From: James Procter Date: Thu, 11 Jan 2024 14:45:33 +0000 (+0000) Subject: JAL-4366 incomplete test verifying a 3di alignment can be reconstructed for a peptide... X-Git-Url: http://source.jalview.org/gitweb/?a=commitdiff_plain;h=26757aaaf1e2171dff558b055902058cd6d31cdc;p=jalview.git JAL-4366 incomplete test verifying a 3di alignment can be reconstructed for a peptide msa and 3di sequences --- diff --git a/test/jalview/datamodel/AlignmentTest.java b/test/jalview/datamodel/AlignmentTest.java index 1c27420..28a1ed2 100644 --- a/test/jalview/datamodel/AlignmentTest.java +++ b/test/jalview/datamodel/AlignmentTest.java @@ -38,9 +38,12 @@ import org.testng.annotations.BeforeMethod; import org.testng.annotations.Test; import jalview.analysis.AlignmentGenerator; +import jalview.analysis.AlignmentUtils; +import jalview.analysis.CrossRef; import jalview.datamodel.AlignedCodonFrame.SequenceToSequenceMapping; import jalview.gui.JvOptionPane; import jalview.io.DataSourceType; +import jalview.io.FastaFile; import jalview.io.FileFormat; import jalview.io.FileFormatI; import jalview.io.FormatAdapter; @@ -829,6 +832,59 @@ public class AlignmentTest } /** + * test mapping between a protein and 3di sequence alignment. Assumes 1:1 + * @throws IOException + */ + @Test(groups={"Functional"},enabled=true) + public void testAlignAs_3di() throws IOException + { + String protAl = ">1ji5_A\n" + + "-----------------------------DQPVLLLLLLQLLLLLVLLLQQLVVCLVQAD\n" + + "DPCNVVSNVVSVVSSVVSVVSNVVSQVVCVVVVHHHDDDVSSVVRYPQDHHDPP--DYPL\n" + + "RSLVSLLVSLVVVLVSLVVSLVSCVVVVNVVSNVSSVVVSVVSVVSNVVSCVVVVD----\n" + + "---------------------------------------------------\n" + + ">1jig_A\n" + + "---------------------------DALLVVLLLLLLQLLLALVLLLQQLVLCLVLAD\n" + + "DPCNVVSNVVSVVVSVVSVVSNVVSQVVCVVSVHHHDDDVSSVVRYPQDHDDSP--DYPL\n" + + "RSLVSLLVSLVVLLVSLVVSLVSCVVNVNPVSNVSSVVSSVVSVVSNVVSVVVND-----\n" + + "---------------------------------------------------\n" + + "\n"; + String tdiAl = ">1ji5_A\n" + + "-----------------------------MNKQVIEVLNKQVADWSVLFTKLHNFHWYVK\n" + + "GPQFFTLHEKFEELYTESATHIDEIAERILAIGGKPVATKEYLEISSIQEAAYG--ETAE\n" + + "GMVEAIMKDYEMMLVELKKGMEIAQNSDDEMTSDLLLGIYTELEKHAWMLRAFLNQ----\n" + + "---------------------------------------------------\n" + + ">1jig_A\n" + + "---------------------------MSTKTNVVEVLNKQVANWNVLYVKLHNYHWYVT\n" + + "GPHFFTLHEKFEEFYNEAGTYIDELAERILALEGKPLATKEYLATSSVNEGTSK--ESAE\n" + + "EMVQTLVNDYSALIQELKEGMEVAGEAGDATSADMLLAIHTTLEQHVWMLSAFLK-----\n" + + "---------------------------------------------------\n" + ""; + AlignmentI prot = loadAlignment(protAl, FileFormat.Fasta); + ((Alignment) prot).createDatasetAlignment(); + + AlignmentI tdi = loadAlignment(tdiAl, FileFormat.Fasta); + assertTrue(AlignmentUtils.map3diPeptideToProteinAligment(prot, tdi)); + + AlignmentI newProt = new Alignment( + new SequenceI[] + { prot.getSequenceAt(0).getSubSequence(25, 35), + prot.getSequenceAt(1).getSubSequence(35, 45) }); + newProt.setDataset(prot.getDataset()); + + // TODO Find matching tdi sequence and construct alignment mirroring + // the protein alignment + // Alignment newTdi = new CrossRef(newProt.getSequencesArray(), + // newProt.getDataset()).findXrefSequences("", false); + // + // newTdi.alignAs(newProt); + // + // System.out.println("newProt - aa\n"+new + // FastaFile().print(newProt.getSequencesArray(), true)); + // System.out.println("newProt - 3di\n"+new + // FastaFile().print(newTdi.getSequencesArray(), true)); + + } + /** * Helper method that makes mappings and then aligns the first alignment as * the second * @@ -857,7 +913,7 @@ public class AlignmentTest /** * Helper method to make mappings between sequences, and add the mappings to - * the 'mapped from' alignment + * the 'mapped from' alignment. If alFrom.isNucleotide() == alTo.isNucleotide() then ratio is always 1:1 * * @param alFrom * @param alTo