X-Git-Url: http://source.jalview.org/gitweb/?a=blobdiff_plain;f=test%2Fjalview%2Fws%2Fseqfetcher%2FDbRefFetcherTest.java;h=d2b5aecdc3b395e4bd485ae09b0dc4612cf291b1;hb=51ff7ec3b6914f3c69b35e91e69d10c88aaf5270;hp=851ab2d0afd497d69dff6a3ebaaa600d4863d464;hpb=8286731258d314669ee6facb627947fe159ac1eb;p=jalview.git diff --git a/test/jalview/ws/seqfetcher/DbRefFetcherTest.java b/test/jalview/ws/seqfetcher/DbRefFetcherTest.java index 851ab2d..d2b5aec 100644 --- a/test/jalview/ws/seqfetcher/DbRefFetcherTest.java +++ b/test/jalview/ws/seqfetcher/DbRefFetcherTest.java @@ -20,12 +20,20 @@ */ package jalview.ws.seqfetcher; -import static org.testng.Assert.assertNotEquals; import static org.testng.AssertJUnit.assertEquals; import static org.testng.AssertJUnit.assertFalse; import static org.testng.AssertJUnit.assertNotNull; import static org.testng.AssertJUnit.assertTrue; +import java.util.ArrayList; +import java.util.Arrays; +import java.util.List; + +import org.junit.Assert; +import org.testng.annotations.AfterClass; +import org.testng.annotations.BeforeClass; +import org.testng.annotations.Test; + import jalview.analysis.CrossRef; import jalview.datamodel.AlignmentAnnotation; import jalview.datamodel.AlignmentI; @@ -43,15 +51,6 @@ import jalview.ws.dbsources.EBIAlfaFold; import jalview.ws.dbsources.Pdb; import jalview.ws.dbsources.Uniprot; -import java.util.ArrayList; -import java.util.Arrays; -import java.util.List; - -import org.junit.Assert; -import org.testng.annotations.AfterClass; -import org.testng.annotations.BeforeClass; -import org.testng.annotations.Test; - /** * @author jimp * @@ -83,26 +82,28 @@ public class DbRefFetcherTest { } - @Test(groups= {"Network"}) + @Test(groups = { "Network" }) public void checkUniprotCanonicalFlagSet() { - // TODO - mock this - for moment it is a live request. + // TODO - mock this - for moment it is a live request. SequenceI uniprotSeq = new Sequence("FER1_SPIOL", "MAATTTTMMGMATTFVPKPQAPPMMAALPSNTGRSLFGLKTGSRGGRMTMAAYKVTLVTPTGNVEFQCPDDV" - + "YILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKEEE" - + "LTA"); + + "YILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKEEE" + + "LTA"); DBRefFetcher dbr = new DBRefFetcher(new SequenceI[] { uniprotSeq }); dbr.fetchDBRefs(true); List primRefs = uniprotSeq.getPrimaryDBRefs(); assertNotNull(primRefs); - assertTrue(primRefs.size()>0); - boolean canonicalUp=false; - for (DBRefEntry ref:primRefs) { + assertTrue(primRefs.size() > 0); + boolean canonicalUp = false; + for (DBRefEntry ref : primRefs) + { assertEquals(DBRefSource.UNIPROT, ref.getCanonicalSourceName()); canonicalUp |= ref.isCanonical(); } assertTrue("No Canonical Uniprot reference detected", canonicalUp); } + /** * Tests that standard protein database sources include Uniprot (as the first) * and also PDB. (Additional sources are dependent on availability of DAS @@ -161,8 +162,8 @@ public class DbRefFetcherTest public void testEmblUniprotProductRecovery() throws Exception { String retrievalId = "V00488"; - DbSourceProxy embl = new SequenceFetcher().getSourceProxy( - DBRefSource.EMBL).get(0); + DbSourceProxy embl = new SequenceFetcher() + .getSourceProxy(DBRefSource.EMBL).get(0); assertNotNull("Couldn't find the EMBL retrieval client", embl); verifyProteinNucleotideXref(retrievalId, embl); } @@ -177,8 +178,8 @@ public class DbRefFetcherTest public void