X-Git-Url: http://source.jalview.org/gitweb/?a=blobdiff_plain;f=test%2Fjalview%2Fstructure%2FStructureSelectionManagerTest.java;h=a59fbdecee794cd24d8a6750e32a8c452bc09e13;hb=9bde0814fff97f50e3ac6165a9fb83787c37d39a;hp=e4cc3367534c1fe0373d0d1ff15730055ad6fcf7;hpb=90336678e0ea5403d2803942eb3dd7f8f4436a14;p=jalview.git diff --git a/test/jalview/structure/StructureSelectionManagerTest.java b/test/jalview/structure/StructureSelectionManagerTest.java index e4cc336..a59fbde 100644 --- a/test/jalview/structure/StructureSelectionManagerTest.java +++ b/test/jalview/structure/StructureSelectionManagerTest.java @@ -1,61 +1,108 @@ +/* + * Jalview - A Sequence Alignment Editor and Viewer ($$Version-Rel$$) + * Copyright (C) $$Year-Rel$$ The Jalview Authors + * + * This file is part of Jalview. + * + * Jalview is free software: you can redistribute it and/or + * modify it under the terms of the GNU General Public License + * as published by the Free Software Foundation, either version 3 + * of the License, or (at your option) any later version. + * + * Jalview is distributed in the hope that it will be useful, but + * WITHOUT ANY WARRANTY; without even the implied warranty + * of MERCHANTABILITY or FITNESS FOR A PARTICULAR + * PURPOSE. See the GNU General Public License for more details. + * + * You should have received a copy of the GNU General Public License + * along with Jalview. If not, see . + * The Jalview Authors are detailed in the 'AUTHORS' file. + */ package jalview.structure; import static org.testng.AssertJUnit.assertEquals; import static org.testng.AssertJUnit.assertTrue; import jalview.datamodel.AlignedCodonFrame; +import jalview.datamodel.Sequence; +import jalview.datamodel.SequenceFeature; +import jalview.datamodel.SequenceI; +import jalview.gui.JvOptionPane; +import jalview.io.DataSourceType; +import jalview.io.StructureFile; +import jalview.util.MapList; -import java.util.HashSet; -import java.util.Set; +import java.util.ArrayList; +import java.util.List; +import org.testng.annotations.BeforeClass; import org.testng.annotations.BeforeMethod; import org.testng.annotations.Test; public class StructureSelectionManagerTest { + + @BeforeClass(alwaysRun = true) + public void setUpJvOptionPane() + { + JvOptionPane.setInteractiveMode(false); + JvOptionPane.setMockResponse(JvOptionPane.CANCEL_OPTION); + } + private StructureSelectionManager ssm; - @BeforeMethod(alwaysRun = true) + @BeforeMethod(alwaysRun = true) public void setUp() { + StructureImportSettings.setShowSeqFeatures(true); ssm = new StructureSelectionManager(); } - @Test(groups ={ "Functional" }) + @Test(groups = { "Functional" }) public void testRegisterMapping() { AlignedCodonFrame acf1 = new AlignedCodonFrame(); + acf1.addMap(new Sequence("s1", "ttt"), new Sequence("p1", "p"), + new MapList(new int[] { 1, 3 }, new int[] { 1, 1 }, 1, 1)); AlignedCodonFrame acf2 = new AlignedCodonFrame(); + acf2.addMap(new Sequence("s2", "ttt"), new Sequence("p2", "p"), + new MapList(new int[] { 1, 3 }, new int[] { 1, 1 }, 1, 1)); ssm.registerMapping(acf1); - assertEquals(1, ssm.seqmappings.size()); - assertTrue(ssm.seqmappings.contains(acf1)); + assertEquals(1, ssm.getSequenceMappings().size()); + assertTrue(ssm.getSequenceMappings().contains(acf1)); ssm.registerMapping(acf2); - assertEquals(2, ssm.seqmappings.size()); - assertTrue(ssm.seqmappings.contains(acf1)); - assertTrue(ssm.seqmappings.contains(acf2)); + assertEquals(2, ssm.getSequenceMappings().size()); + assertTrue(ssm.getSequenceMappings().contains(acf1)); + assertTrue(ssm.getSequenceMappings().contains(acf2)); /* * Re-adding