X-Git-Url: http://source.jalview.org/gitweb/?a=blobdiff_plain;f=test%2Fjalview%2Fws%2Fdbsources%2FUniprotTest.java;h=a95d52096f02937b4cf555129c38bdac2da4b734;hb=cdc539ef6f32d74747ab857831268dd5954b28f5;hp=4b88b2bb1475313b17ab42913a8f0dfccf98df67;hpb=e838644df5d5a10a16cf0ad7fb23d24dd7d2729a;p=jalview.git diff --git a/test/jalview/ws/dbsources/UniprotTest.java b/test/jalview/ws/dbsources/UniprotTest.java index 4b88b2b..a95d520 100644 --- a/test/jalview/ws/dbsources/UniprotTest.java +++ b/test/jalview/ws/dbsources/UniprotTest.java @@ -20,53 +20,81 @@ */ package jalview.ws.dbsources; +import static org.testng.Assert.assertFalse; import static org.testng.AssertJUnit.assertEquals; -import static org.testng.AssertJUnit.assertFalse; import static org.testng.AssertJUnit.assertNotNull; import static org.testng.AssertJUnit.assertNull; +import static org.testng.AssertJUnit.assertTrue; -import jalview.datamodel.PDBEntry; -import jalview.datamodel.SequenceFeature; -import jalview.datamodel.SequenceI; -import jalview.datamodel.UniprotEntry; - -import java.io.Reader; -import java.io.StringReader; -import java.util.Vector; +import java.io.ByteArrayInputStream; +import java.io.InputStream; +import java.io.UnsupportedEncodingException; +import java.math.BigInteger; +import java.util.List; +import org.testng.Assert; +import org.testng.annotations.BeforeClass; +import org.testng.annotations.DataProvider; import org.testng.annotations.Test; +import jalview.datamodel.DBRefEntry; +import jalview.datamodel.DBRefSource; +import jalview.datamodel.SequenceFeature; +import jalview.datamodel.SequenceI; +import jalview.gui.JvOptionPane; +import jalview.util.DBRefUtils; +import jalview.xml.binding.uniprot.DbReferenceType; +import jalview.xml.binding.uniprot.Entry; +import jalview.xml.binding.uniprot.FeatureType; +import jalview.xml.binding.uniprot.LocationType; +import jalview.xml.binding.uniprot.PositionType; + public class UniprotTest { + + @BeforeClass(alwaysRun = true) + public void setUpJvOptionPane() + { + JvOptionPane.setInteractiveMode(false); + JvOptionPane.setMockResponse(JvOptionPane.CANCEL_OPTION); + } + // adapted from http://www.uniprot.org/uniprot/A9CKP4.xml private static final String UNIPROT_XML = "" - + "" + + "" + "" + "A9CKP4" - + "A9CKP5" - + "A9CKP4_AGRT5" + + "A9CKP5" + "A9CKP4_AGRT5" + "A9CKP4_AGRT6" - + "Mitogen-activated protein kinase 13Henry" + + "Mitogen-activated protein kinase 13" + "" + "" + "" + "" + "" + "" + + "ML" + + "ML" + + "M" + + "LLMVM" + + "LLLMVML" + + "LLLMVKMLML" + "MHAPL VSKDL" + ""; /** * Test the method that unmarshals XML to a Uniprot model + * + * @throws UnsupportedEncodingException */ @Test(groups = { "Functional" }) - public void testGetUniprotEntries() + public void testGetUniprotEntries() throws UnsupportedEncodingException { Uniprot u = new Uniprot(); - Reader reader = new StringReader(UNIPROT_XML); - Vector entries = u.getUniprotEntries(reader); + InputStream is = new ByteArrayInputStream(UNIPROT_XML.getBytes()); + List entries = u.getUniprotEntries(is); assertEquals(1, entries.size()); - UniprotEntry entry = entries.get(0); + Entry entry = entries.get(0); assertEquals(2, entry.getName().size()); assertEquals("A9CKP4_AGRT5", entry.getName().get(0)); assertEquals("A9CKP4_AGRT6", entry.getName().get(1)); @@ -74,108 +102,560 @@ public class UniprotTest assertEquals("A9CKP4", entry.getAccession().get(0)); assertEquals("A9CKP5", entry.getAccession().get(1)); - /* - * UniprotSequence drops any space characters - */ - assertEquals("MHAPLVSKDL", entry.getUniprotSequence().getContent()); + assertEquals("MHAPL VSKDL", entry.getSequence().getValue()); - assertEquals(2, entry.getProtein().getName().size()); assertEquals("Mitogen-activated protein kinase 13", entry.getProtein() - .getName().get(0)); - assertEquals("Henry", entry.getProtein().getName().get(1)); + .getRecommendedName().getFullName().getValue()); /* * Check sequence features */ - Vector features = entry.getFeature(); - assertEquals(3, features.size()); - SequenceFeature sf = features.get(0); + List features = entry.getFeature(); + assertEquals(9, features.size()); + FeatureType sf = features.get(0); assertEquals("signal peptide", sf.getType()); assertNull(sf.getDescription()); assertNull(sf.getStatus()); - assertEquals(1, sf.getPosition()); - assertEquals(1, sf.getBegin()); - assertEquals(18, sf.getEnd()); + assertNull(sf.getLocation().getPosition()); + assertEquals(1, sf.getLocation().getBegin().getPosition().intValue()); + assertEquals(18, sf.getLocation().getEnd().getPosition().intValue()); sf = features.get(1); assertEquals("propeptide", sf.getType()); assertEquals("Activation peptide", sf.getDescription()); - assertEquals(19, sf.getPosition()); - assertEquals(19, sf.getBegin()); - assertEquals(20, sf.getEnd()); + assertNull(sf.getLocation().getPosition()); + assertEquals(19, sf.getLocation().getBegin().getPosition().intValue()); + assertEquals(20, sf.getLocation().getEnd().getPosition().intValue()); sf = features.get(2); assertEquals("chain", sf.getType()); assertEquals("Granzyme B", sf.getDescription()); - assertEquals(21, sf.getPosition()); - assertEquals(21, sf.getBegin()); - assertEquals(247, sf.getEnd()); + assertNull(sf.getLocation().getPosition()); + assertEquals(21, sf.getLocation().getBegin().getPosition().intValue()); + assertEquals(247, sf.getLocation().getEnd().getPosition().intValue()); + + sf = features.get(3); + assertEquals("sequence variant", sf.getType()); + assertNull(sf.getDescription()); + assertEquals(41, + sf.getLocation().getPosition().getPosition().intValue()); + assertNull(sf.getLocation().getBegin()); + assertNull(sf.getLocation().getEnd()); + + sf = features.get(4); + assertEquals("sequence variant", sf.getType()); + assertEquals("Pathogenic", sf.getDescription()); + assertEquals(41, + sf.getLocation().getPosition().getPosition().intValue()); + assertNull(sf.getLocation().getBegin()); + assertNull(sf.getLocation().getEnd()); + + sf = features.get(5); + assertEquals("sequence variant", sf.getType()); + assertEquals("Pathogenic", sf.getDescription()); + assertEquals(41, + sf.getLocation().getPosition().getPosition().intValue()); + assertNull(sf.getLocation().getBegin()); + assertNull(sf.getLocation().getEnd()); + + sf = features.get(6); + assertEquals("sequence variant", sf.getType()); + assertEquals("Foo", sf.getDescription()); + assertEquals(42, + sf.getLocation().getPosition().getPosition().intValue()); + assertNull(sf.getLocation().getBegin()); + assertNull(sf.getLocation().getEnd()); + Assert.assertEquals(Uniprot.getDescription(sf), "p.Met42Leu" + + "
  " + "p.Met42LeuMetVal Foo"); + + sf = features.get(7); + assertNull(sf.getLocation().getPosition()); + assertEquals(42, sf.getLocation().getBegin().getPosition().intValue()); + assertEquals(43, sf.getLocation().getEnd().getPosition().intValue()); + Assert.assertEquals(Uniprot.getDescription(sf), "p.MetLeu42LeuLeu" + + "
  " + "p.MetLeu42LeuMetVal Foo"); + + sf = features.get(8); + assertNull(sf.getLocation().getPosition()); + assertEquals(42, sf.getLocation().getBegin().getPosition().intValue()); + assertEquals(45, sf.getLocation().getEnd().getPosition().intValue()); + Assert.assertEquals(Uniprot.getDescription(sf), "p.MLML42LeuLeu" + + "