testEmblCDSUniprotProductRecovery() throws Exception { String retrievalId = "AAH29712"; - DbSourceProxy embl = new SequenceFetcher().getSourceProxy( - DBRefSource.EMBLCDS).get(0); + DbSourceProxy embl = new SequenceFetcher() + .getSourceProxy(DBRefSource.EMBLCDS).get(0); assertNotNull("Couldn't find the EMBL retrieval client", embl); verifyProteinNucleotideXref(retrievalId, embl); } @@ -198,23 +199,22 @@ public class DbRefFetcherTest assertEquals("Didn't retrieve right number of records", 1, alsq.getHeight()); SequenceI seq = alsq.getSequenceAt(0); - assertEquals("Wrong sequence name", embl.getDbSource() + "|" - + retrievalId, seq.getName()); + assertEquals("Wrong sequence name", + embl.getDbSource() + "|" + retrievalId, seq.getName()); List sfs = seq.getSequenceFeatures(); assertFalse("Sequence features missing", sfs.isEmpty()); - assertTrue( - "Feature not CDS", - FeatureProperties.isCodingFeature(embl.getDbSource(), - sfs.get(0).getType())); + assertTrue("Feature not CDS", FeatureProperties + .isCodingFeature(embl.getDbSource(), sfs.get(0).getType())); assertEquals(embl.getDbSource(), sfs.get(0).getFeatureGroup()); List dr = DBRefUtils.selectRefs(seq.getDBRefs(), - new String[] { DBRefSource.UNIPROT }); + new String[] + { DBRefSource.UNIPROT }); assertNotNull(dr); assertEquals("Expected a single Uniprot cross reference", 1, dr.size()); - assertEquals("Expected cross reference map to be one amino acid", dr.get(0) - .getMap().getMappedWidth(), 1); - assertEquals("Expected local reference map to be 3 nucleotides", dr.get(0) - .getMap().getWidth(), 3); + assertEquals("Expected cross reference map to be one amino acid", + dr.get(0).getMap().getMappedWidth(), 1); + assertEquals("Expected local reference map to be 3 nucleotides", + dr.get(0).getMap().getWidth(), 3); AlignmentI sprods = new CrossRef(alsq.getSequencesArray(), alsq) .findXrefSequences(dr.get(0).getSource(), true); assertNotNull( @@ -223,8 +223,8 @@ public class DbRefFetcherTest assertEquals("Didn't xref right number of records", 1, sprods.getHeight()); SequenceI proteinSeq = sprods.getSequenceAt(0); - assertEquals(proteinSeq.getSequenceAsString(), dr.get(0).getMap().getTo() - .getSequenceAsString()); + assertEquals(proteinSeq.getSequenceAsString(), + dr.get(0).getMap().getTo().getSequenceAsString()); assertEquals(dr.get(0).getSource() + "|" + dr.get(0).getAccessionId(), proteinSeq.getName()); } @@ -239,18 +239,21 @@ public class DbRefFetcherTest public void testAlphaFoldClien() throws Exception { DbSourceProxy alphafold = new EBIAlfaFold(); - AlignmentI resp = alphafold.getSequenceRecords(alphafold.getTestQuery()); + AlignmentI resp = alphafold + .getSequenceRecords(alphafold.getTestQuery()); assertNotNull(resp); - assertEquals("One sequence only",resp.getHeight(), 1); - for (AlignmentAnnotation aa:resp.getAlignmentAnnotation()) { + assertEquals("One sequence only", resp.getHeight(), 1); + for (AlignmentAnnotation aa : resp.getAlignmentAnnotation()) + { if (aa.graph == AlignmentAnnotation.CUSTOMRENDERER) { - assertTrue("Contact map didn't provide valid contact",resp.getContactListFor(aa, 1).getContactAt(1)!=-1d); + assertTrue("Contact map didn't provide valid contact", + resp.getContactListFor(aa, 1).getContactAt(1) != -1d); // test passes return; } } - Assert.fail(); + Assert.fail("No pAE matrix found for alphafold structure."); } }