From: Jim Procter Date: Mon, 6 Sep 2021 09:52:49 +0000 (+0100) Subject: JAL-3829 pull out structure chooser query source tests to new class X-Git-Tag: Release_2_11_2_0~39^2~19 X-Git-Url: http://source.jalview.org/gitweb/?a=commitdiff_plain;h=1782673a61778d3aec570fbfc291ab21f99af7a3;p=jalview.git JAL-3829 pull out structure chooser query source tests to new class --- diff --git a/test/jalview/gui/StructureChooserTest.java b/test/jalview/gui/StructureChooserTest.java index 309b5ad..685e1bc 100644 --- a/test/jalview/gui/StructureChooserTest.java +++ b/test/jalview/gui/StructureChooserTest.java @@ -30,6 +30,8 @@ import jalview.datamodel.PDBEntry; import jalview.datamodel.Sequence; import jalview.datamodel.SequenceI; import jalview.fts.api.FTSData; +import jalview.fts.core.FTSRestRequest; +import jalview.fts.service.pdb.PDBFTSRestClient; import jalview.fts.service.threedbeacons.TDBeaconsFTSRestClient; import jalview.fts.threedbeacons.TDBeaconsFTSRestClientTest; import jalview.gui.structurechooser.PDBStructureChooserQuerySource; @@ -41,6 +43,7 @@ import jalview.ws.params.InvalidArgumentException; import java.util.Collection; import java.util.Vector; +import org.junit.Assert; import org.testng.annotations.AfterMethod; import org.testng.annotations.BeforeClass; import org.testng.annotations.BeforeMethod; @@ -123,108 +126,6 @@ public class StructureChooserTest upSeq=null; } - @SuppressWarnings("deprecation") - @Test(groups = { "Functional" }) - public void buildQueryTest() - { - System.out.println("seq >>>> " + seq); - - StructureChooserQuerySource scquery = StructureChooserQuerySource.getQuerySourceFor(new SequenceI[] { seq}); - assertTrue(scquery instanceof PDBStructureChooserQuerySource); - String query = scquery.buildQuery(seq); - assertEquals("pdb_id:1tim", query); - seq.getAllPDBEntries().clear(); - query = scquery.buildQuery(seq); - assertEquals( - "text:XYZ_1 OR text:XYZ_2 OR text:XYZ_3 OR text:XYZ_4 OR text:4kqy", - query); - seq.setDBRefs(null); - query = scquery.buildQuery(seq); - System.out.println(query); - assertEquals("text:4kqy", query); - - DBRefEntry uniprotDBRef = new DBRefEntry(); - uniprotDBRef.setAccessionId("P12345"); - uniprotDBRef.setSource(DBRefSource.UNIPROT); - seq.addDBRef(uniprotDBRef); - - DBRefEntry pdbDBRef = new DBRefEntry(); - pdbDBRef.setAccessionId("1XYZ"); - pdbDBRef.setSource(DBRefSource.PDB); - seq.addDBRef(pdbDBRef); - - for (int x = 1; x < 5; x++) - { - DBRefEntry dbRef = new DBRefEntry(); - dbRef.setAccessionId("XYZ_" + x); - seq.addDBRef(dbRef); - } - System.out.println(""); - System.out.println(seq.getDBRefs()); - System.out.println(query); - query = scquery.buildQuery(seq); - assertEquals( - "uniprot_accession:P12345 OR uniprot_id:P12345 OR pdb_id:1xyz", - query); - } - - @SuppressWarnings("deprecation") - @Test(groups = { "Functional" }) - public void buildThreeDBQueryTest() - { - System.out.println("seq >>>> " + upSeq); - TDBeaconsFTSRestClientTest.setMock(); - StructureChooserQuerySource scquery = StructureChooserQuerySource.getQuerySourceFor(new SequenceI[] { upSeq}); - assertTrue(scquery instanceof ThreeDBStructureChooserQuerySource); - String query = scquery.buildQuery(upSeq); - assertEquals("P38398", query); - - // query shouldn't change