  " + "p.MLML42LMVK Foo Too"); /* * Check cross-references */ - Vector xrefs = entry.getDbReference(); + List xrefs = entry.getDbReference(); assertEquals(3, xrefs.size()); - PDBEntry xref = xrefs.get(0); + DbReferenceType xref = xrefs.get(0); assertEquals("2FSQ", xref.getId()); assertEquals("PDB", xref.getType()); - assertEquals("X-ray", xref.getProperty("method")); - assertEquals("1.40", xref.getProperty("resolution")); + assertEquals("X-ray", + Uniprot.getProperty(xref.getProperty(), "method")); + assertEquals("1.40", + Uniprot.getProperty(xref.getProperty(), "resolution")); xref = xrefs.get(1); assertEquals("2FSR", xref.getId()); assertEquals("PDBsum", xref.getType()); - assertFalse(xref.getProperties().hasMoreElements()); + assertTrue(xref.getProperty().isEmpty()); xref = xrefs.get(2); assertEquals("AE007869", xref.getId()); assertEquals("EMBL", xref.getType()); assertEquals("AAK85932.1", - xref.getProperty("protein sequence ID")); + Uniprot.getProperty(xref.getProperty(), "protein sequence ID")); assertEquals("Genomic_DNA", - xref.getProperty("molecule type")); + Uniprot.getProperty(xref.getProperty(), "molecule type")); } @Test(groups = { "Functional" }) - public void testGetUniprotSequence() + public void testGetUniprotSequence() throws UnsupportedEncodingException { - UniprotEntry entry = new Uniprot().getUniprotEntries( - new StringReader(UNIPROT_XML)).get(0); - SequenceI seq = new Uniprot().uniprotEntryToSequenceI(entry); + InputStream is = new ByteArrayInputStream(UNIPROT_XML.getBytes()); + Entry entry = new Uniprot().getUniprotEntries(is).get(0); + SequenceI seq = new Uniprot().uniprotEntryToSequence(entry); assertNotNull(seq); - assertEquals(6, seq.getDBRefs().length); // 2*Uniprot, PDB, PDBsum, 2*EMBL + assertEquals(6, seq.getDBRefs().size()); // 2*Uniprot, PDB, PDBsum, 2*EMBL + assertEquals(seq.getSequenceAsString(), + seq.createDatasetSequence().getSequenceAsString()); + assertEquals(2, seq.getPrimaryDBRefs().size()); + List res = DBRefUtils.searchRefs(seq.getPrimaryDBRefs(), + "A9CKP4"); + assertEquals(1, res.size()); + assertTrue(res.get(0).isCanonical()); + res = DBRefUtils.searchRefsForSource(seq.getDBRefs(), + DBRefSource.UNIPROT); + assertEquals(2, res.size()); + /* + * NB this test fragile - relies on ordering being preserved + */ + assertTrue(res.get(0).isCanonical()); + assertFalse(res.get(1).isCanonical()); + + // check version is preserved for EMBLCDS + res = DBRefUtils.searchRefs(seq.getDBRefs(), "AAK85932"); + assertEquals(1, res.size()); + // Ideally we would expect AAK85932.1 -> AAK85932 + // assertTrue("1".equals(res.get(0).getVersion())); + // but it also passes through DBrefUtils.ensurePrimaries which adds + // (promoted) to the version string + // FIXME: Jim needs to specify what (promoted) means !! - or perhaps we just + // ignore it ! + assertEquals("1 (promoted)", (res.get(0).getVersion())); + + List features = seq.getFeatures().findFeatures(41, 41, + "sequence variant"); + // verify single position features are parsed correctly JAL-4347 + assertNotNull(features); + assertEquals(3, features.size()); } + /** * Test the method that formats the sequence id + * + * @throws UnsupportedEncodingException */ @Test(groups = { "Functional" }) - public void testGetUniprotEntryId() + public void testGetUniprotEntryId() throws UnsupportedEncodingException { - UniprotEntry entry = new