a/test/jalview/structure/Mapping.java b/test/jalview/structure/Mapping.java index 5397c48..f8461f8 100644 --- a/test/jalview/structure/Mapping.java +++ b/test/jalview/structure/Mapping.java @@ -1,6 +1,6 @@ /* - * Jalview - A Sequence Alignment Editor and Viewer (Version 2.9.0b1) - * Copyright (C) 2015 The Jalview Authors + * Jalview - A Sequence Alignment Editor and Viewer ($$Version-Rel$$) + * Copyright (C) $$Year-Rel$$ The Jalview Authors * * This file is part of Jalview. * @@ -23,22 +23,37 @@ package jalview.structure; import static org.testng.AssertJUnit.assertEquals; import static org.testng.AssertJUnit.assertTrue; +import jalview.bin.Cache; import jalview.datamodel.AlignmentAnnotation; import jalview.datamodel.Annotation; import jalview.datamodel.Sequence; import jalview.datamodel.SequenceI; import jalview.gui.AlignFrame; +import jalview.gui.JvOptionPane; +import jalview.io.DataSourceType; +import jalview.io.FileFormat; import jalview.io.FileLoader; -import jalview.io.FormatAdapter; +import jalview.io.StructureFile; import org.testng.Assert; import org.testng.AssertJUnit; +import org.testng.annotations.BeforeClass; import org.testng.annotations.Test; -import MCview.PDBfile; - public class Mapping { + @BeforeClass(alwaysRun = true) + public void setUp() + { + Cache.initLogger(); + } + + @BeforeClass(alwaysRun = true) + public void setUpJvOptionPane() + { + JvOptionPane.setInteractiveMode(false); + JvOptionPane.setMockResponse(JvOptionPane.CANCEL_OPTION); + } /* * more test data @@ -66,10 +81,11 @@ public class Mapping int coils[] = { 266, 275, 278, 287, 289, 298, 302, 316 }, helices[] = new int[] { 303, 315 }, sheets[] = new int[] { 267, 268, 269, 270 }; - StructureSelectionManager ssm = new jalview.structure.StructureSelectionManager(); - PDBfile pmap = ssm.setMapping(true, new SequenceI[] { uprot }, + StructureSelectionManager ssm = StructureSelectionManager + .getStructureSelectionManager(null); + StructureFile pmap = ssm.setMapping(true, new SequenceI[] { uprot }, new String[] { "A" }, "test/jalview/ext/jmol/1QCF.pdb", - jalview.io.FormatAdapter.FILE); + DataSourceType.FILE); assertTrue(pmap != null); SequenceI protseq = pmap.getSeqsAsArray()[0]; AlignmentAnnotation pstra = protseq @@ -135,11 +151,13 @@ public class Mapping "EIVKGVCSNFLCDLQPGDNVQITGPVGKEMLMPKDPNATIIMLATGTGIAPFRSFLWKMFFEKHDDYKFNGLGWLFLGVPTSSSLLYKEEFGKM"); Sequence sq1 = new Sequence(sq); String inFile; - StructureSelectionManager ssm = new jalview.structure.StructureSelectionManager(); + StructureSelectionManager ssm = StructureSelectionManager + .getStructureSelectionManager(null); // Associate the 1GAQ pdb file with the subsequence 'imported' from another // source - PDBfile pde = ssm.setMapping(true, new SequenceI[] { sq }, new String[] - { "A" }, inFile = "examples/1gaq.txt", jalview.io.FormatAdapter.FILE); + StructureFile pde = ssm.setMapping(true, new SequenceI[] { sq }, + new String[] + { "A" }, inFile = "examples/1gaq.txt", DataSourceType.FILE); assertTrue("PDB File couldn't be found", pde != null); StructureMapping[] mp = ssm.getMapping(inFile); assertTrue("No mappings made.", mp != null && mp.length > 0); @@ -229,14 +247,15 @@ public class Mapping public void mapFer1From3W5V() throws Exception { AlignFrame seqf = new FileLoader(false) - .LoadFileWaitTillLoaded( + .loadFileWaitTillLoaded( ">FER1_MAIZE/1-150 Ferredoxin-1, chloroplast precursor\nMATVLGSPRAPAFFFSSSSLRAAPAPTAVALPAAKVGIMGRSASSRRRLRAQATYNVKLITPEGEVELQVPD\nDVYILDQAEEDGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSYLDDGQIADGWVLTCHAYPTSDVVIETHKE\nEELTGA", - FormatAdapter.PASTE, "FASTA"); + DataSourceType.PASTE, FileFormat.Fasta); SequenceI newseq = seqf.getViewport().getAlignment().getSequenceAt(0); - StructureSelectionManager ssm = new jalview.structure.StructureSelectionManager(); - PDBfile pmap = ssm.setMapping(true, new SequenceI[] { newseq }, + StructureSelectionManager ssm = StructureSelectionManager + .getStructureSelectionManager(null); + StructureFile pmap = ssm.setMapping(true, new SequenceI[] { newseq }, new String[] { null }, "examples/3W5V.pdb", - jalview.io.FormatAdapter.FILE); + DataSourceType.FILE); if (pmap == null) { AssertJUnit.fail("Couldn't make a mapping for 3W5V to FER1_MAIZE"); @@ -250,21 +269,25 @@ public class Mapping @Test(groups = { "Functional" }) public void compareTransferredToRefPDBAnnot() throws Exception { + StructureImportSettings.setProcessSecondaryStructure(true); + StructureImportSettings.setVisibleChainAnnotation(true); + StructureImportSettings.setShowSeqFeatures(true); AlignFrame ref = new FileLoader(false) .LoadFileWaitTillLoaded("test/jalview/ext/jmol/1QCF.pdb", - jalview.io.FormatAdapter.FILE); + DataSourceType.FILE); SequenceI refseq = ref.getViewport().getAlignment().getSequenceAt(0); SequenceI newseq = new Sequence(refseq.getName() + "Copy", refseq.getSequenceAsString()); // make it harder by shifting the copy vs the reference newseq.setStart(refseq.getStart() + 25); newseq.setEnd(refseq.getLength() + 25 + refseq.getStart()); - StructureSelectionManager ssm = new jalview.structure.StructureSelectionManager(); + StructureSelectionManager ssm = StructureSelectionManager + .getStructureSelectionManager(null); ssm.setProcessSecondaryStructure(true); ssm.setAddTempFacAnnot(true); - PDBfile pmap = ssm.setMapping(true, new SequenceI[] { newseq }, + StructureFile pmap = ssm.setMapping(true, new SequenceI[] { newseq }, new String[] { null }, "test/jalview/ext/jmol/1QCF.pdb", - jalview.io.FormatAdapter.FILE); + DataSourceType.FILE); assertTrue(pmap != null); assertEquals("Original and copied sequence of different lengths.", refseq.getLength(), newseq.getLength());