regardless of additional entries - // because 3DBeacons requires canonical entries. - upSeq.getAllPDBEntries().clear(); - query = scquery.buildQuery(upSeq); - assertEquals("P38398", query); - upSeq.setDBRefs(null); - query = scquery.buildQuery(upSeq); - /* - * legacy projects/datasets will not have canonical flags set for uniprot dbrefs - * graceful behaviour would be to - * - pick one ? not possible - * - iterate through all until a 200 is obtained ? - * ---> ideal but could be costly - * ---> better to do a direct retrieval from uniprot to work out which is the canonical identifier.. - * ----> need a test to check that accessions can be promoted to canonical! - */ - assertEquals(null, query); - - // TODO: -// -// DBRefEntry uniprotDBRef = new DBRefEntry(); -// uniprotDBRef.setAccessionId("P12345"); -// uniprotDBRef.setSource(DBRefSource.UNIPROT); -// upSeq.addDBRef(uniprotDBRef); -// -// DBRefEntry pdbDBRef = new DBRefEntry(); -// pdbDBRef.setAccessionId("1XYZ"); -// pdbDBRef.setSource(DBRefSource.PDB); -// upSeq.addDBRef(pdbDBRef); -// -// for (int x = 1; x < 5; x++) -// { -// DBRefEntry dbRef = new DBRefEntry(); -// dbRef.setAccessionId("XYZ_" + x); -// seq.addDBRef(dbRef); -// } -// System.out.println(""); -// System.out.println(seq.getDBRefs()); -// System.out.println(query); -// query = scquery.buildQuery(seq); -// assertEquals( -// "uniprot_accession:P12345 OR uniprot_id:P12345 OR pdb_id:1xyz", -// query); - } - - @Test(groups = { "Functional" }) public void populateFilterComboBoxTest() throws InterruptedException { @@ -257,7 +158,22 @@ public class StructureChooserTest "discoveredStructuresSet"); assertNotNull(ss); assertTrue(ss.size() > 0); + } + @Test(groups = { "Functional" }) + public void fetchStructuresInfoMockedTest() + { + Assert.fail("Not yet implemented"); + TDBeaconsFTSRestClientTest.setMock(); + + // PDBFTSRestClient.setMock(); + SequenceI[] selectedSeqs = new SequenceI[] { upSeq }; + StructureChooser sc = new StructureChooser(selectedSeqs, seq, null); + sc.fetchStructuresMetaData(); + Collection ss = (Collection) PA.getValue(sc, + "discoveredStructuresSet"); + assertNotNull(ss); + assertTrue(ss.size() > 0); } @Test(groups = { "Functional" }) diff --git a/test/jalview/gui/structurechooser/StructureChooserQuerySourceTest.java b/test/jalview/gui/structurechooser/StructureChooserQuerySourceTest.java new file mode 100644 index 0000000..b6b4615 --- /dev/null +++ b/test/jalview/gui/structurechooser/StructureChooserQuerySourceTest.java @@ -0,0 +1,280 @@ +/* + * Jalview - A Sequence Alignment Editor and Viewer ($$Version-Rel$$) + * Copyright (C) $$Year-Rel$$ The Jalview Authors + * + * This file is part of Jalview. + * + * Jalview is free software: you can redistribute it and/or + * modify it under the terms of the GNU General Public License + * as published by the Free Software Foundation, either version 3 + * of the License, or (at your option) any later version. + * + * Jalview is distributed in the hope that it will be useful, but + * WITHOUT ANY WARRANTY; without even the implied warranty + * of MERCHANTABILITY or FITNESS FOR A PARTICULAR + * PURPOSE. See the GNU General Public License for more details. + * + * You should have received a copy of the GNU General Public License + * along with Jalview. If not, see . + * The Jalview Authors are detailed in the 'AUTHORS' file. + */ +package jalview.gui.structurechooser; + + +import java.util.Vector; + +import org.testng.AssertJUnit; +import org.testng.annotations.AfterMethod; +import org.testng.annotations.BeforeClass; +import org.testng.annotations.BeforeMethod; +import org.testng.annotations.Test; + +import jalview.datamodel.DBRefEntry; +import jalview.datamodel.DBRefSource; +import jalview.datamodel.PDBEntry; +import jalview.datamodel.Sequence; +import jalview.datamodel.SequenceI; +import jalview.fts.core.FTSRestRequest; +import jalview.fts.threedbeacons.TDBeaconsFTSRestClientTest; +import jalview.gui.JvOptionPane; + +public class StructureChooserQuerySourceTest +{ + + @BeforeClass(alwaysRun = true) + public void setUpJvOptionPane() + { + JvOptionPane.setInteractiveMode(false); + JvOptionPane.setMockResponse(JvOptionPane.CANCEL_OPTION); + } + + Sequence seq,upSeq; + + // same set up as for structurechooser test + +@BeforeMethod(alwaysRun = true) + public void setUp() throws Exception + { + seq = new Sequence("PDB|4kqy|4KQY|A", "ABCDEFGHIJKLMNOPQRSTUVWXYZ", 1, + 26); + seq.createDatasetSequence(); + for (int x = 1; x < 5; x++) + { + DBRefEntry dbRef = new DBRefEntry(); + dbRef.setAccessionId("XYZ_" + x); + seq.addDBRef(dbRef); + } + + PDBEntry dbRef = new PDBEntry(); + dbRef.setId("1tim"); + + Vector pdbIds = new Vector<>(); + pdbIds.add(dbRef); + + seq.setPDBId(pdbIds); + + // Uniprot sequence for 3D-Beacons mocks + upSeq = new Sequence("P38398", + "MDLSALRVEEVQNVINAMQKILECPICLELIKEPVSTKCDHIFCKFCMLKLLNQKKGPSQCPLCKNDITKRS\n" + + "LQESTRFSQLVEELLKIICAFQLDTGLEYANSYNFAKKENNSPEHLKDEVSIIQSMGYRNRAKRLLQSEPEN\n" + + "PSLQETSLSVQLSNLGTVRTLRTKQRIQPQKTSVYIELGSDSSEDTVNKATYCSVGDQELLQITPQGTRDEI\n" + + "SLDSAKKAACEFSETDVTNTEHHQPSNNDLNTTEKRAAERHPEKYQGSSVSNLHVEPCGTNTHASSLQHENS\n" + + "SLLLTKDRMNVEKAEFCNKSKQPGLARSQHNRWAGSKETCNDRRTPSTEKKVDLNADPLCERKEWNKQKLPC\n" + + "SENPRDTEDVPWITLNSSIQKVNEWFSRSDELLGSDDSHDGESESNAKVADVLDVLNEVDEYSGSSEKIDLL\n" + + "ASDPHEALICKSERVHSKSVESNIEDKIFGKTYRKKASLPNLSHVTENLIIGAFVTEPQIIQERPLTNKLKR\n" + + "KRRPTSGLHPEDFIKKADLAVQKTPEMINQGTNQTEQNGQVMNITNSGHENKTKGDSIQNEKNPNPIESLEK\n" + + "ESAFKTKAEPISSSISNMELELNIHNSKAPKKNRLRRKSSTRHIHALELVVSRNLSPPNCTELQIDSCSSSE\n" + + "EIKKKKYNQMPVRHSRNLQLMEGKEPATGAKKSNKPNEQTSKRHDSDTFPELKLTNAPGSFTKCSNTSELKE\n" + + "FVNPSLPREEKEEKLETVKVSNNAEDPKDLMLSGERVLQTERSVESSSISLVPGTDYGTQESISLLEVSTLG\n" + + "KAKTEPNKCVSQCAAFENPKGLIHGCSKDNRNDTEGFKYPLGHEVNHSRETSIEMEESELDAQYLQNTFKVS\n" + + "KRQSFAPFSNPGNAEEECATFSAHSGSLKKQSPKVTFECEQKEENQGKNESNIKPVQTVNITAGFPVVGQKD\n" + + "KPVDNAKCSIKGGSRFCLSSQFRGNETGLITPNKHGLLQNPYRIPPLFPIKSFVKTKCKKNLLEENFEEHSM\n" + + "SPEREMGNENIPSTVSTISRNNIRENVFKEASSSNINEVGSSTNEVGSSINEIGSSDENIQAELGRNRGPKL\n" + + "NAMLRLGVLQPEVYKQSLPGSNCKHPEIKKQEYEEVVQTVNTDFSPYLISDNLEQPMGSSHASQVCSETPDD\n" + + "LLDDGEIKEDTSFAENDIKESSAVFSKSVQKGELSRSPSPFTHTHLAQGYRRGAKKLESSEENLSSEDEELP\n" + + "CFQHLLFGKVNNIPSQSTRHSTVATECLSKNTEENLLSLKNSLNDCSNQVILAKASQEHHLSEETKCSASLF\n" + + "SSQCSELEDLTANTNTQDPFLIGSSKQMRHQSESQGVGLSDKELVSDDEERGTGLEENNQEEQSMDSNLGEA\n" + + "ASGCESETSVSEDCSGLSSQSDILTTQQRDTMQHNLIKLQQEMAELEAVLEQHGSQPSNSYPSIISDSSALE\n" + + "DLRNPEQSTSEKAVLTSQKSSEYPISQNPEGLSADKFEVSADSSTSKNKEPGVERSSPSKCPSLDDRWYMHS\n" + + "CSGSLQNRNYPSQEELIKVVDVEEQQLEESGPHDLTETSYLPRQDLEGTPYLESGISLFSDDPESDPSEDRA\n" + + "PESARVGNIPSSTSALKVPQLKVAESAQSPAAAHTTDTAGYNAMEESVSREKPELTASTERVNKRMSMVVSG\n" + + "LTPEEFMLVYKFARKHHITLTNLITEETTHVVMKTDAEFVCERTLKYFLGIAGGKWVVSYFWVTQSIKERKM\n" + + "LNEHDFEVRGDVVNGRNHQGPKRARESQDRKIFRGLEICCYGPFTNMPTDQLEWMVQLCGASVVKELSSFTL\n" + + "GTGVHPIVVVQPDAWTEDNGFHAIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIPHSHY\n" + + "", 