From: Fábio Madeira <fmmarquesmadeira@dundee.ac.uk> Date: Mon, 10 Apr 2017 17:01:06 +0000 (+0100) Subject: JWS-116 Added the Sphinx generated documentation pages to website/docs. X-Git-Url: http://source.jalview.org/gitweb/?a=commitdiff_plain;h=524d0a2a7b279b3e344aa58ce58b2f94c8fd7e21;p=jabaws.git JWS-116 Added the Sphinx generated documentation pages to website/docs. --- diff --git a/website/docs/_images/VMware_booted.png b/website/docs/_images/VMware_booted.png new file mode 100644 index 0000000..4740198 Binary files /dev/null and b/website/docs/_images/VMware_booted.png differ diff --git a/website/docs/_images/VMware_cpu.png b/website/docs/_images/VMware_cpu.png new file mode 100644 index 0000000..e1a7901 Binary files /dev/null and b/website/docs/_images/VMware_cpu.png differ diff --git a/website/docs/_images/folder-small.png b/website/docs/_images/folder-small.png new file mode 100644 index 0000000..1933f17 Binary files /dev/null and b/website/docs/_images/folder-small.png differ diff --git a/website/docs/_images/usage_statistics_details.gif b/website/docs/_images/usage_statistics_details.gif new file mode 100644 index 0000000..bc996ec3 Binary files /dev/null and b/website/docs/_images/usage_statistics_details.gif differ diff --git a/website/docs/_images/usage_statistics_job_details.gif b/website/docs/_images/usage_statistics_job_details.gif new file mode 100644 index 0000000..6e8d765 Binary files /dev/null and b/website/docs/_images/usage_statistics_job_details.gif differ diff --git a/website/docs/_images/usage_statistics_main.gif b/website/docs/_images/usage_statistics_main.gif new file mode 100644 index 0000000..d4b680a Binary files /dev/null and b/website/docs/_images/usage_statistics_main.gif differ diff --git a/website/docs/_images/usage_statistics_month.gif b/website/docs/_images/usage_statistics_month.gif new file mode 100644 index 0000000..1568a75 Binary files /dev/null and b/website/docs/_images/usage_statistics_month.gif differ diff --git a/website/docs/_images/vm_welcome_screen.png b/website/docs/_images/vm_welcome_screen.png new file mode 100644 index 0000000..274f109 Binary files /dev/null and b/website/docs/_images/vm_welcome_screen.png differ diff --git a/website/docs/_images/ws-structure.png b/website/docs/_images/ws-structure.png new file mode 100644 index 0000000..791ad9a Binary files /dev/null and b/website/docs/_images/ws-structure.png differ diff --git a/website/docs/_sources/advanced.rst.txt b/website/docs/_sources/advanced.rst.txt new file mode 100644 index 0000000..38a4185 --- /dev/null +++ b/website/docs/_sources/advanced.rst.txt @@ -0,0 +1,473 @@ +Advanced Usage +============== + +JABAWS web services are WS-I basic profile compliant, which means they can be accessed using any programming language or system that can utilize standard SOAP web services. The Web Service Definition Language (WSDL) for each service is published on the JABAWS home page, and you can use this to automatically generate service bindings for your program. If you use Java you may wish to use our client package to access JABAWS. This package is based on the autogenerated source code produced by wsimport, which is the Java tool for creating web service bindings. In addition, this offers some additional methods that simplify working with JABAWS. For more information please refer to the data model javadoc. + + +------------ + +.. _jabaws_wsdl: + +Valid WSDL +---------- + +**Multiple sequence alignment services** + +* ClustalOWS - http://www.compbio.dundee.ac.uk/jabaws/ClustalOWS?wsdl +* ClustalWS - http://www.compbio.dundee.ac.uk/jabaws/ClustalWS?wsdl +* MuscleWS - http://www.compbio.dundee.ac.uk/jabaws/MuscleWS?wsdl +* MafftWS - http://www.compbio.dundee.ac.uk/jabaws/MafftWS?wsdl +* TcoffeeWS - http://www.compbio.dundee.ac.uk/jabaws/TcoffeeWS?wsdl +* ProbconsWS - http://www.compbio.dundee.ac.uk/jabaws/ProbconsWS?wsdl +* MSAprobsWS - http://www.compbio.dundee.ac.uk/jabaws/MSAprobsWS?wsdl +* GLprobsWS - http://www.compbio.dundee.ac.uk/jabaws/GLprobsWS?wsdl + +**Protein disorder prediction services** + +* IUPredWS - http://www.compbio.dundee.ac.uk/jabaws/IUPredWS?wsdl +* GlobPlotWS - http://www.compbio.dundee.ac.uk/jabaws/GlobPlotWS?wsdl +* DisemblWS - http://www.compbio.dundee.ac.uk/jabaws/DisemblWS?wsdl +* JronnWS - http://www.compbio.dundee.ac.uk/jabaws/JronnWS?wsdl + +**Amino acid conservation service** + +* AAConWS - http://www.compbio.dundee.ac.uk/jabaws/AAConWS?wsdl + +**RNA Secondary Structure Prediction** + +* RNAalifoldWS - http://www.compbio.dundee.ac.uk/jabaws/RNAalifoldWS?wsdl + + +Please replace http://www.compbio.dundee.ac.uk/ with your JABAWS instance host name, and jabaws with your JABAWS context name to access your local version of JABAWS web services. For example http://localhost:8080/jabaws would be a valid URL for the default Apache-Tomcat installation and jabaws.war file deployment. + + +------------ + +.. _jabaws_config: + +JABAWS Configuration +-------------------- + +There are three parts of the system you can configure. The local and the cluster engines, and the paths to the individual executables for each engine. These settings are stored in configuration files within the web application directory (for an overview, then take a look at the `war file content table`_). + +Initially, JABAWS is configured with only the local engine enabled, with job output written to directory called "jobsout" within the web application itself. This means that JABAWS will work out of the box, but may not be suitable for serving a whole lab or a university. + + +------------ + +.. _jabaws_config_le: + +Local Engine Configuration +~~~~~~~~~~~~~~~~~~~~~~~~~~ + +The Local execution engine configuration is defined in the properties file ``conf/Engine.local.properties``. The supported configuration settings are: + +``engine.local.enable=true`` - enable or disable local engine, valid values true | false + +``local.tmp.directory=D:\\clusterengine\\testoutput`` - a directory to use for temporary files storage, optional, defaults to java temporary directory + +``engine.local.thread.number=4`` - Number of threads for tasks execution (valid values between 1 and 2x cpu. Where x is a number of cores available in the system). Optional defaults to the number of cores for core number <=4 and number of cores-1 for greater core numbers. + +If the local engine going to be heavily loaded (which is often the case if you do not have a cluster) it is a good idea to increase the amount of memory available for the web application server. If you are using Apache-Tomcat, then you can define its memory settings in the JAVA_OPTS environment variable. To specify which JVM to use for Apache-Tomcat, put the full path to the JRE installation in the JAVA_HOME environment variable. (We would recommend using Sun Java Virtual Machine (JVM) in preference to Open JDK). Below is an example of code which can be added to ``<tomcat_dir>/bin/setenv.sh`` script to define which JVM to use and a memory settings for Tomcat server. Tomcat server startup script (``catalina.sh``) will execute ``setenv.sh`` on each server start automatically. + +.. code:: bash + + export JAVA_HOME=/homes/ws-dev2/jdk1.6.0_17/ + export JAVA_OPTS="-server -Xincgc -Xms512m -Xmx1024m" + + +------------ + +.. _jabaws_config_ce: + +Cluster Engine Configuration +~~~~~~~~~~~~~~~~~~~~~~~~~~~~ + +Supported configuration settings: + +``engine.cluster.enable=true`` - enable or disable local engine true | false, defaults to false + +``cluster.tmp.directory=/homes/clustengine/testoutput`` - a directory to use for temporary files storage. The value must be an absolute path to the temporary directory. This is required. The value must be different from what is defined for local engine. This directory must be accessible from all cluster nodes. + +For the cluster engine to work, the SGE_ROOT and LD_LIBRARY_PATH environment variables have to be defined. They tell the cluster engine where to find DRMAA libraries. These variables should be defined when the web application server starts up, e.g. + +.. code:: bash + + SGE_ROOT=/gridware/sge + LD_LIBRARY_PATH=/gridware/sge/lib/lx24-amd64 + +Finally, do not forget to configure executables for the cluster execution, they may be the same as for the local execution but may be different. Please refer to the executable configuration section for further details. + + +------------ + +.. _jabaws_config_ec: + +Executable Configuration +~~~~~~~~~~~~~~~~~~~~~~~~ + +All the executable programs are configured in conf/Executable.properties file. Each executable is configured with a number of options. They are: + +.. code:: bash + + local.X.bin.windows=<path to executable under windows system, optional> + local.X.bin=<path to the executable under non-windows system, optional> + cluster.X.bin=<path to the executable on the cluster, all cluster nodes must see it, optional> + X.bin.env=<semicolon separated list of environment variables for executable, use hash symbol as name value separator, optional> + X.--aamatrix.path=<path to the directory containing substitution matrices, optional> + X.presets.file=<path to the preset configuration file, optional> + X.parameters.file=<path to the parameters configuration file, optional> + X.limits.file=<path to the limits configuration file, optional> + X.cluster.settings=<list of the cluster specific options, optional> + +Where X any of the bioinformatics tools available (e.g. clustalw, muscle, mafft, probcons, t-coffee, etc.). + +Default JABAWS configuration includes path to local executables to be run by the local engine only, all cluster related settings are commented out, but they are there for you as examples. Cluster engine is disabled by default. To configure executable for cluster execution uncomment the X.cluster settings and change them appropriately. + +By default limits are set well in excess of what you may want to offer to the users outside your lab, to make sure that the tasks are never rejected. The default limit is 100000 sequences of 100000 letters on average for all of the JABA web services. You can adjust the limits according to your needs by editing ``conf/settings/<X>Limit.xml`` files. +After you have completed the editing your configuration may look like this: + +.. code:: bash + + local.mafft.bin=binaries/mafft + cluster.mafft.bin=/homes/cengine/mafft + mafft.bin.env=MAFFT_BINARIES#/homes/cengine/mafft;FASTA_4_MAFFT#/bin/fasta34; + mafft.--aamatrix.path=binaries/matrices + mafft.presets.file=conf/settings/MafftPresets.xml + mafft.parameters.file=conf/settings/MafftParameters.xml + mafft.limits.file=conf/settings/MafftLimits.xml + mafft.cluster.settings=-q bigmem.q -l h_cpu=24:00:00 -l h_vmem=6000M -l ram=6000M + +Please not that relative paths must only be specified for the files that reside inside web application directory, all other paths must be supplied as absolute! + +Furthermore, you should avoid using environment variables within the paths or options - since these will not be evaluated correctly. Instead, please explicitly specify the absolute path to anything normally evaluated from an environment variable at execution time. + +If you are using JABAWS to submit jobs to the cluster (with cluster engine enabled), executables must be available from all cluster nodes the task can be sent to, also paths to the executables on the cluster e.g. ``cluster.<exec_name>.bin`` must be absolute. + +Executables can be located anywhere in your system, they do not have to reside on the server as long as the web application server can access and execute them. + +Cluster settings are treated as a black box, the system will just pass whatever is specified in this line directly to the cluster submission library. This is how DRMAA itself treats this settings. More exactly DRMAA ``JobTemplate.setNativeSpecification()`` function will be called. + +For further details and examples of configuration please refer to the ``Executable.properties`` file supplied with JABAWS. + + +------------ + +.. _jabaws_config_env_exe: + +Defining Environment Variables for Executables +~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ + + +Environment variables can be defined in property + +.. code:: bash + + x.bin.env + +Where x is one of thw executables supported by JABAWS. Several environment variables can be specified in the same line. For example. + +.. code:: bash + + mafft.bin.env=MAFFT_BINARIES#/homes/cengine/mafft;FASTA_4_MAFFT#/bin/fasta34; + +The example above defines two environment variables with names ``MAFFT-BINARIES`` and ``FASTA_4_MAFFT`` and values ``/homes/cengine/mafft and /bin/fasta34`` respectively. Semicolon is used as a separator between different environment variables whereas hash is used as a separator for name and value of the variable. + + +------------ + +.. _jabaws_config_env_mafft: + +Configure JABAWS to Work with Mafft +~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ + + +If you use default configuration you do not need to read any further. The default configuration will work for you without any changes, however, if you want to install Mafft yourself then there is a couple of more steps to do. + +Mafft executable needs to know the location of other files supplied with Mafft. In addition some Mafft functions depends on the fasta executable, which is not supplied with Mafft, but is a separate package. Mafft needs to know the location of fasta34 executable. + +To let Mafft know where the other files from its package are, change the value of MAFFT-BINARIES environment variables. To let Mafft know where is the fasta34 executable set the value of FASTA_4_MAFFT environment variable to point to a location of fasta34 program. The latter can be added to the PATH variable instead. If you are using executables supplied with JABAWS, the path to Mafft binaries would be like ``<relative path to web application directory>/binaries/src/mafft/binaries`` and the path to fasta34 binary would be ``<relative path to web application directory>/binaries/src/fasta34/fasta34``. You can specify the location of Mafft binaries as well as fasta34 program elsewhere by providing an absolute path to them. All these settings are defined in ``conf/Executable.properties`` file. + + +------------ + +.. _jabaws_config_env_limit: + +Limiting the size of the job accepted by JABAWS +~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ + +JABAWS can be configured to reject excessively large tasks. This is useful if you operate JABAWS service for many users. By defining a maximum allowed task size you can provide an even service for all users and prevents waste of resources on the tasks too large to complete successfully. You can define the maximum number of sequences and the maximum average sequence length that JABAWS accepts for each JABA Web Service independently. Furthermore, you can define different limits for different presets of the same web service. + +By default limits are disabled. You can enable them by editing ``conf/Executable.properties`` file. You can adjust the limits according to your needs by editing ``conf/settings/<X>Limit.xml`` files. + + +.. _war_precompiled_bin: + +Pre-compiled binaries +~~~~~~~~~~~~~~~~~~~~~ + +JABAWS comes with pre-compiled x86 Linux binaries, thus on such systems JABAWS should work straight out of the box. If you are in any doubts or experience problems you may want to make sure that the binaries supplied work under your OS. The source code for these programs is also provided so you can `recompile the binaries`_ for your own architecture and exploit any optimizations that your system can provide. + +To check if the bundled binaries are working in your system execute each binary, without any command line options or input files. If you see an error message complaining about missing libraries or other