the first mapping does nothing */ ssm.registerMapping(acf1); - assertEquals(2, ssm.seqmappings.size()); - assertTrue(ssm.seqmappings.contains(acf1)); - assertTrue(ssm.seqmappings.contains(acf2)); + assertEquals(2, ssm.getSequenceMappings().size()); + assertTrue(ssm.getSequenceMappings().contains(acf1)); + assertTrue(ssm.getSequenceMappings().contains(acf2)); } - @Test(groups ={ "Functional" }) + @Test(groups = { "Functional" }) public void testRegisterMappings() { AlignedCodonFrame acf1 = new AlignedCodonFrame(); + acf1.addMap(new Sequence("s1", "ttt"), new Sequence("p1", "p"), + new MapList(new int[] { 1, 3 }, new int[] { 1, 1 }, 1, 1)); AlignedCodonFrame acf2 = new AlignedCodonFrame(); + acf2.addMap(new Sequence("s2", "ttt"), new Sequence("p2", "p"), + new MapList(new int[] { 1, 3 }, new int[] { 1, 1 }, 1, 1)); AlignedCodonFrame acf3 = new AlignedCodonFrame(); + acf3.addMap(new Sequence("s3", "ttt"), new Sequence("p3", "p"), + new MapList(new int[] { 1, 3 }, new int[] { 1, 1 }, 1, 1)); - Set set1 = new HashSet(); + List set1 = new ArrayList(); set1.add(acf1); set1.add(acf2); - Set set2 = new HashSet(); + List set2 = new ArrayList(); set2.add(acf2); set2.add(acf3); @@ -67,9 +114,50 @@ public class StructureSelectionManagerTest ssm.registerMappings(set2); ssm.registerMappings(set2); - assertEquals(3, ssm.seqmappings.size()); - assertTrue(ssm.seqmappings.contains(acf1)); - assertTrue(ssm.seqmappings.contains(acf2)); - assertTrue(ssm.seqmappings.contains(acf3)); + assertEquals(3, ssm.getSequenceMappings().size()); + assertTrue(ssm.getSequenceMappings().contains(acf1)); + assertTrue(ssm.getSequenceMappings().contains(acf2)); + assertTrue(ssm.getSequenceMappings().contains(acf3)); + } + + /** + * Verify that RESNUM sequence features are present after creating a PDB + * mapping + */ + @Test(groups = { "Functional" }) + public void testSetMapping_seqFeatures() + { + SequenceI seq = new Sequence( + "1GAQ|B", + "ATYNVKLITPEGEVELQVPDDVYILDQAEEDGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSYLDDGQIADGWVLTCHAYPTSDVVIETHKEEELTGA"); + StructureSelectionManager sm = new StructureSelectionManager(); + sm.setProcessSecondaryStructure(true); + sm.setAddTempFacAnnot(true); + StructureFile pmap = sm.setMapping(true, new SequenceI[] { seq }, + new String[] { null }, "examples/1gaq.txt", DataSourceType.FILE); + assertTrue(pmap != null); + + assertEquals(3, pmap.getSeqs().size()); + assertEquals("1GAQ|A", pmap.getSeqs().get(0).getName()); + assertEquals("1GAQ|B", pmap.getSeqs().get(1).getName()); + assertEquals("1GAQ|C", pmap.getSeqs().get(2).getName()); + + /* + * Verify a RESNUM sequence feature in the PDBfile sequence + */ + SequenceFeature sf = pmap.getSeqs().get(0).getSequenceFeatures().get(0); + assertEquals("RESNUM", sf.getType()); + assertEquals("1gaq", sf.getFeatureGroup()); + assertEquals("GLU: 19 1gaqA", sf.getDescription()); + + /* + * Verify a RESNUM sequence feature in the StructureSelectionManager mapped + * sequence + */ + StructureMapping map = sm.getMapping("examples/1gaq.txt")[0]; + sf = map.sequence.getSequenceFeatures().get(0); + assertEquals("RESNUM", sf.getType()); + assertEquals("1gaq", sf.getFeatureGroup()); + assertEquals("ALA: 1 1gaqB", sf.getDescription()); } }