1, +1863); + upSeq.createDatasetSequence(); + upSeq.setDescription("Breast cancer type 1 susceptibility protein"); + upSeq.addDBRef(new DBRefEntry("UNIPROT","0","P38398",null,true)); + } + +@AfterMethod(alwaysRun = true) + public void tearDown() throws Exception + { + seq = null; + upSeq=null; + } + + @SuppressWarnings("deprecation") + @Test(groups = { "Functional" }) + public void buildPDBQueryTest() + { + System.out.println("seq >>>> " + seq); + + StructureChooserQuerySource scquery = StructureChooserQuerySource.getQuerySourceFor(new SequenceI[] { seq}); + AssertJUnit.assertTrue(scquery instanceof PDBStructureChooserQuerySource); + String query = scquery.buildQuery(seq); + AssertJUnit.assertEquals("pdb_id:1tim", query); + seq.getAllPDBEntries().clear(); + query = scquery.buildQuery(seq); + AssertJUnit.assertEquals( + "text:XYZ_1 OR text:XYZ_2 OR text:XYZ_3 OR text:XYZ_4 OR text:4kqy", + query); + seq.setDBRefs(null); + query = scquery.buildQuery(seq); + System.out.println(query); + AssertJUnit.assertEquals("text:4kqy", query); + + DBRefEntry uniprotDBRef = new DBRefEntry(); + uniprotDBRef.setAccessionId("P12345"); + uniprotDBRef.setSource(DBRefSource.UNIPROT); + seq.addDBRef(uniprotDBRef); + + DBRefEntry pdbDBRef = new DBRefEntry(); + pdbDBRef.setAccessionId("1XYZ"); + pdbDBRef.setSource(DBRefSource.PDB); + seq.addDBRef(pdbDBRef); + + for (int x = 1; x < 5; x++) + { + DBRefEntry dbRef = new DBRefEntry(); + dbRef.setAccessionId("XYZ_" + x); + seq.addDBRef(dbRef); + } + System.out.println(""); + System.out.println(seq.getDBRefs()); + System.out.println(query); + query = scquery.buildQuery(seq); + AssertJUnit.assertEquals( + "uniprot_accession:P12345 OR uniprot_id:P12345 OR pdb_id:1xyz", + query); + } + + @SuppressWarnings("deprecation") + @Test(groups = { "Functional" }) + public void buildThreeDBQueryTest() + { + System.out.println("seq >>>> " + upSeq); + TDBeaconsFTSRestClientTest.setMock(); + StructureChooserQuerySource scquery = StructureChooserQuerySource.getQuerySourceFor(new SequenceI[] { upSeq}); + AssertJUnit.assertTrue(scquery instanceof ThreeDBStructureChooserQuerySource); + String query = scquery.buildQuery(upSeq); + AssertJUnit.assertEquals("P38398", query); + + // query shouldn't change regardless of additional entries + // because 3DBeacons requires canonical entries. + upSeq.getAllPDBEntries().clear(); + query = scquery.buildQuery(upSeq); + AssertJUnit.assertEquals("P38398", query); + upSeq.setDBRefs(null); + query = scquery.buildQuery(upSeq); + /* + * legacy projects/datasets will not have canonical flags set for uniprot dbrefs + * graceful behaviour would be to + * - pick one ? not possible + * - iterate through all until a 200 is obtained ? + * ---> ideal but could be costly + * ---> better to do a direct retrieval from uniprot to work out which