problems, then you probably need to `recompile the binaries`_. + +Alternately, if you have already got binaries on your system, then you can simply `reuse the existing binaries`_ by updating the paths in JABAWS's `configuration files`_ so these are used instead. If you have a different version of an executable (e.g. an alignment program) which you prefer, you could use it as long as it supports all the functions JABAWS executable require. This could be the case with more recent executable. If the options supported by your chosen executable is different from the standard JABAWS executable, then you need to edit the ``ExecutableNameParamaters.xml`` configuration file. + +You can try all the JABAWS functionality with the JABAWS test client or have a look at `deploying on Tomcat tips`_ if you experience any problems. + +.. note:: You may want to enable logging for testing different executables as described in section 'JABAWS Internal Logging' + + +------------ + +.. _war_recompile_bin: + +Recompiling binaries for your system +~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ + + +If you have a fully equipped build environment on your (POSIX-like) system, then you should be able to recompile the programs from the source distributions which are included in the JABAWS war file. A script called 'compilebin.sh' is provided to automate this task. + +1. In a terminal window, change the working directory to ``binaries/src`` +2. Execute the compilebin.sh script: + + .. code:: bash + + chmod +x compilebin.sh; compilebin.sh > compilebin.out; +3. Then run: + + .. code:: bash + + chmod +x setexecflag.sh; sh setexecflag.sh + + If any of the binaries was not recompiled, then a 'file not found' error will be raised. + +4. Finally, restart your Tomcat server (or JABAWS application only), and `test JABAWS`_ to check that it can use the new binaries. + + +If you couldn't compile everything, then it may be that your system does not have all the tools required for compiling the programs. At the very least check that you have gcc, g++ and make installed in your system. If not install these packages and repeat the compilation steps again. You should also review the compilebin.sh output - which was redirected to compilebin.out, and any errors output to the terminal. + + +------------ + +.. _war_reusing_bin: + +Obtaining or reusing binaries +~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ + +You could search for pre-packaged compiled executable in your system package repository or alternately, download pre-compiled binaries from each alignment program's home page. Then, either replace the executables supplied with the downloaded ones, or modify the paths defined in ``executable.properties`` as described below. +.. Below are some suggestions on where you may be able to get the binaries for your system. + +If you would like to use the binaries you already have, then you just need to let JABAWS know where they are. To do this, edit: ``conf/Executable.properties`` + +When specifying paths to executables that already exist on your system, make sure you provide an absolute path, or one relative to the JABAWS directory inside webapps. For example, the default path for clustalw is defined as ``local.clustalw.bin=binaries/src/clustalw/src/clustalw2`` Alternatively, instead of changing ``Executable.properties`` you could also replace the executables bundled with JABAWS with the ones that you have, or make symbolic links to them. Then the default configuration will work for you. More information about the Executable.properties file is given in the JABAWS Configuration page. + + +------------ + +.. _jabaws_config_lb: + +Load balancing +-------------- + +If your cluster is busy and has significant waiting times, you can achieve a faster response by allowing the server machine to calculate small tasks and then reserve the cluster for bigger jobs. This works especially well if your server is a powerful machine with many CPUs. To do this you need to enable and configure both the cluster and the local engines. Once this is done decide on the maximum size of a task to be run on the server locally. Then, edit "# LocalEngineExecutionLimit #" preset in ``<ServiceName>Limits.xml`` file accordingly. JABAWS server then will balance the load according to the following rule: If the task size is smaller than the maximum task size for local engine, and the local engine has idle threads, then it calculates task locally otherwise it submit the task to the cluster. + + +------------ + +.. _war_testing: + +Testing the JABAWS Server +------------------------- + +Access ``<your_JABAWS_server_URL>/ServiceStatus`` to test all web services. Each time you access this URL, all services are tested. For production configuration we recommend prohibiting requests to this URL for non authenticated users to prevent excessive load on the server. + +Alternatively, you can use a command line client (part of the client only package) to test your JABAWS installation as described here. If you downloaded a JABAWS server package, you can use ``<your_jaba_context_name>/WEB-INF/lib/jaba-client.jar`` to test JABAWS installation as described here. If you downloaded the source code, then you could run a number of test suites defined in the build.xml Apache Ant file. + + +First of all make sure that Tomcat server is started successfully. If this was the case, then you should see JABAWS home page when you navigate to your Tomcat JABAWS context path in your browser (e.g. at ``http://myhost.compbio.ac.uk:8080/jabaws`` => ``<jabaws_server>``) + +If you see it, then it is time to make sure that web services are working too. The easiest way to do this is to access Services Status page available from the main JABAWS web page menu. + +If you need to monitor web service health automatically when the best option is to use service checker that responds with the standard HTTP status code. To access this checker use the following URL: + +**Using JABAWS service status checker** + +If you see it, then it is time to make sure that web services are working too. The easiest way to do this is to access Services Status page available from the main JABAWS web page menu. + +If you need to monitor web service health automatically when the best option is to use service checker that responds with the standard HTTP status code. To access this checker use the following URL: ``<jabaws-server>/HttpCodeResponseServiceStatus`` or alternatively ``<jabaws-server>/man_serverwar.jsp`` + +This page returns code 200, and no page context if all services are operational, 503 if one of the services have problems. You can also check each web service individually by providing the name of the web service to check at the end of the service checker URL like this: ``<jabaws_server>/HttpCodeResponseServiceStatus/ClustalWS`` + + +Upon request, the service status checker will examine the health of the ClustalWS web service only. If the service name is not valid, then the service checker will return code 400. + +**Using command line client** + +Alternatively, you should be able to use the test program which can be found in ``<webapplicationpath>/WEB-INF/lib/jabaws-client.jar`` file. To run the tests type: + +.. code:: bash + + java -jar jabaws-client.jar -h=<Your web application server host name, port and JABAWS context path> + +For example to test all JABAWS web services on host myhost.compbio.ac.uk type: + +.. code:: bash + + java -jar jabaws-client.jar -h=http://myhost.compbio.ac.uk:8080/jabaws + + +You can choose a particular web server using -s option like this java -jar jabaws-client.jar -h=http://myhost.compbio.ac.uk:8080/jabaws -s=ClustalWS This command line assumes that java executable is in your path and jabaws-client.jar is located in the current directory. + +An example of the report testing tool produces for operating web service looks like this: + +.. code:: bash + + Connecting to service MuscleWS on http://myhost.compbio.ac.uk:8080/jabaws ... OK + Testing alignment with default parameters: + Queering job status...OK + Retrieving results...OK + Testing alignment with presets: + Aligning with preset 'Protein alignment(Fastest speed)'... OK + Aligning with preset 'Nucleotide alignment(Fastest speed)'... OK + Aligning with preset 'Huge alignments (speed-oriented)'... OK + Queering presets...OK + Queering Parameters...OK + Queering Limits...OK + Queering Local Engine Limits...OK + Check is completed service MuscleWS IS WORKING + +An example of the response of a web service which is deployed but is not operating is below: + +.. code:: bash + + Connecting to service ProbconsWS on http://localhost:8080/ws ... OK + Testing alignment with default parameters:FAILED + Service ProbconsWS IS NOT FUNCTIONAL + + +If the web server did not respond the message looks like following: + +.. code:: bash + + Connecting to service TcoffeeWS on http://localhost:8080/ws ... FAILED + + +------------ + +.. _war_logging: + +JABAWS internal logging +----------------------- + +JABAWS can be configured to log what it is doing. This comes in handy if you would like to see who is using your web services or need to chase some problems. JABAWS uses log4j to do the logging, the example of log4j configuration is bundled with JABAWS war file. You will find it in the ``/WEB-INF/classes/log4j.properties`` file. All the lines in this file are commented out. The reason why the logging is disabled by default it simple, log4j has to know the exact location of where the log files are stored. This is not known up until the deployment time. To enable the logging you need to define logDir property in the log4j.properties and uncomment section of the file which corresponds to your need. More information is given in the log4j.properties file itself. Restart the Tomcat or the JABAWS web application to apply the settings. + +After you have done this, assuming that you did not change the log4j.properties file yourself, you should see the application log file called activity.log. The file called activity.log. The amount of information logged can be adjusted using different logging levels, it is reduced in the following order of log levels TRACE, DEBUG, INFO, WARN, ERROR, FATAL. + +If you would like to know who is using your services, you might want to enable Tomcat request logging. + +------------ + +.. _war_logging_req: + +JABAWS requests logging +~~~~~~~~~~~~~~~~~~~~~~~ + +Enable Tomcat log valve. To do this uncomment the following section of <tomcat_root>/conf/server.xml configuration file. + +.. code-block:: xml + + <Valve className="org.apache.catalina.valves.AccessLogValve" directory="logs" + prefix="localhost_access_log." suffix=".txt" pattern="common" resolveHosts="false"/> + + +The following information will be logged: + ++--------------+------------------------------+-------------------------------+---------------+------------------------+ +| Remote IP | Date | Method server_URL protocol | HTTP status | Response size in bytes | ++==============+==============================+===============================+===============+========================+ +| 10.31.11.159 | [10/Feb/2010:16:51:32 +0000] | "POST /jws2/MafftWS HTTP/1.1" | 200 | 2067 | ++--------------+------------------------------+-------------------------------+---------------+------------------------+ + +Which can be processed in various programs for log analysis, such as WebAlizer, Analog, AWStats. + + +------------ + +.. _jabaws_config_ga: + +JABAWS and Google Analytics +--------------------------- + + +JABAWS reports web services usage to our group Google Analytics (GA) account. JABAWS usage statistics are collected for funding and reporting purposes, and no private information is collected. The data sent by JABAWS is as follows: + +1. The IP address of the JABAWS server machine (the server IP can anonymized see ``conf/GA.properties`` config file) +2. The name of the web service that was called. +3. A few details of the system such as JABAWS version, java version, user language, color depth, screen resolution and character encoding. + +Google Analytics can be disabled or adjusted by removing/editing ``conf/GA.properties`` Google Analytics (GA) settings file. We would appreciate it greatly if you could leave it on! + +All calls to GA are very lightweight, completed asynchronously, create very little overhead and do not influence the server response time or performance. + + +------------ + +.. _war_contents: + +JABAWS War File Content +----------------------- + ++---------------------+----------------------------------------------------------------------------------------------------------------------------------------------------------+ +| Directory | Content description | ++=====================+==========================================================================================================================================================+ +| conf/ contains | configuration files such as Executable.properties, Engine.local.properties, Engine.cluster.properties | ++---------------------+----------------------------------------------------------------------------------------------------------------------------------------------------------+ +| conf/settings | Contains individual executable description files. In particular XXXParameters.xml, XXXPresets.xml, XXXLimits.xml where XXX is the name of the executable | ++---------------------+----------------------------------------------------------------------------------------------------------------------------------------------------------+ +| ExecutionStatistics | The database for storing the execution statistics | ++---------------------+----------------------------------------------------------------------------------------------------------------------------------------------------------+ +| statpages | Web pages for usage statistics visialization and webservices status queries | ++---------------------+----------------------------------------------------------------------------------------------------------------------------------------------------------+ +| jobsout/ | Contains directories generated when running an individual executable. E.g. input and output files and some other task related data (optional) | ++---------------------+----------------------------------------------------------------------------------------------------------------------------------------------------------+ +| binaries/ | Directory contains native executables - programs, windows binaries (optional) | ++---------------------+----------------------------------------------------------------------------------------------------------------------------------------------------------+ +| binaries/src | Contains source of native executables and Linux i386 binaries | ++---------------------+----------------------------------------------------------------------------------------------------------------------------------------------------------+ +| binaries/windows | Contains binaries for MS Windows operating system | ++---------------------+----------------------------------------------------------------------------------------------------------------------------------------------------------+ +| binaries/matrices | Substitution matrices | ++---------------------+----------------------------------------------------------------------------------------------------------------------------------------------------------+ +| WEB-INF | Web application descriptor | ++---------------------+----------------------------------------------------------------------------------------------------------------------------------------------------------+ +| WEB-INF/lib | Web application libraries | ++---------------------+----------------------------------------------------------------------------------------------------------------------------------------------------------+ +| WEB-INF/classes | log4j.properties - log configuration file (optional) | ++---------------------+----------------------------------------------------------------------------------------------------------------------------------------------------------+ +| static | Static content such as CSS, JavaScript and Image files | ++---------------------+----------------------------------------------------------------------------------------------------------------------------------------------------------+ + ++---------------------+----------------------------------------------------------------------------------------------------------------------------------------------------------+ +| **Help Pages** | | ++=====================+==========================================================================================================================================================+ +| / | help pages, index.html is the starting page | ++---------------------+----------------------------------------------------------------------------------------------------------------------------------------------------------+ +| `dm_javadoc`_ | JavaDoc for the JABAWS Data Model | ++---------------------+----------------------------------------------------------------------------------------------------------------------------------------------------------+ +| `full_javadoc`_ | JavaDoc for the complete JABAWS | ++---------------------+----------------------------------------------------------------------------------------------------------------------------------------------------------+ +| `prog_docs`_ | Documentation for programs that are included in JABAWS | ++---------------------+----------------------------------------------------------------------------------------------------------------------------------------------------------+ + + + +.. links +.. _war file content table: advanced.html#jabaws_war_file_content +.. _dm_javadoc: http://www.compbio.dundee.ac.uk/jabaws/dm_javadoc/index.html +.. _full_javadoc: http://www.compbio.dundee.ac.uk/jabaws/full_javadoc/index.html +.. _prog_docs: http://www.compbio.dundee.ac.uk/jabaws/prog_docs/ +.. _test JABAWS: advanced.html#testing-the-jabaws-server +.. _deploying on Tomcat tips: war.html +.. _recompile the binaries: advanced.html#recompiling-binaries-for-your-system +.. _configuration files: advanced.html#jabaws-configuration +.. _reuse the existing binaries: advanced.html#obtaining_or_reusing_binaries diff --git a/website/docs/_sources/changelog.rst.txt b/website/docs/_sources/changelog.rst.txt new file mode 100644 index 0000000..37135b7 --- /dev/null +++ b/website/docs/_sources/changelog.rst.txt @@ -0,0 +1,90 @@ +Changelog +========= + + +.. _v2.2: + +Version 2.2 (Released XX April 2017) +------------------------------------ + +The website and documentation were improved: + +* `Sphinx`_ is now used to generate our documentation pages. +* Documentation was updated to reflect the latest changes introduced in the project. +* Downloading the JABAWS distributions no longer require 'sign in' or 'sign up' to a user account. +* The pre-configured JABAWS Amazon Machine Image (AMI), which allowed for JABAWS to be run in the Amazon EC2 cloud, is no longer provided due to very limited use by the scientific community peers. + +The versions of several application programs provided by JABAWS were bumped to the latest available. + +* Clustal Omega was updated to version 1.2.4 +* ClustalW was updated to version 2.1 +* Mafft was updated to version 7.3.10 +* T-Coffee was updated to version 11.00.8cbe486 +* Protein secondary structure prediction with Jpred (version 3.0.3) was dropped from the list of provided services, as the use of the dedicated Jpred REST API (Jpred 4) is encouraged and recommended. This is the version that is currently provided within Jalview 2.9 or later. + +.. note:: JABAWS version 2.2 is fully backward compatible with JABAWS v1.0 and v2.0. This means all JABAWS 1.0, 2.0, 2.0.1 and 2.1 clients should also be able to use JABAWS 2.2 services. + + +.. _Sphinx: http://www.sphinx-doc.org/en/stable/ + +------------ + +.. _v2.1: + +Version 2.1 (Released 1st Oct 2013) +----------------------------------- + +Several new web services are available in this version of JABAWS: + +* Two multiple sequence aligners (MSAprobs and GLprobs), both services return the standard Alignment object +* RNAalifoldWS returns RNAStructScoreManager, which is the standard ScoreManager objects with several additional methods +* JpredWS returns the JpredAligment object, which is the standard alignment with additional methods for extracting Jpred predictions. These predictions are supplied as additional sequences in the aligment + +Some bugs have been fixed and several improvements have been done: + +* WS status servlet returns version and some additional information on each web service +* a bug with path to help in the client +* Fix two bug with the Google Analytics library: no-stop due to running thread +* GoogleAnalytics gets proper JABAWS version + +------------ + +.. _v2.0.1: + +Version 2.0.1 (Released 2nd Jul 2013) +------------------------------------- + +JABAWS 2.0.1 includes several bug fixes and minor updates for JABAWS Version 2.0. These are listed below: + +* Disembl returned swapped strings for HOTLOOPS and REM465 +* Jronn failed to process jobs with more than 3 sequences +* JABAWS could not deal with FASTA records with '>' symbols in the record identificator +* Change of parameter description for AAcon: parameters have been replaced with options for calculation methods. This allows a user to get several AAcon's conservation scores in one call +* JABAWS never cleaned up job directories. Now JABAWS deletes the job directory if it exist longer than a period defined in Engine.properties +* Default web security has been incompatible with Tomcat 7.0.31 and newer +* Documentation has been updated + +------------ + +.. _v2.0: + +Version 2 (Released 16th Dec 2011) +---------------------------------- + +Compared to JABAWS 1, JABAWS 2 offers a greater number and diversity of web services, Amazon EC2 integration and improved ease of use. + +It now contains: + +* Updates for all multiple sequence alignment services +* Four new protein disorder prediction services +* Clustal Omega multiple sequence alignment web service +* Amino acid conservation service +* Web services execution statistics visualization +* Web services status check from a web page +* VirtualBox support was dropped in favour of VMware +* New WAR package for Mac users +* Amazon Machine Image (AMI) distributive to enable users to use JABAWS on the EC2 cloud +* Improved web services client API +* Simplified WAR package installation + +.. warning:: To access the analysis web services introduced in JABAWS 2.0, clients that were designed for JABAWS v1.0 must be updated. diff --git a/website/docs/_sources/citations.rst.txt b/website/docs/_sources/citations.rst.txt new file mode 100644 index 0000000..2dfcfc3 --- /dev/null +++ b/website/docs/_sources/citations.rst.txt @@ -0,0 +1,11 @@ + +Citations +========= + +.. Note:: It is important that you cite JABAWS when you use it. Citing us helps us funding the work we do and allow us to continue to improve the project further. + +.. _citations: + +Peter V. Troshin, James B. Procter and Geoffrey J. Barton - **Java Bioinformatics Analysis Web Services for Multiple Sequence Alignment - JABAWS:MS** Bioinformatics 2011. 27 (14): 2001-2002. doi: `10.1093/bioinformatics/btr304`_ + +.. _10.1093/bioinformatics/btr304: https://doi.org/10.1093/bioinformatics/btr304 diff --git a/website/docs/_sources/client.rst.txt b/website/docs/_sources/client.rst.txt new file mode 100644 index 0000000..aaa5b9e --- /dev/null +++ b/website/docs/_sources/client.rst.txt @@ -0,0 +1,118 @@ +Command Line Client (CLI) +========================= + +The JABAWS client is a Java application that lets you run the programs for which a JABAWS server provides web services. This command line application this is able to call any of the JABAWS web services on any instance of JABAWS Server available over the web. The basic client is useful if you would like to test or execute the programs provided by the JABAWS server in your own scripts, but you do not want to handle any web service specific details. The client is an open source software, so you can also use the source code to as an example how to manipulate with JABAWS web services in your own code. The JABA Web Services are `WS-I`_ compliant. This means that you can access them from any language that has libraries or functions for consuming interoperable SOAP web services. More information on how to develop software that access JABAWS services is provided in the `documentation pages`_. + +The command line client comes as a part of `client package`_ which you are welcome to download. The command line client can be used to align sequences using any of JABAWS supported web services. The client is OS independent and supports most of the functions which can be accessed programmatically via `JABAWS API`_. Using this client you could align sequences using presets or custom parameters, please see examples of this below. Here is the list of options supported by the command line client. + + +------------ + +.. _client_installing: + +Installing +---------- + +.. tip:: Check if you are running the recommended version of Java. + +You need Java 7 or higher installed in your machine to be able to run the JABAWS CLI client. +Please see the `Java` web site for up to date instructions and downloads. + +.. _Java: http://www.oracle.com/technetwork/java/javase/downloads/jre7-downloads-1880261.html + + +------------ + +.. _cli_usage: + +Usage +----- + +.. code:: bash + + java -jar jaba-client.jar + +:: + + Usage: + java -jar <path_to_jar_file> -h=host_and_context -s=serviceName ACTION [OPTIONS] + -h=<host_and_context> - a full URL to the JABAWS web server including context path e.g. http://10.31.10.159:8080/ws + -s=<ServiceName> - one of [MafftWS, MuscleWS, ClustalWS, ClustalOWS, TcoffeeWS, ProbconsWS, AAConWS, JronnWS, DisemblWS, GlobPlotWS, IUPredWS] + + + ACTIONS: + -i=<inputFile> - full path to fasta formatted sequence file, from which to align sequences + -parameters - lists parameters supported by web service + -presets - lists presets supported by web service + -limits - lists web services limits + Please note that if input file is specified other actions are ignored + + + OPTIONS: (only for use with -i action): + -r=<presetName> - name of the preset to use + -o=<outputFile> - full path to the file where to write an alignment + -f=<parameterInputFile> - the name of the file with the list of parameters to use. + + Please note that -r and -f options cannot be used together. Alignment is done with either preset or aparameters from the file, but not both! + + +------------ + +.. _cli_example: + +Example Usage +------------- + + +Align sequences from input.fasta file using Mafft web service with default settings, print alignment in Clustal format to console. + +.. code:: bash + + java -jar jabaws-min-client.jar -h=http://myhost.compbio.ac.uk:8080/jabaws -s=MafftWS -i=d:\input.fasta + +Content of input.fasta file is show below (please note sequences has been trimmed for clarity) + +:: + + >Foobar + MTADGPRELLQLRAAVRHRPQDFVAWL + >Bar + MGDTTAGEMAVQRGLALHQ + >Foofriend + MTADGPRELLQLRAAV + +Align as in above example, but write output alignment in a file out.clustal, using parameters defined in prm.in file + +.. code:: bash + + java -jar jabaws-min-client.jar -h=http://myhost.compbio.ac.uk:8080/jabaws -s=MafftWS -i=d:\input.fasta -o=d:\out.clustal -f=prm.in + +The content of the prm.in file is shown below + +:: + + --nofft + --noscore + --fastaparttree + --retree=10 + --op=2.2 + +The format of the file is the same for all JABAWS web services. Parameters are specified in exactly the same way as for native executables - alignment programs like Mafft etc. So parameters which you can use with command line version of an alignment program can be used with JABAWS. Most of the settings controlling alignment process are supported, but because any output has to be handled by JABAWS, settings controlling output are not allowed to be changed. For a list of parameters supported by a web service see the next example. In prm.in parameters are separated by the new line, and name of the parameter is separated from its value with an equals sign. This format is constant no matter which JABAWS web service is used. + +.. code:: bash + + java -jar jabaws-min-client.jar -h=http://myhost.compbio.ac.uk:8080/jabaws -s=MafftWS -parameters + +The same client can be used to access JABAWS on different hosts. Just point the client to the host you want to use by changing the value of -h key. + +For example you used ``-h=http://myhost.compbio.ac.uk:8080/jabaws`` server, now you want to use another server to ``-h=http://mylabserver.myuni.edu``. This comes handy if your favorite server is off and you need to do the job yesterday. + + +.. links +.. _Jalview: http://www.jalview.org/ +.. _Java: http://www.oracle.com/technetwork/java/javase/downloads/jre7-downloads-1880261.html +.. _client package: ../download.jsp#client +.. _documentation pages: develop.html#accessing-jabaws-from-your-program +.. _CLI documentation pages: client.html +.. _JABAWS API: http://www.compbio.dundee.ac.uk/jabaws/full_javadoc/index.html +.. _WS-I: http://www.ws-i.org/ diff --git a/website/docs/_sources/develop.rst.txt b/website/docs/_sources/develop.rst.txt new file mode 100644 index 0000000..538923c --- /dev/null +++ b/website/docs/_sources/develop.rst.txt @@ -0,0 +1,635 @@ +For Developers +============== + +.. _jabaws_source: + +Source Code +----------- + +.. note:: This is an open source project. If you want to contribute or report an issue have a look at our `Git-tracker`_. + +Publicly available Git repository: http://source.jalview.org/gitweb/?p=jabaws.git + +.. code:: bash + + git clone http://source.jalview.org/git/jabaws.git + + +------------ + +.. _jabaws_api: + +The API +------- + +`Data Model JavaDoc`_ - read this if your are coding against JABA Web Services + +`Complete JavaDoc`_ - for developers who want to use JABAWS framework and use Engines and Executables directly + + +------------- + +.. _jabaws_structure: + +Structure of the project +------------------------ + +| |folder| *binaries* contains native executables e.g. clustalw +| |folder| *src* contains sources of native executables +| |folder| *windows* contains pre-compiled Windows binaries +| |folder| *compilebin.sh* the script to complile binaries +| |folder| *setexecflag.sh* the script to set executable flag for the binaries +| |folder| *conf* contains JABAWS configuration files +| |folder| *ExecutionStatistics* the database for storing collected execution statistics +| |folder| *jobsout* a default folder for temporary job directories +| |folder| *statpages* the web pages for execution statistics display +| |folder| *WEB-INF* default +| |folder| *docs* contains the reStructuredText documentation files +| |folder| *website* contains the JABAWS web pages +| |folder| *archive* contains JABAWS packages, the WAR and JAR files +| |folder| *datamodel* contains the JABAWS datamodel +| |folder| *engine* contains the JABAWS engine - the code that abstract the execution environment and executes native binaries +| |folder| *runner* contains the JABAWS runners - thin wrappers for native binaries +| |folder| *webservices* contains the JABAWS SOAP web services +| |folder| *testsrc* contains the JABAWS unit tests + + +------------ + +.. _jabaws_code: + +The code structure +------------------ + +.. image:: ../website/static/img/ws-structure.png + :height: 414 + :width: 282 + :scale: 95 % + :align: left + + +Each source folder depends on the upper folders for compilation. For example, the datamodel is the top level folder so it has no other dependencies on other JABAWS code. The Engine level depends on the datamodel to compile etc. The web services folder is the bottom layer and depends on all the other source code. + +So the JABAWS project is split into 4 layers. From bottom-up the first layer consists from the value classes used by all other layers of the hierarchy, in particular web services. So, to be able to use JABAWS one needs to have these classes. At the same time classes on this layer does not have any dependencies on the layers above. + +The second layer contains code for execution of the wrappers, which are the abstraction describing native executables. JABAWS can execute tasks locally that is on the same machine as JVM and on the cluster. Thus currently code on this layer contain two engines. This layer depends on the layer underneath, the data model layer, but is completely independent from the code above. + +The third layer consists of the wrappers for the native executables and classes to handle their configuration. It depends on the engines and the data model, but know nothing about the web services. + +Finally, the upper layer contains the web services, that depend on all the layers below. + +The layer isolation is archived though specially designed compilation task which is executed sequentially in several stages so that the first layer compiles before any other layers, second layer compiles after that and process continies before all the code is compiled. Any violation of the layer boundaries results in the compilation failure. Use Ant "Compile" or "Complile_with_debug" tasks to perform the staged compilation. + +A client package contains only classes from data model layer and a simple web services client. Framework package is for anyone who want to use JABAWS framework for controlling native executables in local or cluster environments. Framework exclude the web services layer. Server package contains all the code. + + +------------ + +.. _jabaws_tests: + +Unit Testing +------------ + +JABAWS uses `TestNG`_ framework for testing. The test results for the JABAWS package offered for download can be found at: `Test Results`_ +JABAWS uses TestNG for testing. There is a TestNG plugin available for Eclipse which has functionality similar to JUnit. However, no plugins are necessary to run the test cases, as testng jar is supplied with JABAWS together with an ant tasks to run the test cases. + + +Several testing groups are supported: + +* All tests ('Test') +* Cluster tests ('Run_cluster_dependent_test') +* Cluster independent tests ('All_cluster_independent_tests') +* Windows only tests ('All_cluster_independent_windows_only_tests') +* Performance and stability tests ('Long_tests') +* Re-run failed tests ('Rerun_failed_tests') +* Run custom test ('CustomTest') + +To run the tests you need to download all sources from repository. Once you have done that, enter into the command line mode, change directory to the project directory and type: + +.. code:: bash + + ant -f build.xml <test group name> + + +Make sure you have `Apache Ant`_ installed and path to ant executable is defined in your path environmental variable. Replace test group name with the one of the names given in the list above to run required group of tests e.g for running cluster only tests use the following command: + +.. code:: bash + + ant -f build.xml Run_cluster_dependent_test + + +If you work under Linux you could use a simple script from the root folder of repository called ``runtests.sh``. This script simply contains a collection of the test commands described above and paths to java home directory and an ant executable, which you can define once for your system and then reuse. + +A handy feature of TestNG is its ability to re-run failed tests. Failed test ant file is stored in ``test-output/testng-failed.xml``. and is used in the ant task called ``Rerun_failed_tests``. So re-running failed tests requires no more work than running any other test group and could be accomplished with the command: + +.. code:: bash + + ant -f build.xml Rerun_failed_tests + + +CustomTest runs the test defined in the project root directory file called ``temp-testng-customsuite.xml``. This file is generated by TestNG plugin every time you run the test from Eclipse. Thus an easy way to run a test in a different environment is to run it from Eclipse first and then from ant using a custom test procedure. + +For cluster execution make sure that the property ``LD_LIBRARY_PATH`` defined in build.xml points to cluster engine LD libraries directory in your local system. + + +------------ + +.. _jabaws_conn_services: + +Accessing JABAWS from your program +---------------------------------- + +.. _jabaws_conn_functions: + +Web services functions overview +~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ + + +All JABAWS multiple sequence alignment web services comply to the same interface, thus the function described below are available from all the services. + +Functions for initiating the alignment + +.. code:: bash + + String id = align(List<FastaSequence> list) + String id = customAlign(List<FastaSequence> sequenceList, List<Option> optionList) + String id = presetAlign(List<FastaSequence> sequenceList, Preset preset) + +Functions pertaining to job monitoring and control + +.. code:: bash + + JobStatus status = getJobStatus(String id) + Alignment al = getResult(String id) + boolean cancelled = cancelJob(String id) + ChunkHolder chunk = pullExecStatistics(String id, long marker) + +Functions relating to service features discovery + +.. code:: bash + + RunnerConfig rc = getRunnerOptions() + Limit limit = getLimit(String name) + LimitsManager lm = getLimits() + PresetManager pm = getPresets() + +Please refer to a Data Model JavaDoc for a detailed description of each methods. + + +------------ + +.. _jabaws_conn_functions2: + +Structure of the template command line client +~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ + ++------------------------+------------------------------------------------------------------------+ +| Packages | Classes and Interfaces | ++========================+========================================================================+ +| compbio.data.msa | MsaWS the interface for all multiple sequence alignment web services | ++------------------------+------------------------------------------------------------------------+ +| compbio.data.sequence | JABAWS data types | ++------------------------+------------------------------------------------------------------------+ +| compbio.metadata | JABAWS meta data types | ++------------------------+------------------------------------------------------------------------+ +| compbio.ws.client | JABAWS command line client | ++------------------------+------------------------------------------------------------------------+ + +Additional utility libraries that this client depend upon is the compbio-util-1.3.jar and compbio-annotation-1.0.jar. + +Please refer to a `Data Model JavaDoc`_ for a detailed description of each class and its methods. + + +------------ + +.. _jabaws_conn_conn: + +Connecting to JABAWS +~~~~~~~~~~~~~~~~~~~~ + +For a complete working example of JABAWS command line client please see compbio.ws.client.Jws2Client class. JABAWS command line client source code is available from the `download page`_. Please note that for now all the examples are in Java, other languages will follow if there is sufficient demand. + +Download a binary JABAWS client. Add the client to the class path. The following code excerpt will connect your program to Clustal web service deployed in the University of Dundee. + +.. code-block:: java + + import java.net.URL; + import javax.xml.namespace.QName; + import javax.xml.ws.Service; + // (...) + String qualifiedName = "http://msa.data.compbio/01/01/2010/"; + URL url = new URL("http://www.compbio.dundee.ac.uk/jabaws/ClustalWS?wsdl"); + QName qname = new QName(, "ClustalWS"); + Service serv = Service.create(url, qname); + MsaWS msaws = serv.getPort(new QName(qualifiedName, "ClustalWSPort"), + MsaWS.class); + +Line 1 makes a qualified name for JABA web services. + +Line 2 constructs the URL to the web services WSDL. + +Line 3 makes a qualified name instance for Clustal JABA web service. + +Line 4 creates a service instance. + +Line 5 makes a connection to the server. + +A more generic connection method would look like this + +.. code-block:: java + + import java.net.URL; + import javax.xml.namespace.QName; + import javax.xml.ws.Service; + import compbio.ws.client.Services + // (...) + String qualifiedServiceName = "http://msa.data.compbio/01/01/2010/"; + String host = "http://www.compbio.dundee.ac.uk/jabaws"; + // In real life the service name can come from args + Services clustal = Services.ClustalWS; + URL url = new URL(host + "/" + clustal.toString() + "?wsdl"); + QName qname = new QName(qualifiedServiceName, clustal.toString()); + Service serv = Service.create(url, qname); + MsaWS msaws = serv.getPort(new QName(qualifiedServiceName, clustal + "Port"), MsaWS.class); + + +Where Services is enumeration of JABAWS web services. All JABAWS multiple sequence alignment methods confirm to MsaWS specification, thus from the caller point of view all JABAWS web services can be represented by MsaWS interface. The full documentation of MsaWS functions is available from the `JavaDoc`_. + + +------------ + +.. _jabaws_conn_aln: + +Aligning Sequences +~~~~~~~~~~~~~~~~~~ + +Given that *msaws* is web service proxy, created as described in "Connecting to JABAWS" section, the actual alignment can be obtained as follows: + +.. code:: bash + + List<FastaSequence> fastalist = SequenceUtil.readFasta(new FileInputStream(file)); + String jobId = msaws.align(fastalist); + Alignment alignment = msaws.getResult(jobId); + Line one loads FASTA sequence from the file. + +Line two submits them to web service represented by msaws proxy. + +Line three retrieves the alignment from a web service. This line will block the execution until the result is available. Use this with caution. In general, you should make sure that the calculation has been completed before attempting retrieving results. This is to avoid keeping the connection to the server on hold for a prolonged periods of time. While this may be ok with your local server, our public server (www.compbio.dundee.ac.uk/jabaws) will not let you hold the connection for longer than 10 minutes. This is done to prevent excessive load on the server. The next section describes how to check the status of the calculation. +Methods and classes mentioned in the excerpt are available from the JABAWS client library. + + +------------ + +.. _jabaws_conn_status: + +Checking the status of the calculation +~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ + +You may have noticed that there was no pause between submitting the job and retrieving of the results. This is because getResult(jobId) method block the processing until the calculation is completed. However, taking into account that the connection holds server resources, our public server (www.compbio.dundee.ac.uk/jabaws) is configured to reset the connection after 10 minutes of waiting. To work around the connection reset you are encouraged to check whether the calculation has been completed before accessing the results. You can do it like this: + +.. code-block:: java + + while (msaws.getJobStatus(jobId) != JobStatus.FINISHED) { + Thread.sleep(2000); // wait two seconds, then recheck the status + } + + +------------ + +.. _jabaws_conn_aln_presets: + +Aligning with presets +~~~~~~~~~~~~~~~~~~~~~ + +.. code:: bash + + PresetManager presetman = msaws.getPresets(); + Preset preset = presetman.getPresetByName(presetName); + List<FastaSequence> fastalist = SequenceUtil.readFasta(new FileInputStream(file)); + String jobId = msaws.presetAlign(fastalist, preset); + Alignment alignment = msaws.getResult(jobId); + +Line one obtains the lists of presets supported by a web service. + +Line two return a particular Preset by its name. + +Lines three to five are doing the same job as in the `first aligning sequences example`_. + + +------------ + +.. _jabaws_conn_aln_params: + +Aligning with custom parameters +~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ + +.. code:: bash + + RunnerConfig options = msaws.getRunnerOptions(); + Argument matrix = options.getArgument("MATRIX"); + matrix.setValue("PAM300"); + Argument gapopenpenalty = options.getArgument("GAPOPEN"); + gapopenpenalty.setValue("20"); + List<Argument> arguments = new ArrayList<Argument>(); + arguments.add(matrix); arguments.add(gapopenpenalty); + List<FastaSequence> fastalist = SequenceUtil.readFasta(new FileInputStream(file)); + String jobId = msaws.customAlign(fastalist, arguments); + Alignment alignment = msaws.getResult(jobId); + +Line one obtains the ``RunnerConfig`` object that holds information on supported parameters and their values + +Line two retrieve a particular parameter from the holder by its name. + +Lines three sets a value to this parameter which will be used in the calculation. + +Line four and five do the same but for another parameter. + +Line six makes a List to hold the parameters. + +Line seven puts the parameters into that list. + +Line eight and ten is the same as in previous examples. + +Line nine submit an alignment request with the sequences and the parameters. + +The names of all the parameters supported by a web service e.g. "PAM300" can be obtained using ``options.getArguments()`` method. Further details on the methods available from ``RunnerConfig`` object are available from the JavaDoc. + + +------------ + +.. _jabaws_conn_aln_file: + +Writing alignments to a file +~~~~~~~~~~~~~~~~~~~~~~~~~~~~ + +There is a utility method in the client library that does exactly that. + +.. code-block:: java + + Alignment alignment = align(...) + FileOutputStream outStream = new FileOutputStream(file); + ClustalAlignmentUtil.writeClustalAlignment(outStream, align); + + +------------ + +.. _jabaws_conn_aln_example: + +A complete client example +~~~~~~~~~~~~~~~~~~~~~~~~~ + +Finally, a complete example of the program that connects to JABAWS Clustal service and aligns sequences using one of the Clustal web service presets. All you need for this to work is a `JABAWS CLI client`_. Please make sure that the client is in the Java class path before running this example. + +.. code-block:: java + + import java.io.ByteArrayInputStream; + import java.io.FileNotFoundException; + import java.io.IOException; + import java.net.URL; + import java.util.List; + + import javax.xml.namespace.QName; + import javax.xml.ws.Service; + + import compbio.data.msa.MsaWS; + import compbio.data.sequence.Alignment; + import compbio.data.sequence.FastaSequence; + import compbio.data.sequence.SequenceUtil; + import compbio.metadata.JobSubmissionException; + import compbio.metadata.LimitExceededException; + import compbio.metadata.Preset; + import compbio.metadata.PresetManager; + import compbio.metadata.ResultNotAvailableException; + import compbio.metadata.UnsupportedRuntimeException; + import compbio.metadata.WrongParameterException; + + public class Example { + + /* + * Input sequences for alignment + */ + static final String input = ">Foo\r\n" + + "MTADGPRELLQLRAAVRHRPQDFVAWLMLADAELGMGDTTAGEMAVQRGLALHPGHPEAVARLGR" + + "VRWTQQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDAGQAEAAAAAYTRAHQLLPEEPYITAQ" + + "LLNWRRRLCDWRALDVLSAQVRAAVAQGVGAVEPFAFLSEDASAAEQLACARTRAQAIAASVRPL" + + "APTRVRSKGPLRVGFVSNGFGAHPTGLLTVALFEALQRRQPDLQMHLFATSGDDGSTLRTRLAQA" + + "STLHDVTALGHLATAKHIRHHGIDLLFDLRGWGGGGRPEVFALRPAPVQVNWLAYPGTSGAPWMD" + + "YVLGDAFALPPALEPFYSEHVLRLQGAFQPSDTSRVVAEPPSRTQCGLPEQGVVLCCFNNSYKLN" + + "PQSMARMLAVLREVPDSVLWLLSGPGEADARLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHAD" + + "LFLDTHPYNAHTTASDALWTGCPVLTTPGETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALAS" + + "DPAALTALHARVDVLRRESGVFEMDGFADDFGALLQALARRHGWLGI\r\n" + + "\r\n" + + ">Bar\r\n" + + "MGDTTAGEMAVQRGLALHQQRHAEAAVLLQQASDAAPEHPGIALWLHALEDAGQAEAAAAYTRAH" + + "QLLPEEPYITAQLLNAVAQGVGAVEPFAFLSEDASAAESVRPLAPTRVRSKGPLRVGFVSNGFGA" + + "HPTGLLTVALFEALQRRQPDLQMHLFATSGDDGSTLRTRLAQASTLHDVTALGHLATAKHIRHHG" + + "IDLLFDLRGWGGGGRPEVFALRPAPVQVNWLAYPGTSGAPWMDYVLGDAFALPPALEPFYSEHVL" + + "RLQGAFQPSDTSRVVAEPPSRTQCGLPEQGVVLCCFNNSYKLNPQSMARMLAVLREVPDSVLWLL" + + "SGPGEADARLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHADLFLDTHPYNAHTTASDALWTGC" + + "PVLTTPGETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALASDPAALTALHARVDVLRRESGV" + + "FEMDGFADDFGALLQALARRHGWLGI\r\n" + + "\r\n" + + ">Friends\r\n" + + "MTADGPRELLQLRAAVRHRPQDVAWLMLADAELGMGDTTAGEMAVQRGLALHPGHPEAVARLGRV" + + "RWTQQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDHQLLPEEPYITAQLDVLSAQVRAAVAQG" + + "VGAVEPFAFLSEDASAAEQLACARTRAQAIAASVRPLAPTRVRSKGPLRVGFVSNGFGAHPTGLL" + + "TVALFEALQRRQPDLQMHLFATSGDDGSTLRTRLAQASTLHDVTALGHLATAKHIRHHGIDLLFD" + + "LRGWGGGGRPEVFALRPAPVQVNWLAYPGTSGAPWMDYVLGDAFALPPALEPFYSEHVLRLQGAF" + + "QPSDTSRVVAEPPSRTQCGLPEQGVVLCCFNNSYKLNPQSMARMLAVLREVPDSVLWLLSGPGEA" + + "DARLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHADLFLDTHPYNAHTTASDALWTGCPVLTTP" + + "GETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALASDPAALTALHARVDVLRRESI"; + + public static void main(String[] args) throws UnsupportedRuntimeException, + LimitExceededException, JobSubmissionException, + WrongParameterException, FileNotFoundException, IOException, + ResultNotAvailableException, InterruptedException { + + String qualifiedServiceName = "http://msa.data.compbio/01/01/2010/"; + + /* Make a URL pointing to web service WSDL */ + URL url = new URL("http://www.compbio.dundee.ac.uk/jabaws/ClustalWS?wsdl"); + + /* + * If you are making a client that connects to different web services + * you can use something like this: + */ + // URL url = new URL(host + "/" + Services.ClustalWS.toString() + + // "?wsdl"); + + QName qname = new QName(qualifiedServiceName, "ClustalWS"); + Service serv = Service.create(url, qname); + /* + * Multiple sequence alignment interface for Clustal web service + * instance + */ + MsaWS msaws = serv.getPort(new QName(qualifiedServiceName, "ClustalWS" + + "Port"), MsaWS.class); + + /* Get the list of available presets */ + PresetManager presetman = msaws.getPresets(); + + /* Get the Preset object by preset name */ + Preset preset = presetman + .getPresetByName("Disable gap weighting (Speed-oriented)"); + + /* + * Load sequences in FASTA format from the file You can use something + * like new FileInputStream(<filename>) to load sequence from the file + */ + List<FastaSequence> fastalist = SequenceUtil + .readFasta(new ByteArrayInputStream(input.getBytes())); + + /* + * Submit loaded sequences for an alignment using preset. The job + * identifier is returned by this method, you can retrieve the results + * with it sometime later. + */ + String jobId = msaws.presetAlign(fastalist, preset); + + /* This method will block for the duration of the calculation */ + Alignment alignment = msaws.getResult(jobId); + + /* + * This is a better way of obtaining results, it does not involve + * holding the connection open for the duration of the calculation, + * Besides, as the University of Dundee public server will reset the + * connection after 10 minutes of idling, this is the only way to obtain + * the results of long running task from our public server. + */ + // while (msaws.getJobStatus(jobId) != JobStatus.FINISHED) { + // Thread.sleep(1000); // wait a second, then recheck the status + // } + + /* Output the alignment to standard out */ + System.out.println(alignment); + + // Alternatively, you can record retrieved alignment into the file in + // ClustalW format + + // ClustalAlignmentUtil.writeClustalAlignment(new FileOutputStream( + // "output.al"), alignment); + + } + } + +For a more detailed description of all available types and their functions please refer to the `Data Model JavaDoc`_. + + +------------ + +.. _jabaws_new_services: + +Adding new web-services +----------------------- + +.. _jabaws_new_guide: + +Brief Guide +~~~~~~~~~~~ + + +1. Add a new executable which you'd like to wrap as a JABAWS web service to the binaries folder. If it has the source code and can be recompiled for different platforms include it under ``binaries/src``. Edit ``setexecutableflag.sh`` and ``compilebin.sh`` scripts in ``binaries/src`` accordingly. + +2. Make sure that all the dependencies of the software being installed are satisfied. If there are other binaries they should be included as well. Keep the dependent binaries in a subfolder for the main executable. Update ``compilebin.sh`` and ``setexecflag.sh`` scripts accordingly. + +3. Make sure that the new executable does not have any hard links to its dependencies, e.g. is able to run from any installation folder and does not contain any hard coded paths. + +4. Describe executable in ``conf/Exectuable.properties`` file. The lowercase name of the wrapper should be included in the name of the property for example Clustal properties all include clustal as a part of the name e.g. ``local.clustalw.bin``. The same property for MAFFT will be called ``local.mafft.bin``. For more help please refer to the Executable.properties file. + +5. Describe the executable supported parameters in the ``<ExecutableName>Parameters.xml``, presets in the ``<ExecutableName>Presets.xml`` and the execution limits in the ``<ExecutableName>Limit.xml``. By convention these files are stored in ``conf/settings``. All of these are optional. If the executable does not support parameters you do not have to mention the ``XXXParameter.xml`` file in the ``Executable.properties`` file at all. The same is true for Presets and Limits. + +6. Create a Java wrapper class for your executable. Create it within runner source directory. Examples of other wrappers can be found in ``compbio.runner.msa`` or in other ``compbio.runner.*`` packages. Wrapper should extend ``SkeletalExecutable<T>`` and implement ``PipedExecutable<T>`` if you need to pass the input or collect the results from the standard in/out. Please see Mafft code as example. Wrapper should expend ``SkeletalExecutable<T>`` if input/output can be set as a parameter for an executable. Please see the ClustalW code as example. + +7. Create a testcase suit for your wrapper in ``testsrc`` and run the test cases. + +8. Create parser for the output files of your executable. Suggested location ``compbio.data.sequence.SequenceUtil``. + +9. Test the parser. + +10. Decide which web services interfaces your executable is going to match. For example if the executable output can be represented as SequenceAnnotation then SequenceAnnotation interface might be appropriate. For multiple sequence alignment an Msa interface should be used. + +11. If you find a web interface that matches your returning data type, then implement a web service which confirms to it within a webservices source folder. + +12. Register web service in ``WEB-INF/web.xml`` and ``WEB-INF/sun-jaxws.xml``. + +13. Add generated wsdl to wsbuild.xml ant script to generate the stubs. + +14. Run build-server task in wsbuild file. Watch for errors. If the task fails that means that JAXB cannot serialize some of your new data structures. Add appropriate annotations to your data types. Also check that: + + * you do not have interfaces to serialize, since JAXB cannot serialize them + * you have a default no args constructor (can be private if you do not need it) + * JAXB cannot serialize Java Map class, use a custom data structure instead + * Enum cannot be serialized as its abstract class (do not confuse with enum which is fine) + * Fields serialization leaves a little more space for manoeuvre. If you do this then you may accept and return interfaces, e.g. List, Map; abstract classes etc, from your methods + + If you have the data on the server side, but nothing is coming through to the client, this is a JAXB serialization problem. They tend to be very silent and thus hard to debug. Check your data structure can be serialized! + +15. Modify the client to work with your new web service. Update Services enumeration to include new service and ensure that all the methods of this enumeration take into account the new service. Update the client help text (``client_help.txt``) and insert it into the Constraints class. + +16. Test the web service with the client. + +17. Test on the cluster. + + +------------ + +.. _jabaws_artifacts: + +Building web services artifacts +~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ + +JABAWS are the standard `JAX-WS`_ SOAP web services, which are `WS-I`_ basic profile compatible. This means that you could use whatever tool your language has to work with web services. Below is how you can generate portable artifacts to work with JABAWS from Java. However if programming in Java, we recommend using our client library as it provides a handful of useful methods in addition to plain data types. + +.. code:: bash + + wsimport -keep http://www.compbio.dundee.ac.uk/jabaws/ClustalWS?wsdl + + +Server side artifacts should be rebuild whenever the data model, meta model or MSA interface were changed. To do that run build-server task from wsbuild.xml ant build file. WSDL files will be generated in ``webservices/compbio/ws/server/resource`` directory. It is not necessary to edit them if any of the JABAWS clients are used. JABAWS are the standard JAX-WS web services, which are WS-I basic profile compatible. + + +------------ + +.. _jabaws_distributives: + +Preparing Distributives +~~~~~~~~~~~~~~~~~~~~~~~ + +There are a number of ant tasks aimed for preparing distributives for download. Currently a few types of JABAWS packages are offered: + +1. Client only (contains classes required to access JABA Web Services) +2. Platform specific JABAWS (windows and other) +3. JABAWS without binaries +4. JABAWS framework + +Corresponding build task names are: + +1. min-jaba-client +2. jaba-windows, jaba-complete +3. jaba-no-binaries +4. full-jaba-client + +The easiest way to build all distributives is to call ``build-all`` ant task. There are more tasks defined in build.xml than described here. They are mostly self explanatory. + +If you made any changes to the data model and would like to generate a complete JABAWS distro make sure you have rebuilt jaxws artifact as described below. + + + +.. |folder| image:: ../website/static/img/folder-small.png + :align: middle + :width: 15 + + +.. links +.. _Git-tracker: https://source.jalview.org/crucible/changelog/jabaws +.. _Data Model JavaDoc: http://www.compbio.dundee.ac.uk/jabaws/dm_javadoc/index.html +.. _Complete JavaDoc: http://www.compbio.dundee.ac.uk/jabaws/full_javadoc/index.html +.. _JavaDoc: http://www.compbio.dundee.ac.uk/jabaws/full_javadoc/index.html +.. _Test Results: http://www.compbio.dundee.ac.uk/user/www-jws2/tests/index.html +.. _TestNG: http://testng.org/doc/index.html +.. _Apache Ant: http://ant.apache.org/ +.. _download page: download.jsp +.. _JABAWS CLI client: download.jsp#client +.. _first aligning sequences example: develop.html#aligning-sequences +.. _JAX-WS: http://jax-ws.java.net/ +.. _WS-I: http://www.ws-i.org/ diff --git a/website/docs/_sources/getting_started.rst.txt b/website/docs/_sources/getting_started.rst.txt new file mode 100644 index 0000000..08fcfe7 --- /dev/null +++ b/website/docs/_sources/getting_started.rst.txt @@ -0,0 +1,160 @@ +Getting Started +=============== + +JABAWS stands for *JAva Bioinformatics Analysis Web Services*. As the name suggests, JABAWS is a collection of web services for bioinformatics, and currently provides services that make it easy to access well-known multiple sequence alignment and protein disorder prediction programs (see the list of `currently supported programs`_). Future versions of JABAWS will incorporate other tools. + +JABAWS consists of a server and a client, but unlike most bioinformatics web-service systems, you can download and run both parts on your own computer! If you want a server just for yourself, then download and install the `JABAWS Virtual Appliance (VA)`_. It requires no configuration and is simple to install. If you want to install JABAWS for your lab or institution then download the `JABAWS Web Application aRchive (WAR)`_. It is slightly more complicated to configure but is very straightforward too. Finally, if you want to script against any version of JABAWS or are interested in writing your own client, the `JABAWS Command Line Interface (CLI)`_ client is what you need. + + +------------ + +.. _benefits: + +JABAWS Benefits +--------------- + +* Can be deployed on most operating systems, as a VMware or compatible Virtual Appliance, as well as a Tomcat Java Web Application. +* Comes complete with sources and binaries for all the bioinformatics programs that it runs. +* Can operate as a stand alone server or one that submits jobs to a cluster via `DRMAA`. +* Easy to access from `Jalview`_ using its graphical client, or using the JABAWS command line client. +* Clients can submit jobs to any JABAWS servers that they might want to access, such as the one running on your local computer, your lab's server, or the publicly available services at the `University of Dundee`_. +* Local or intranet installation eliminates any security concerns you might have about sending sensitive data over the internet. +* Wide range of configuration options to control size of jobs accepted by a server, and the command line options available for the program run by a service. + + +------------ + +.. _distributions: + +JABAWS Distributions +-------------------- + +.. tip:: To help you choose the JABAWS distribution that better suits your needs and read on the quickstart guides below. + +**I want to use JABAWS for...