Uniprot().getUniprotEntries( - new StringReader(UNIPROT_XML)).get(0); + InputStream is = new ByteArrayInputStream(UNIPROT_XML.getBytes()); + Entry entry = new Uniprot().getUniprotEntries(is).get(0); /* - * name formatted as source | accession ids | names - * source database converted to Jalview canonical name + * name formatted with Uniprot Entry name */ - String expectedName = "UNIPROT|A9CKP4|A9CKP5|A9CKP4_AGRT5|A9CKP4_AGRT6"; + String expectedName = "A9CKP4_AGRT5|A9CKP4_AGRT6"; assertEquals(expectedName, Uniprot.getUniprotEntryId(entry)); } /** * Test the method that formats the sequence description + * + * @throws UnsupportedEncodingException */ @Test(groups = { "Functional" }) public void testGetUniprotEntryDescription() + throws UnsupportedEncodingException { - UniprotEntry entry = new Uniprot().getUniprotEntries( - new StringReader(UNIPROT_XML)).get(0); - + InputStream is = new ByteArrayInputStream(UNIPROT_XML.getBytes()); + Entry entry = new Uniprot().getUniprotEntries(is).get(0); + + assertEquals("Mitogen-activated protein kinase 13", + Uniprot.getUniprotEntryDescription(entry)); + } + + @Test(groups = { "Functional" }) + public void testGetDescription() + { + FeatureType ft = new FeatureType(); + assertEquals("", Uniprot.getDescription(ft)); + + ft.setDescription("Hello"); + assertEquals("Hello", Uniprot.getDescription(ft)); + + ft.setLocation(new LocationType()); + ft.getLocation().setPosition(new PositionType()); + ft.getLocation().getPosition().setPosition(BigInteger.valueOf(23)); + ft.setOriginal("K"); + ft.getVariation().add("y"); + assertEquals("p.Lys23Tyr Hello", Uniprot.getDescription(ft)); + + // multiple variants generate an html description over more than one line + ft.getVariation().add("W"); + assertEquals("p.Lys23Tyr
  p.Lys23Trp Hello", + Uniprot.getDescription(ft)); + /* - * recommended names concatenated with space separator + * indel cases + * up to 3 bases (original or variant) are shown using 3 letter code */ - String expectedDescription = "Mitogen-activated protein kinase 13 Henry"; - assertEquals(expectedDescription, - Uniprot.getUniprotEntryDescription(entry)); + ft.getVariation().clear(); + ft.getVariation().add("KWE"); + ft.setOriginal("KLS"); + assertEquals("p.LysLeuSer23LysTrpGlu Hello", + Uniprot.getDescription(ft)); + + // adding a fourth original base switches to single letter code + ft.setOriginal("KLST"); + assertEquals("p.KLST23LysTrpGlu Hello", Uniprot.getDescription(ft)); + + // adding a fourth variant switches to single letter code + ft.getVariation().clear(); + ft.getVariation().add("KWES"); + assertEquals("p.KLST23KWES Hello", Uniprot.getDescription(ft)); + + ft.getVariation().clear(); + ft.getVariation().add("z"); // unknown variant - fails gracefully + ft.setOriginal("K"); + assertEquals("p.Lys23z Hello", Uniprot.getDescription(ft)); + + ft.getVariation().clear(); // variant missing - is ignored + assertEquals("Hello", Uniprot.getDescription(ft)); + } + + public static String Q29079 = Q29079 = new String( + "\n" + + "\n" + + "Q29079\n" + + "Q29017\n" + + "PAG2_PIG\n" + "\n" + + "\n" + + "Pregnancy-associated glycoprotein 2\n" + + "PAG 2\n" + + "3.4.23.-\n" + + "\n" + "\n" + "\n" + + "PAG2\n" + "\n" + + "\n" + + "Sus scrofa\n" + + "Pig\n" + + "\n" + + "\n" + "Eukaryota\n" + + "Metazoa\n" + "Chordata\n" + + "Craniata\n" + + "Vertebrata\n" + + "Euteleostomi\n" + + "Mammalia\n" + + "Eutheria\n" + + "Laurasiatheria\n" + + "Artiodactyla\n" + + "Suina\n" + "Suidae\n" + + "Sus\n" + "\n" + + "\n" + "\n" + + "\n" + + "Porcine pregnancy-associated glycoproteins: new members of the aspartic proteinase gene family expressed in trophectoderm.