is the canonical identifier.. + * ----> need a test to check that accessions can be promoted to canonical! + */ + //FIXME - need to be able to use ID to query here ? + AssertJUnit.assertEquals(null, query); + + + + // TODO: + /** + * set of sequences: + * - no protein -> TDB not applicable, query PDBe only (consider RNA or DNA - specific query adapter ?) + * - protein but no uniprot -> first consider trying to get uniprot refs (need a mark to say none are available) + * - protein and uniprot - no canonicals -> resolve to uniprot automatically to get canonicals + * - query uniprot against 3DBeacons + * --> decorate experimental structures with additional data from PDBe + * - query remaining against PDBe + * Ranking + * - 3D Beacons + * --> in memory ranking - no need to query twice + * Rank by + * - experimental > AlphaFold -> Model + * - start > end + * -> filters for + * -> experimental only + * -> experimental plus best models for other regions + * -> "best cover" + * -> need to be able to select correct reference (the longest one that covers all) for superposition + */ +// +// DBRefEntry uniprotDBRef = new DBRefEntry(); +// uniprotDBRef.setAccessionId("P12345"); +// uniprotDBRef.setSource(DBRefSource.UNIPROT); +// upSeq.addDBRef(uniprotDBRef); +// +// DBRefEntry pdbDBRef = new DBRefEntry(); +// pdbDBRef.setAccessionId("1XYZ"); +// pdbDBRef.setSource(DBRefSource.PDB); +// upSeq.addDBRef(pdbDBRef); +// +// for (int x = 1; x < 5; x++) +// { +// DBRefEntry dbRef = new DBRefEntry(); +// dbRef.setAccessionId("XYZ_" + x); +// seq.addDBRef(dbRef); +// } +// System.out.println(""); +// System.out.println(seq.getDBRefs()); +// System.out.println(query); +// query = scquery.buildQuery(seq); +// assertEquals( +// "uniprot_accession:P12345 OR uniprot_id:P12345 OR pdb_id:1xyz", +// query); + } + @Test(groups= {"Functional"}) + public void cascadingThreeDBandPDBQuerys() + { + TDBeaconsFTSRestClientTest.setMock(); + + StructureChooserQuerySource scquery = StructureChooserQuerySource.getQuerySourceFor(new SequenceI[] { upSeq}); + + // query TDB for doc + // query PDBe for PDB entry metadata + // Combine + + FTSRestRequest tdbQuery = new FTSRestRequest(); + tdbQuery.setResponseSize(100); + tdbQuery.setFieldToSearchBy(""); + tdbQuery.setSearchTerm(scquery.buildQuery(upSeq)); + tdbQuery.setWantedFields(scquery.getDocFieldPrefs().getStructureSummaryFields()); + //scquery.fetchStructuresMetaData(upSeq, null, null, false); + String secondaryPdbQuery; + //secondaryPdbQuery = ((ThreeDBStructureChooserQuerySource)scquery).buildPDBFTSquery(); + + } + + @Test(groups = { "Functional" }) + public void sanitizeSeqNameTest() + { + String name = "ab_cdEF|fwxyz012349"; + AssertJUnit.assertEquals(name, PDBStructureChooserQuerySource.sanitizeSeqName(name)); + + // remove a [nn] substring + name = "abcde12[345]fg"; + AssertJUnit.assertEquals("abcde12fg", PDBStructureChooserQuerySource.sanitizeSeqName(name)); + + // remove characters other than a-zA-Z0-9 | or _ + name = "ab[cd],.\t£$*!- \\\"@:e"; + AssertJUnit.assertEquals("abcde", PDBStructureChooserQuerySource.sanitizeSeqName(name)); + + name = "abcde12[345a]fg"; + AssertJUnit.assertEquals("abcde12345afg", PDBStructureChooserQuerySource.sanitizeSeqName(name)); + } +}