** + +* :ref:`jabaws-jalview-public` - Running JABAWS services through Jalview on the JABAWS *public* server +* :ref:`jabaws-cli` - Accessing a *public* or *private* JABAWS server using the JABAWS client +* :ref:`jabaws-war` - Running JABAWS for my group, lab, or organization on the *local* infrastructure +* :ref:`jabaws-va` - Running JABAWS services through Jalview or the CLI client on a *private* virtual machine server + + +------------ + +.. _jabaws-jalview-public: + +Jalview and the JABAWS Public Server +~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ + +`Jalview`_, a multiple sequence alignment and analysis application, is a good example of a graphical JABAWS client. This client uses the same functionality as the `JABAWS Command Line Interface (CLI)`_ client, but instead allows JABAWS services to be accessed in a more user-friendly manner, through a graphical user interface. In this way, this is the easiest way to run JABAWS web services. Simply launch `Jalview`_ and run any of the methods provided under the 'Web Service' menu. Jalview uses the public JABAWS server by default. If you are concerned about privacy or want to run sensitive analysis on your own hardware, you can either setup a local `JABAWS Virtual Appliance (VA)`_ or configure the `JABAWS Web Application aRchive (WAR)`_ in your infrastructure. + +------------ + +.. _jabaws-cli: + +Command Line Client (CLI) +~~~~~~~~~~~~~~~~~~~~~~~~~ + +This is a single Java archive which contains the JABAWS command line interface (CLI) client. It allows anyone who wants to connect to the JABAWS web-services running at the University of Dundee's Public Server, or to run a local private JABAWS server from their own software. You can read more about how to use JABAWS command line (CLI) client given in the `CLI documentation pages`_, but a brief instructions are given below: + +1. Download the `Client Jar file`_ +2. Download and install `Java`_ (version 1.7) +3. Provided that you have the Java ready to run, you can get command line help by changing to the directory where you downloaded the client jar, and typing: + + .. code:: bash + + java -jar jaba-client.jar + + +The JABA Web Services are WS-I compliant. This means that you can access them from any language that has libraries or functions for consuming interoperable SOAP web services. More information on how to develop software that access JABAWS services is provided in the `documentation pages`_. + + +------------ + +.. _jabaws-war: + +Web Application aRchive (WAR) +~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ + +The JABAWS Web Application aRchive (WAR) is for anyone who wants to run JABAWS for their group, lab or organization, or wants to enable their local JABAWS server to use the cluster or perform very large tasks. Complete documentation is provided in the `WAR documentation pages`_, but brief instructions are given below: + +1. Download the `JABAWS WAR file`_ +2. Download and install `Apache-Tomcat`_ + + You will need at least Tomcat version 5.5 of (we would recommend version 8.5) and at least `Java` 1.7 (i.e. JAVA 7). +3. Drop the JABAWS WAR file into ``tomcat/webapps`` directory. +4. (Re)start the Tomcat. +5. Once the tomcat has started, it should automatically unpack the WAR into the webapps directory (if it doesn't, simply unpack the WAR archive). +6. If you are on Mac or other unix-like architecture with GNU compilers available or you'd like to get a maximum performance + + ``cd`` to ``webapps/jabaws/binaries/src/`` and execute ``./compilebin.sh`` script to compile all binaries JABAWS depends on. + +**Testing** + +You can test that your JABAWS server is working in several ways. + +1. Visit Services Status page available from the JABAWS main page using your web browser. +2. If you are working on the command line, then use the command line client shipped with the JABAWS war to test it by running: + + .. code:: bash + + java -jar <Path to tomcat WebApp directory>/jabaws/WEB-INF/lib/jabaws-client.jar -h=http://localhost:8080/jabaws + + In this example we assumed that your JABAWS server URL is ``http://localhost:8080`` and JABAWS context path is *jabaws* +3. Alternately, you can point Jalview at your new server: + + 1. Launch the desktop version of `Jalview`_ + 2. Open the Jalview desktop's preferences panel (from the Tools->Preferences menu option), elect the Webservices panel and press the New Service URL button. + 3. Enter the URL for the tomcat server, including the context path for the JABAWS web app (e.g. http://localhost:8080/jabaws). + + +------------ + +.. _jabaws-va: + +Virtual Appliance (VA) +~~~~~~~~~~~~~~~~~~~~~~ + +.. warning:: The Virtual Appliance (VA) for JABAWS v2.2 will be provided soon. + +The Virtual Appliance (VA) package allows you to run a JABAWS server installed on `TurnKey Linux`_ as a virtual machine on your laptop or desktop computer. A complete guide to the JABAWS VA is given in the `VA documentation pages`_, but for the impatient, brief instructions are given below: + +If you work on Windows, Linux or Unix: + +1. Download `JABAWS Virtual Appliance`_ +2. Download and install `VMWare Player`_ +3. Unpack the JABAWS virtual appliance and open it with VMware Player + +If you work on Mac do the same using `VMware Fusion`_. + +**Testing** + +To check that your JABAWS virtual appliance is working visit the Services Status page available from the main JABAWS menu. For this enter the JABAWS URL for your new server into a web browser. This is shown once the appliance is booted up. + +Alternatively you can use Jalview to complete the testing. + +1. Launch the desktop version of `Jalview`_ +2. Open the Jalview desktop's preferences panel (from the Tools->Preferences menu option), select the ``Webservices`` panel and press the ``New Service URL`` button. +3. Enter the JABAWS URL for your new server. This is shown once the appliance is booted up. + + +.. links +.. _Jalview: http://www.jalview.org/ +.. _currently supported programs: included_tools.html +.. _JABAWS Virtual Appliance (VA): va.html +.. _JABAWS Web Application aRchive (WAR): war.html +.. _JABAWS Command Line Interface (CLI): client.html +.. _TurnKey Linux: https://www.turnkeylinux.org/tomcat +.. _DRMAA: http://www.drmaa.org/ +.. _University of Dundee: http://www.compbio.dundee.ac.uk/ +.. _Java: http://www.oracle.com/technetwork/java/javase/downloads/jre7-downloads-1880261.html +.. _Client Jar file: ../download.jsp#client +.. _documentation pages: develop.html#accessing-jabaws-from-your-program +.. _CLI documentation pages: client.html +.. _JABAWS WAR file: ../download.jsp#war +.. _Apache-Tomcat: http://tomcat.apache.org/download-80.cgi +.. _WAR documentation pages: war.html +.. _JABAWS Virtual Appliance: ../download.jsp#va +.. _VMWare Player: http://www.vmware.com/products/player +.. _VMWare Fusion: http://www.vmware.com/products/fusion/overview.html +.. _VA documentation pages: va.html diff --git a/website/docs/_sources/included_tools.rst.txt b/website/docs/_sources/included_tools.rst.txt new file mode 100644 index 0000000..22d6290 --- /dev/null +++ b/website/docs/_sources/included_tools.rst.txt @@ -0,0 +1,58 @@ +Included Tools +============== + +.. _msa: + +Multiple Sequence Alignment +--------------------------- + +* `Clustal Omega`_ (version 1.2.4) +* `ClustalW`_ (version 2.1) +* `Mafft`_ (version 7.310) +* `Muscle`_ (version 3.8.31) +* `T-coffee`_ (version 11.00.8cbe486) +* `Probcons`_ (version 1.12) +* `MSAProbs`_ (version 0.9.7) +* `GLProbs`_ (version 0.9.7) + + +.. _pdis: + +Protein Disorder Prediction +--------------------------- + +* `DisEMBL`_ (version 1.5) +* `IUPred`_ (version 1.0) +* Jronn - Java implementation of `Ronn`_ (version 3.1) +* `GlobPlot`_ (version 2.3) + +.. _aac: + +Amino Acid Conservation +----------------------- + +* `AACon`_ (version 1.0) + + +.. _rnass: + +RNA Secondary Structure +----------------------- + +* RNAalifold from `ViennaRNA`_ (version 2.0) + + +.. _Clustal Omega: http://www.clustal.org/omega +.. _ClustalW: http://www.clustal.org/clustal2 +.. _Mafft: http://align.bmr.kyushu-u.ac.jp/mafft/software/ +.. _Muscle: http://www.drive5.com/muscle +.. _T-coffee: http://www.tcoffee.org/Projects_home_page/t_coffee_home_page.html +.. _Probcons: http://probcons.stanford.edu/ +.. _MSAProbs: http://msaprobs.sourceforge.net/ +.. _GLProbs: http://sourceforge.net/projects/glprobs/ +.. _DisEMBL: http://dis.embl.de/ +.. _IUPred: http://iupred.enzim.hu +.. _Ronn: http://www.strubi.ox.ac.uk/RONN +.. _GlobPlot: http://globplot.embl.de/ +.. _AACon: http://www.compbio.dundee.ac.uk/aacon +.. _ViennaRNA: http://www.tbi.univie.ac.at/RNA diff --git a/website/docs/_sources/index.rst.txt b/website/docs/_sources/index.rst.txt new file mode 100644 index 0000000..e0a0729 --- /dev/null +++ b/website/docs/_sources/index.rst.txt @@ -0,0 +1,40 @@ +.. JABAWS documentation master file, created by + sphinx-quickstart on Thu Apr 6 13:57:23 2017. + You can adapt this file completely to your liking, but it should at least + contain the root `toctree` directive. + +Welcome to JABAWS's documentation! +================================== + +Read on these documentation pages or go back to the `JABAWS homepage`_! + +JABAWS documentation is also available in *pdf*. `Download it here`_! + + +.. _JABAWS homepage: ../ + + +.. toctree:: + :maxdepth: 3 + :caption: Contents: + + getting_started + included_tools + client + war + va + advanced + develop + stats + citations + changelog + + +------------ + +.. note:: This is an open source project. If you want to contribute or report an issue have a look at our `Git-tracker`_. + + +.. links +.. _Git-tracker: https://source.jalview.org/crucible/changelog/jabaws +.. _Download it here: ./jabaws_manual.pdf diff --git a/website/docs/_sources/man/advanced.rst.txt b/website/docs/_sources/man/advanced.rst.txt new file mode 100644 index 0000000..9c1f36e --- /dev/null +++ b/website/docs/_sources/man/advanced.rst.txt @@ -0,0 +1,471 @@ +Advanced Usage +============== + +JABAWS web services are WS-I basic profile compliant, which means they can be accessed using any programming language or system that can utilize standard SOAP web services. The Web Service Definition Language (WSDL) for each service is published on the JABAWS home page, and you can use this to automatically generate service bindings for your program. If you use Java you may wish to use our client package to access JABAWS. This package is based on the autogenerated source code produced by wsimport, which is the Java tool for creating web service bindings. In addition, this offers some additional methods that simplify working with JABAWS. For more information please refer to the data model javadoc. + + +------------ + +.. _jabaws_wsdl: + +Valid WSDL +---------- + +**Multiple sequence alignment services** + +* ClustalOWS - http://www.compbio.dundee.ac.uk/jabaws/ClustalOWS?wsdl +* ClustalWS - http://www.compbio.dundee.ac.uk/jabaws/ClustalWS?wsdl +* MuscleWS - http://www.compbio.dundee.ac.uk/jabaws/MuscleWS?wsdl +* MafftWS - http://www.compbio.dundee.ac.uk/jabaws/MafftWS?wsdl +* TcoffeeWS - http://www.compbio.dundee.ac.uk/jabaws/TcoffeeWS?wsdl +* ProbconsWS - http://www.compbio.dundee.ac.uk/jabaws/ProbconsWS?wsdl +* MSAprobsWS - http://www.compbio.dundee.ac.uk/jabaws/MSAprobsWS?wsdl +* GLprobsWS - http://www.compbio.dundee.ac.uk/jabaws/GLprobsWS?wsdl + +**Protein disorder prediction services** + +* IUPredWS - http://www.compbio.dundee.ac.uk/jabaws/IUPredWS?wsdl +* GlobPlotWS - http://www.compbio.dundee.ac.uk/jabaws/GlobPlotWS?wsdl +* DisemblWS - http://www.compbio.dundee.ac.uk/jabaws/DisemblWS?wsdl +* JronnWS - http://www.compbio.dundee.ac.uk/jabaws/JronnWS?wsdl + +**Amino acid conservation service** + +* AAConWS - http://www.compbio.dundee.ac.uk/jabaws/AAConWS?wsdl + +**RNA Secondary Structure Prediction** + +* RNAalifoldWS - http://www.compbio.dundee.ac.uk/jabaws/RNAalifoldWS?wsdl + + +Please replace http://www.compbio.dundee.ac.uk/ with your JABAWS instance host name, and jabaws with your JABAWS context name to access your local version of JABAWS web services. For example http://localhost:8080/jabaws would be a valid URL for the default Apache-Tomcat installation and jabaws.war file deployment. + + +------------ + +.. _jabaws_config: + +JABAWS Configuration +-------------------- + +There are three parts of the system you can configure. The local and the cluster engines, and the paths to the individual executables for each engine. These settings are stored in configuration files within the web application directory (for an overview, then take a look at the war file content table) [link]. + +Initially, JABAWS is configured with only the local engine enabled, with job output written to directory called "jobsout" within the web application itself. This means that JABAWS will work out of the box, but may not be suitable for serving a whole lab or a university. + + +------------ + +.. _jabaws_config_le: + +Local Engine Configuration +~~~~~~~~~~~~~~~~~~~~~~~~~~ + +The Local execution engine configuration is defined in the properties file ``conf/Engine.local.properties``. The supported configuration settings are: + +``engine.local.enable=true`` - enable or disable local engine, valid values true | false + +``local.tmp.directory=D:\\clusterengine\\testoutput`` - a directory to use for temporary files storage, optional, defaults to java temporary directory + +``engine.local.thread.number=4`` - Number of threads for tasks execution (valid values between 1 and 2x cpu. Where x is a number of cores available in the system). Optional defaults to the number of cores for core number <=4 and number of cores-1 for greater core numbers. + +If the local engine going to be heavily loaded (which is often the case if you do not have a cluster) it is a good idea to increase the amount of memory available for the web application server. If you are using Apache-Tomcat, then you can define its memory settings in the JAVA_OPTS environment variable. To specify which JVM to use for Apache-Tomcat, put the full path to the JRE installation in the JAVA_HOME environment variable. (We would recommend using Sun Java Virtual Machine (JVM) in preference to Open JDK). Below is an example of code which can be added to ``<tomcat_dir>/bin/setenv.sh`` script to define which JVM to use and a memory settings for Tomcat server. Tomcat server startup script (``catalina.sh``) will execute ``setenv.sh`` on each server start automatically. + +.. code:: bash + + export JAVA_HOME=/homes/ws-dev2/jdk1.6.0_17/ + export JAVA_OPTS="-server -Xincgc -Xms512m -Xmx1024m" + + +------------ + +.. _jabaws_config_ce: + +Cluster Engine Configuration +~~~~~~~~~~~~~~~~~~~~~~~~~~~~ + +Supported configuration settings: + +``engine.cluster.enable=true`` - enable or disable local engine true | false, defaults to false + +``cluster.tmp.directory=/homes/clustengine/testoutput`` - a directory to use for temporary files storage. The value must be an absolute path to the temporary directory. This is required. The value must be different from what is defined for local engine. This directory must be accessible from all cluster nodes. + +For the cluster engine to work, the SGE_ROOT and LD_LIBRARY_PATH environment variables have to be defined. They tell the cluster engine where to find DRMAA libraries. These variables should be defined when the web application server starts up, e.g. + +.. code:: bash + + SGE_ROOT=/gridware/sge + LD_LIBRARY_PATH=/gridware/sge/lib/lx24-amd64 + +Finally, do not forget to configure executables for the cluster execution, they may be the same as for the local execution but may be different. Please refer to the executable configuration section for further details. + + +------------ + +.. _jabaws_config_ec: + +Executable Configuration +~~~~~~~~~~~~~~~~~~~~~~~~ + +All the executable programs are configured in conf/Executable.properties file. Each executable is configured with a number of options. They are: + +.. code:: bash + + local.X.bin.windows=<path to executable under windows system, optional> + local.X.bin=<path to the executable under non-windows system, optional> + cluster.X.bin=<path to the executable on the cluster, all cluster nodes must see it, optional> + X.bin.env=<semicolon separated list of environment variables for executable, use hash symbol as name value separator, optional> + X.--aamatrix.path=<path to the directory containing substitution matrices, optional> + X.presets.file=<path to the preset configuration file, optional> + X.parameters.file=<path to the parameters configuration file, optional> + X.limits.file=<path to the limits configuration file, optional> + X.cluster.settings=<list of the cluster specific options, optional> + +Where X any of the bioinformatics tools available (e.g. clustalw, muscle, mafft, probcons, t-coffee, etc.). + +Default JABAWS configuration includes path to local executables to be run by the local engine only, all cluster related settings are commented out, but they are there for you as examples. Cluster engine is disabled by default. To configure executable for cluster execution uncomment the X.cluster settings and change them appropriately. + +By default limits are set well in excess of what you may want to offer to the users outside your lab, to make sure that the tasks are never rejected. The default limit is 100000 sequences of 100000 letters on average for all of the JABA web services. You can adjust the limits according to your needs by editing ``conf/settings/<X>Limit.xml`` files. +After you have completed the editing your configuration may look like this: + +.. code:: bash + + local.mafft.bin=binaries/mafft + cluster.mafft.bin=/homes/cengine/mafft + mafft.bin.env=MAFFT_BINARIES#/homes/cengine/mafft;FASTA_4_MAFFT#/bin/fasta34; + mafft.