\n" + + "\n" + "\n" + + "\n" + + "\n" + + "\n" + "\n" + + "\n" + + "\n" + + "\n" + + "NUCLEOTIDE SEQUENCE [GENOMIC DNA]\n" + + "\n" + "\n" + + "\n" + + "Gene for porcine pregnancy-associated glycoprotein 2 (poPAG2): its structural organization and analysis of its promoter.\n" + + "\n" + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + "\n" + + "\n" + + "\n" + + "\n" + + "NUCLEOTIDE SEQUENCE [GENOMIC DNA]\n" + + "\n" + "Placenta\n" + + "\n" + "\n" + + "\n" + + "\n" + + "Secreted\n" + + "Extracellular space\n" + + "\n" + "\n" + + "\n" + + "Expressed throughout the chorion, with the signal localized exclusively over the trophectoderm.\n" + + "\n" + + "\n" + + "Expression was detected at day 15, coinciding with the beginning of implantation, and continued throughout gestation.\n" + + "\n" + "\n" + + "Belongs to the peptidase A1 family.\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "Aspartyl protease\n" + + "Disulfide bond\n" + + "Glycoprotein\n" + + "Hydrolase\n" + + "Protease\n" + + "Reference proteome\n" + + "Secreted\n" + + "Signal\n" + + "Zymogen\n" + + "\n" + + "\n" + "\n" + + "\n" + "\n" + + "\n" + + "\n" + + "\n" + "\n" + + "\n" + "\n" + + "\n" + + "\n" + + "\n" + "\n" + + "\n" + "\n" + + "\n" + + "\n" + + "\n" + "\n" + + "\n" + "\n" + + "\n" + + "\n" + + "\n" + "\n" + + "\n" + "\n" + + "\n" + + "\n" + "\n" + + "\n" + "\n" + + "\n" + + "\n" + "\n" + + "\n" + "\n" + + "\n" + + "\n" + "\n" + + "\n" + "\n" + + "\n" + + "\n" + "\n" + + "\n" + "\n" + + "\n" + + "\n" + + "\n" + "\n" + + "\n" + "\n" + + "\n" + + "\n" + + "\n" + "\n" + + "\n" + "\n" + + "\n" + + "\n" + + "\n" + "\n" + + "\n" + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + "\n" + + "\n" + + "\n" + + "\n" + + "\n" + "\n" + + "\n" + + "MKWLVILGLVALSDCLVMIPLTKVKSVRESLREKGLLKNFLKEHPYNMIQNLLSKNSSHVQKFSYQPLRNYLDMVYVGNISIGTPPQQFSVVFDTGSSDLWVPSIYCKSKACVTHRSFNPSHSSTFHDRGKSIKLEYGSGKMSGFLGQDTVRIGQLTSTGQAFGLSKEETGKAFEHAIFDGILGLAYPSIAIKGTTTVIDNLKKQDQISEPVFAFYLSSDKEEGSVVMFGGVDKKYYKGDLKWVPLTQTSYWQIALDRITCRGRVIGCPRGCQAIVDTGTSMLHGPSKAVAKIHSLIKHFEKEYVVPCNARKALPDIVFTINNVDYPVPAQAYIRKYVVPCNARKALPDIVFTINNVDYPVPAQAYIRKNANNNRCYSTFEDIMDTLNQREIWILGDVFLRLYFTVYDEGQNRIGLAQAT\n" + + "\n" + + " Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms Distributed under the Creative Commons Attribution (CC BY 4.0) License \n" + + ""); + + @DataProvider + public Object[][] problemEntries() + { + return new Object[][] { new Object[] { Q29079 } }; + } + + @Test(groups = "Functional", dataProvider = "problemEntries") + public SequenceI testimportOfProblemEntries(String entry) + { + Uniprot u = new Uniprot(); + InputStream is = new ByteArrayInputStream(entry.getBytes()); + List entries = u.getUniprotEntries(is); + assertEquals(1, entries.size()); + SequenceI sq = u.uniprotEntryToSequence(entries.get(0)); + assertNotNull(sq); + return sq; + } + + @Test(groups = "Functional") + public void checkIndefiniteSequenceFeatures() + { + SequenceI upseq = testimportOfProblemEntries(Q29079); + List sf = upseq.getFeatures() + .getPositionalFeatures("chain"); + assertNotNull(sf); + assertTrue(sf.size() == 1); + SequenceFeature chainFeaure = sf.get(0); + assertTrue(chainFeaure.getBegin() == 1); + assertTrue(chainFeaure.getEnd() == upseq.getEnd()); + assertNotNull(chainFeaure.getValueAsString("start_status")); + assertNull(chainFeaure.getValueAsString("end_status")); + assertTrue( + "unknown".equals(chainFeaure.getValueAsString("start_status"))); } }