X-Git-Url: http://source.jalview.org/gitweb/?a=blobdiff_plain;f=test%2Fjalview%2Fws%2Fseqfetcher%2FDbRefFetcherTest.java;h=8b223d1efb5432486347e79299cc3a663bd78189;hb=57738a1f3c19b1c3a00bd3ac5108f8cd0af32f99;hp=914520f8a87634ebb0cde4dd7c42fc06836f87e7;hpb=c49fa6aa001663914b33fc53a1d002bfc6a291ba;p=jalview.git diff --git a/test/jalview/ws/seqfetcher/DbRefFetcherTest.java b/test/jalview/ws/seqfetcher/DbRefFetcherTest.java index 914520f..8b223d1 100644 --- a/test/jalview/ws/seqfetcher/DbRefFetcherTest.java +++ b/test/jalview/ws/seqfetcher/DbRefFetcherTest.java @@ -68,7 +68,7 @@ public class DbRefFetcherTest @BeforeClass(alwaysRun = true) public static void setUpBeforeClass() throws Exception { - jalview.bin.Cache.initLogger(); + jalview.bin.Console.initLogger(); } /** @@ -79,26 +79,28 @@ public class DbRefFetcherTest { } - @Test(groups= {"Network"}) + @Test(groups = { "Network" }) public void checkUniprotCanonicalFlagSet() { - // TODO - mock this - for moment it is a live request. + // TODO - mock this - for moment it is a live request. SequenceI uniprotSeq = new Sequence("FER1_SPIOL", "MAATTTTMMGMATTFVPKPQAPPMMAALPSNTGRSLFGLKTGSRGGRMTMAAYKVTLVTPTGNVEFQCPDDV" - + "YILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKEEE" - + "LTA"); + + "YILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKEEE" + + "LTA"); DBRefFetcher dbr = new DBRefFetcher(new SequenceI[] { uniprotSeq }); dbr.fetchDBRefs(true); List primRefs = uniprotSeq.getPrimaryDBRefs(); assertNotNull(primRefs); - assertTrue(primRefs.size()>0); - boolean canonicalUp=false; - for (DBRefEntry ref:primRefs) { + assertTrue(primRefs.size() > 0); + boolean canonicalUp = false; + for (DBRefEntry ref : primRefs) + { assertEquals(DBRefSource.UNIPROT, ref.getCanonicalSourceName()); canonicalUp |= ref.isCanonical(); } assertTrue("No Canonical Uniprot reference detected", canonicalUp); } + /** * Tests that standard protein database sources include Uniprot (as the first) * and also PDB. (Additional sources are dependent on availability of DAS @@ -157,8 +159,8 @@ public class DbRefFetcherTest public void testEmblUniprotProductRecovery() throws Exception { String retrievalId = "V00488"; - DbSourceProxy embl = new SequenceFetcher().getSourceProxy( - DBRefSource.EMBL).get(0); + DbSourceProxy embl = new SequenceFetcher() + .getSourceProxy(DBRefSource.EMBL).get(0); assertNotNull("Couldn't find the EMBL retrieval client", embl); verifyProteinNucleotideXref(retrievalId, embl); } @@ -173,8 +175,8 @@ public class DbRefFetcherTest public void testEmblCDSUniprotProductRecovery() throws Exception { String retrievalId = "AAH29712"; - DbSourceProxy embl = new SequenceFetcher().getSourceProxy( - DBRefSource.EMBLCDS).get(0); + DbSourceProxy embl = new SequenceFetcher() + .getSourceProxy(DBRefSource.EMBLCDS).get(0); assertNotNull("Couldn't find the EMBL retrieval client", embl); verifyProteinNucleotideXref(retrievalId, embl); } @@ -194,23 +196,22 @@ public class DbRefFetcherTest assertEquals("Didn't retrieve right number of records", 1, alsq.getHeight()); SequenceI seq = alsq.getSequenceAt(0); - assertEquals("Wrong sequence name", embl.getDbSource() + "|" - + retrievalId, seq.getName()); + assertEquals("Wrong sequence name", + embl.getDbSource() + "|" + retrievalId, seq.getName()); List sfs = seq.getSequenceFeatures(); assertFalse("Sequence features missing", sfs.isEmpty()); - assertTrue( - "Feature not CDS", - FeatureProperties.isCodingFeature(embl.getDbSource(), - sfs.get(0).getType())); + assertTrue("Feature not CDS", FeatureProperties + .isCodingFeature(embl.getDbSource(), sfs.get(0).getType())); assertEquals(embl.getDbSource(), sfs.get(0).getFeatureGroup()); List dr = DBRefUtils.selectRefs(seq.getDBRefs(), - new String[] { DBRefSource.UNIPROT }); + new String[] + { DBRefSource.UNIPROT }); assertNotNull(dr); assertEquals("Expected a single Uniprot cross reference", 1, dr.size()); - assertEquals("Expected cross reference map to be one amino acid", dr.get(0) - .getMap().getMappedWidth(), 1); - assertEquals("Expected local reference map to be 3 nucleotides", dr.get(0) - .getMap().getWidth(), 3); + assertEquals("Expected cross reference map to be one amino acid", + dr.get(0).getMap().getMappedWidth(), 1); + assertEquals("Expected local reference map to be 3 nucleotides", + dr.get(0).getMap().getWidth(), 3); AlignmentI sprods = new CrossRef(alsq.getSequencesArray(), alsq) .findXrefSequences(dr.get(0).getSource(), true); assertNotNull( @@ -219,8 +220,8 @@ public class DbRefFetcherTest assertEquals("Didn't xref right number of records", 1, sprods.getHeight()); SequenceI proteinSeq = sprods.getSequenceAt(0); - assertEquals(proteinSeq.getSequenceAsString(), dr.get(0).getMap().getTo() - .getSequenceAsString()); + assertEquals(proteinSeq.getSequenceAsString(), + dr.get(0).getMap().getTo().getSequenceAsString()); assertEquals(dr.get(0).getSource() + "|" + dr.get(0).getAccessionId(), proteinSeq.getName()); }