--aamatrix.path=binaries/matrices + mafft.presets.file=conf/settings/MafftPresets.xml + mafft.parameters.file=conf/settings/MafftParameters.xml + mafft.limits.file=conf/settings/MafftLimits.xml + mafft.cluster.settings=-q bigmem.q -l h_cpu=24:00:00 -l h_vmem=6000M -l ram=6000M + +Please not that relative paths must only be specified for the files that reside inside web application directory, all other paths must be supplied as absolute! + +Furthermore, you should avoid using environment variables within the paths or options - since these will not be evaluated correctly. Instead, please explicitly specify the absolute path to anything normally evaluated from an environment variable at execution time. + +If you are using JABAWS to submit jobs to the cluster (with cluster engine enabled), executables must be available from all cluster nodes the task can be sent to, also paths to the executables on the cluster e.g. ``cluster.<exec_name>.bin`` must be absolute. + +Executables can be located anywhere in your system, they do not have to reside on the server as long as the web application server can access and execute them. + +Cluster settings are treated as a black box, the system will just pass whatever is specified in this line directly to the cluster submission library. This is how DRMAA itself treats this settings. More exactly DRMAA ``JobTemplate.setNativeSpecification()`` function will be called. + +For further details and examples of configuration please refer to the ``Executable.properties`` file supplied with JABAWS. + + +------------ + +.. _jabaws_config_env_exe: + +Defining Environment Variables for Executables +~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ + + +Environment variables can be defined in property + +.. code:: bash + + x.bin.env + +Where x is one of thw executables supported by JABAWS. Several environment variables can be specified in the same line. For example. + +.. code:: bash + + mafft.bin.env=MAFFT_BINARIES#/homes/cengine/mafft;FASTA_4_MAFFT#/bin/fasta34; + +The example above defines two environment variables with names ``MAFFT-BINARIES`` and ``FASTA_4_MAFFT`` and values ``/homes/cengine/mafft and /bin/fasta34`` respectively. Semicolon is used as a separator between different environment variables whereas hash is used as a separator for name and value of the variable. + + +------------ + +.. _jabaws_config_env_mafft: + +Configure JABAWS to Work with Mafft +~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ + + +If you use default configuration you do not need to read any further. The default configuration will work for you without any changes, however, if you want to install Mafft yourself then there is a couple of more steps to do. + +Mafft executable needs to know the location of other files supplied with Mafft. In addition some Mafft functions depends on the fasta executable, which is not supplied with Mafft, but is a separate package. Mafft needs to know the location of fasta34 executable. + +To let Mafft know where the other files from its package are, change the value of MAFFT-BINARIES environment variables. To let Mafft know where is the fasta34 executable set the value of FASTA_4_MAFFT environment variable to point to a location of fasta34 program. The latter can be added to the PATH variable instead. If you are using executables supplied with JABAWS, the path to Mafft binaries would be like ``<relative path to web application directory>/binaries/src/mafft/binaries`` and the path to fasta34 binary would be ``<relative path to web application directory>/binaries/src/fasta34/fasta34``. You can specify the location of Mafft binaries as well as fasta34 program elsewhere by providing an absolute path to them. All these settings are defined in ``conf/Executable.properties`` file. + + +------------ + +.. _jabaws_config_env_limit: + +Limiting the size of the job accepted by JABAWS +~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ + +JABAWS can be configured to reject excessively large tasks. This is useful if you operate JABAWS service for many users. By defining a maximum allowed task size you can provide an even service for all users and prevents waste of resources on the tasks too large to complete successfully. You can define the maximum number of sequences and the maximum average sequence length that JABAWS accepts for each JABA Web Service independently. Furthermore, you can define different limits for different presets of the same web service. + +By default limits are disabled. You can enable them by editing ``conf/Executable.properties`` file. You can adjust the limits according to your needs by editing ``conf/settings/<X>Limit.xml`` files. + + +.. _war_precompiled_bin: + +Pre-compiled binaries +~~~~~~~~~~~~~~~~~~~~~ + +.. danger:: improve this bit + + +Using a different version of the alignment program with JABAWS + +JABAWS is supplied with binaries and source code of the executables related to the version it supports. So normally you would not need to install your own executables. However, if you have a different version of an executable (e.g. an alignment program) which you prefer, you could use it as long as it supports all the functions JABAWS executable require. This could be the case with more recent executable. If the options supported by your chosen executable is different from the standard JABAWS executable, then you need to edit ExecutableNameParamaters.xml configuration file. + + +JABAWS comes with pre-compiled x86 Linux binaries, thus on such systems JABAWS should work straight out of the box. If you are in any doubts or experience problems you may want to make sure that the binaries supplied work under your OS. To do this just execute each binary, without any command line options or input files. If you see an error message complaining about missing libraries or other problems, then you probably need to recompile the binaries [link]. + +You can try the JABAWS functionality with the JABAWS test client or have a look at deploying on Tomcat [link] tips if you experience any problems. + +.. note:: You may want to enable logging, as described here [link]. + + +JABAWS's web services use command line programs to do the actual analysis, so it must have access to programs which can be executed on your platform. The native executables bundled with JABAWS for Windows (32-bit) and Linux (i386, 32-bit) should be OK for those systems. The source code for these programs is also provided so you can recompile for your own architecture [link] and exploit any optimizations that your system can provide. Alternately, if you have already got binaries on your system, then you can simply change the paths in JABAWS's configuration files [link] so these are used instead. + +------------ + +.. _war_recompile_bin: + +Recompiling binaries for your system +~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ + +If you have a fully equipped build environment on your (POSIX-like) system, then you should be able to recompile the programs from the source distributions which are included in the JABAWS war file. A script called 'compilebin.sh' is provided to automate this task. + +1. In a terminal window, change the working directory to ``binaries/src`` +2. Execute the compilebin.sh script: + + .. code:: bash + + chmod +x compilebin.sh; compilebin.sh > compilebin.out; +3. Then run: + + .. code:: bash + + chmod +x setexecflag.sh; sh setexecflag.sh + + If any of the binaries was not recompiled, then a 'file not found' error will be raised. + +4. Finally, restart your Tomcat server (or JABAWS application only), and test JABAWS [link] to check that it can use the new binaries. + + +If you couldn't compile everything, then it may be that your system does not have all the tools required for compiling the programs. At the very least check that you have gcc, g++ and make installed in your system. If not install these packages and repeat the compilation steps again. You should also review the compilebin.sh output - which was redirected to compilebin.out, and any errors output to the terminal. Finally, try obtaining the pre compiled binaries [link] for your OS. + + +------------ + +.. _war_reusing_bin: + +Obtaining or reusing binaries +~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ + +You could search for pre-packaged compiled executable in your system package repository or alternately, download pre-compiled binaries from each alignment program's home page. Then, either replace the executables supplied with the downloaded ones, or modify the paths defined in ``executable.properties`` as described below. +.. Below are some suggestions on where you may be able to get the binaries for your system. + +If you would like to use the binaries you already have, then you just need to let JABAWS know where they are. To do this, edit: ``conf/Executable.properties`` + +When specifying paths to executables that already exist on your system, make sure you provide an absolute path, or one relative to the JABAWS directory inside webapps. For example, the default path for clustalw is defined as ``local.clustalw.bin=binaries/src/clustalw/src/clustalw2`` Alternatively, instead of changing ``Executable.properties`` you could also replace the executables bundled with JABAWS with the ones that you have, or make symbolic links to them. Then the default configuration will work for you. More information about the Executable.properties file is given in the JABAWS Configuration page. + + +------------ + +.. _jabaws_config_lb: + +Load balancing +-------------- + +If your cluster is busy and has significant waiting times, you can achieve a faster response by allowing the server machine to calculate small tasks and then reserve the cluster for bigger jobs. This works especially well if your server is a powerful machine with many CPUs. To do this you need to enable and configure both the cluster and the local engines. Once this is done decide on the maximum size of a task to be run on the server locally. Then, edit "# LocalEngineExecutionLimit #" preset in ``<ServiceName>Limits.xml`` file accordingly. JABAWS server then will balance the load according to the following rule: If the task size is smaller than the maximum task size for local engine, and the local engine has idle threads, then it calculates task locally otherwise it submit the task to the cluster. + + +------------ + +.. _war_testing: + +Testing the JABAWS Server +------------------------- + +.. danger:: improve this bit + +Access ``<your_JABAWS_server_URL>/ServiceStatus`` to test all web services. Each time you access this URL, all services are tested. For production configuration we recommend prohibiting requests to this URL for non authenticated users to prevent excessive load on the server. + +Alternatively, you can use a command line client (part of the client only package) to test your JABAWS installation as described here. If you downloaded a JABAWS server package, you can use ``<your_jaba_context_name>/WEB-INF/lib/jaba-client.jar`` to test JABAWS installation as described here. If you downloaded the source code, then you could run a number of test suites defined in the build.xml Apache Ant file. + + +First of all make sure that Tomcat server is started successfully. If this was the case, then you should see JABAWS home page when you navigate to your Tomcat JABAWS context path in your browser (e.g. at ``http://myhost.compbio.ac.uk:8080/jabaws`` => ``<jabaws_server>``) + +If you see it, then it is time to make sure that web services are working too. The easiest way to do this is to access Services Status page available from the main JABAWS web page menu. + +If you need to monitor web service health automatically when the best option is to use service checker that responds with the standard HTTP status code. To access this checker use the following URL: + +**Using JABAWS service status checker** + +If you see it, then it is time to make sure that web services are working too. The easiest way to do this is to access Services Status page available from the main JABAWS web page menu. + +If you need to monitor web service health automatically when the best option is to use service checker that responds with the standard HTTP status code. To access this checker use the following URL: ``<jabaws-server>/HttpCodeResponseServiceStatus`` or alternatively ``<jabaws-server>/man_serverwar.jsp`` + +This page returns code 200, and no page context if all services are operational, 503 if one of the services have problems. You can also check each web service individually by providing the name of the web service to check at the end of the service checker URL like this: ``<jabaws_server>/HttpCodeResponseServiceStatus/ClustalWS`` + + +Upon request, the service status checker will examine the health of the ClustalWS web service only. If the service name is not valid, then the service checker will return code 400. + +**Using command line client** + +Alternatively, you should be able to use the test program which can be found in ``<webapplicationpath>/WEB-INF/lib/jabaws-client.jar`` file. To run the tests type: + +.. code:: bash + + java -jar jabaws-client.jar -h=<Your web application server host name, port and JABAWS context path> + +For example to test all JABAWS web services on host myhost.compbio.ac.uk type: + +.. code:: bash + + java -jar jabaws-client.jar -h=http://myhost.compbio.ac.uk:8080/jabaws + + +You can choose a particular web server using -s option like this java -jar jabaws-client.jar -h=http://myhost.compbio.ac.uk:8080/jabaws -s=ClustalWS This command line assumes that java executable is in your path and jabaws-client.jar is located in the current directory. + +An example of the report testing tool produces for operating web service looks like this: + +.. code:: bash + + Connecting to service MuscleWS on http://myhost.compbio.ac.uk:8080/jabaws ... OK + Testing alignment with default parameters: + Queering job status...OK + Retrieving results...OK + Testing alignment with presets: + Aligning with preset 'Protein alignment(Fastest speed)'... OK + Aligning with preset 'Nucleotide alignment(Fastest speed)'... OK + Aligning with preset 'Huge alignments (speed-oriented)'... OK + Queering presets...OK + Queering Parameters...OK + Queering Limits...OK + Queering Local Engine Limits...OK + Check is completed service MuscleWS IS WORKING + +An example of the response of a web service which is deployed but is not operating is below: + +.. code:: bash + + Connecting to service ProbconsWS on http://localhost:8080/ws ... OK + Testing alignment with default parameters:FAILED + Service ProbconsWS IS NOT FUNCTIONAL + + +If the web server did not respond the message looks like following: + +.. code:: bash + + Connecting to service TcoffeeWS on http://localhost:8080/ws ... FAILED + + +------------ + +.. _war_logging: + +JABAWS internal logging +----------------------- + +JABAWS can be configured to log what it is doing. This comes in handy if you would like to see who is using your web services or need to chase some problems. JABAWS uses log4j to do the logging, the example of log4j configuration is bundled with JABAWS war file. You will find it in the ``/WEB-INF/classes/log4j.properties`` file. All the lines in this file are commented out. The reason why the logging is disabled by default it simple, log4j has to know the exact location of where the log files are stored. This is not known up until the deployment time. To enable the logging you need to define logDir property in the log4j.properties and uncomment section of the file which corresponds to your need. More information is given in the log4j.properties file itself. Restart the Tomcat or the JABAWS web application to apply the settings. + +After you have done this, assuming that you did not change the log4j.properties file yourself, you should see the application log file called activity.log. The file called activity.log. The amount of information logged can be adjusted using different logging levels, it is reduced in the following order of log levels TRACE, DEBUG, INFO, WARN, ERROR, FATAL. + +If you would like to know who is using your services, you might want to enable Tomcat request logging. + +------------ + +.. _war_logging_req: + +JABAWS requests logging +~~~~~~~~~~~~~~~~~~~~~~~ + +Enable Tomcat log valve. To do this uncomment the following section of <tomcat_root>/conf/server.xml configuration file. + +.. code-block:: xml + + <Valve className="org.apache.catalina.valves.AccessLogValve" directory="logs" + prefix="localhost_access_log." suffix=".txt" pattern="common" resolveHosts="false"/> + + +The following information will be logged: + ++--------------+------------------------------+-------------------------------+---------------+------------------------+ +| Remote IP | Date | Method server_URL protocol | HTTP status | Response size in bytes | ++==============+==============================+===============================+===============+========================+ +| 10.31.11.159 | [10/Feb/2010:16:51:32 +0000] | "POST /jws2/MafftWS HTTP/1.1" | 200 | 2067 | ++--------------+------------------------------+-------------------------------+---------------+------------------------+ + +Which can be processed in various programs for log analysis, such as WebAlizer, Analog, AWStats [links]. + + +------------ + +.. _jabaws_config_ga: + +JABAWS and Google Analytics +--------------------------- + + +JABAWS reports web services usage to our group Google Analytics (GA) account. JABAWS usage statistics are collected for funding and reporting purposes, and no private information is collected. The data sent by JABAWS is as follows: + +1. The IP address of the JABAWS server machine (the server IP can anonymized see ``conf/GA.properties`` config file) +2. The name of the web service that was called. +3. A few details of the system such as JABAWS version, java version, user language, color depth, screen resolution and character encoding. + +Google Analytics can be disabled or adjusted by removing/editing ``conf/GA.properties`` Google Analytics (GA) settings file. We would appreciate it greatly if you could leave it on! + +All calls to GA are very lightweight, completed asynchronously, create very little overhead and do not influence the server response time or performance. + + +------------ + +.. _war_contents: + +JABAWS War File Content +----------------------- + ++---------------------+----------------------------------------------------------------------------------------------------------------------------------------------------------+ +| Directory | Content description | ++=====================+==========================================================================================================================================================+ +| conf/ contains | configuration files such as Executable.properties, Engine.local.properties, Engine.cluster.properties | ++---------------------+----------------------------------------------------------------------------------------------------------------------------------------------------------+ +| conf/settings | Contains individual executable description files. In particular XXXParameters.xml, XXXPresets.xml, XXXLimits.xml where XXX is the name of the executable | ++---------------------+----------------------------------------------------------------------------------------------------------------------------------------------------------+ +| ExecutionStatistics | The database for storing the execution statistics | ++---------------------+----------------------------------------------------------------------------------------------------------------------------------------------------------+ +| statpages | Web pages for usage statistics visialization and webservices status queries | ++---------------------+----------------------------------------------------------------------------------------------------------------------------------------------------------+ +| jobsout/ | Contains directories generated when running an individual executable. E.g. input and output files and some other task related data (optional) | ++---------------------+----------------------------------------------------------------------------------------------------------------------------------------------------------+ +| binaries/ | Directory contains native executables - programs, windows binaries (optional) | ++---------------------+----------------------------------------------------------------------------------------------------------------------------------------------------------+ +| binaries/src | Contains source of native executables and Linux i386 binaries | ++---------------------+----------------------------------------------------------------------------------------------------------------------------------------------------------+ +| binaries/windows | Contains binaries for MS Windows operating system | ++---------------------+----------------------------------------------------------------------------------------------------------------------------------------------------------+ +| binaries/matrices | Substitution matrices | ++---------------------+----------------------------------------------------------------------------------------------------------------------------------------------------------+ +| WEB-INF | Web application descriptor | ++---------------------+----------------------------------------------------------------------------------------------------------------------------------------------------------+ +| WEB-INF/lib | Web application libraries | ++---------------------+----------------------------------------------------------------------------------------------------------------------------------------------------------+ +| WEB-INF/classes | log4j.properties - log configuration file (optional) | ++---------------------+----------------------------------------------------------------------------------------------------------------------------------------------------------+ +| static | Static content such as CSS, JavaScript and Image files | ++---------------------+----------------------------------------------------------------------------------------------------------------------------------------------------------+ + ++---------------------+----------------------------------------------------------------------------------------------------------------------------------------------------------+ +| **Help Pages** | | ++=====================+==========================================================================================================================================================+ +| / | help pages, index.html is the starting page | ++---------------------+----------------------------------------------------------------------------------------------------------------------------------------------------------+ +| `dm_javadoc`_ | JavaDoc for the JABAWS Data Model | ++---------------------+----------------------------------------------------------------------------------------------------------------------------------------------------------+ +| `full_javadoc`_ | JavaDoc for the complete JABAWS | ++---------------------+----------------------------------------------------------------------------------------------------------------------------------------------------------+ +| `prog_docs`_ | Documentation for programs that are included in JABAWS | ++---------------------+----------------------------------------------------------------------------------------------------------------------------------------------------------+ + +.. _dm_javadoc: http://www.compbio.dundee.ac.uk/jabaws/dm_javadoc/index.html +.. _full_javadoc: http://www.compbio.dundee.ac.uk/jabaws/full_javadoc/index.html +.. _prog_docs: http://www.compbio.dundee.ac.uk/jabaws/prog_docs/ diff --git a/website/docs/_sources/man/changelog.rst.txt b/website/docs/_sources/man/changelog.rst.txt new file mode 100644 index 0000000..37135b7 --- /dev/null +++ b/website/docs/_sources/man/changelog.rst.txt @@ -0,0 +1,90 @@ +Changelog +========= + + +.. _v2.2: + +Version 2.2 (Released XX April 2017) +------------------------------------ + +The website and documentation were improved: + +* `Sphinx`_ is now used to generate our documentation pages. +* Documentation was updated to reflect the latest changes introduced in the project. +* Downloading the JABAWS distributions no longer require 'sign in' or 'sign up' to a user account. +* The pre-configured JABAWS Amazon Machine Image (AMI), which allowed for JABAWS to be run in the Amazon EC2 cloud, is no longer provided due to very limited use by the scientific community peers. + +The versions of several application programs provided by JABAWS were bumped to the latest available. + +* Clustal Omega was updated to version 1.2.4 +* ClustalW was updated to version 2.1 +* Mafft was updated to version 7.3.10 +* T-Coffee was updated to version 11.00.8cbe486 +* Protein secondary structure prediction with Jpred (version 3.0.3) was dropped from the list of provided services, as the use of the dedicated Jpred REST API (Jpred 4) is encouraged and recommended. This is the version that is currently provided within Jalview 2.9 or later. + +.. note:: JABAWS version 2.2 is fully backward compatible with JABAWS v1.0 and v2.0. This means all JABAWS 1.0, 2.0, 2.0.1 and 2.1 clients should also be able to use JABAWS 2.2 services. + + +.. _Sphinx: http://www.sphinx-doc.org/en/stable/ + +------------ + +.. _v2.1: + +Version 2.1 (Released 1st Oct 2013) +----------------------------------- + +Several new web services are available in this version of JABAWS: + +* Two multiple sequence aligners (MSAprobs and GLprobs), both services return the standard Alignment object +* RNAalifoldWS returns RNAStructScoreManager, which is the standard ScoreManager objects with several additional methods +* JpredWS returns the JpredAligment object, which is the standard alignment with additional methods for extracting Jpred predictions. These predictions are supplied as additional sequences in the aligment + +Some bugs have been fixed and several improvements have been done: + +* WS status servlet returns version and some additional information on each web service +* a bug with path to help in the client +* Fix two bug with the Google Analytics library: no-stop due to running thread +* GoogleAnalytics gets proper JABAWS version + +------------ + +.. _v2.0.1: + +Version 2.0.1 (Released 2nd Jul 2013) +------------------------------------- + +JABAWS 2.0.1 includes several bug fixes and minor updates for JABAWS Version 2.0. These are listed below: + +* Disembl returned swapped strings for HOTLOOPS and REM465 +* Jronn failed to process jobs with more than 3 sequences +* JABAWS could not deal with FASTA records with '>' symbols in the record identificator +* Change of parameter description for AAcon: parameters have been replaced with options for calculation methods. This allows a user to get several AAcon's conservation scores in one call +* JABAWS never cleaned up job directories. Now JABAWS deletes the job directory if it exist longer than a period defined in Engine.properties +* Default web security has been incompatible with Tomcat 7.0.31 and newer +* Documentation has been updated + +------------ + +.. _v2.0: + +Version 2 (Released 16th Dec 2011) +---------------------------------- + +Compared to JABAWS 1, JABAWS 2 offers a greater number and diversity of web services, Amazon EC2 integration and improved ease of use. + +It now contains: + +* Updates for all multiple sequence alignment services +* Four new protein disorder prediction services +* Clustal Omega multiple sequence alignment web service +* Amino acid conservation service +* Web services execution statistics visualization +* Web services status check from a web page +* VirtualBox support was dropped in favour of VMware +* New WAR package for Mac users +* Amazon Machine Image (AMI) distributive to enable users to use JABAWS on the EC2 cloud +* Improved web services client API +* Simplified WAR package installation + +.. warning:: To access the analysis web services introduced in JABAWS 2.0, clients that were designed for JABAWS v1.0 must be updated. diff --git a/website/docs/_sources/man/citations.rst.txt b/website/docs/_sources/man/citations.rst.txt new file mode 100644 index 0000000..2dfcfc3 --- /dev/null +++ b/website/docs/_sources/man/citations.rst.txt @@ -0,0 +1,11 @@ + +Citations +========= + +.. Note:: It is important that you cite JABAWS when you use it. Citing us helps us funding the work we do and allow us to continue to improve the project further. + +.. _citations: + +Peter V. Troshin, James B. Procter and Geoffrey J. Barton - **Java Bioinformatics Analysis Web Services for Multiple Sequence Alignment - JABAWS:MS** Bioinformatics 2011. 27 (14): 2001-2002. doi: `10.1093/bioinformatics/btr304`_ + +.. _10.1093/bioinformatics/btr304: https://doi.org/10.1093/bioinformatics/btr304 diff --git a/website/docs/_sources/man/client.rst.txt b/website/docs/_sources/man/client.rst.txt new file mode 100644 index 0000000..83ddca3 --- /dev/null +++ b/website/docs/_sources/man/client.rst.txt @@ -0,0 +1,106 @@ +Command Line Client (CLI) +========================= + +A JABAWS client is a Java application that lets you run the programs for which a JABAWS server provides web services. The most basic JABAWS client is a command line application this is able to call any of the JABAWS web services on any instance of JABAWS Server available over the web. The basic client is useful if you would like to test or execute the programs provided by the JABAWS server in your own scripts, but you do not want to handle any web service specific details. The client is an open source software, so you can also use the source code to as an example how to manipulate with JABAWS web services in your own code. Jalview [link], a multiple sequence alignment and analysis application, is a good example of a graphical JABAWS client. This client uses the same functionality as the JABAWS command line (CLI) client [link], but instead allows JABAWS services to be accessed in a more user-friendly manner, through a graphical user interface. + +The command line client comes as a part of client package [link] which you are welcome to download. The command line client can be used to align sequences using any of JABAWS supported web services. The client is OS independent and supports most of the functions which can be accessed programmatically via JABAWS API [link]. Using this client you could align sequences using presets or custom parameters, please see examples of this below. Here is the list of options supported by the command line client. + + +------------ + +.. _client_installing: + +Installing +---------- + +.. danger:: update for java + +You need Java vX or higher installed in your machine to be able to run the JABAWS CLI client. +Please see the Java web site [link] for up to date instructions and downloads. + + +------------ + +.. _cli_usage: + +Usage +----- + +.. code:: bash + + java -jar jaba-client.jar + +:: + + Usage: + java -jar <path_to_jar_file> -h=host_and_context -s=serviceName ACTION [OPTIONS] + -h=<host_and_context> - a full URL to the JABAWS web server including context path e.g. http://10.31.10.159:8080/ws + -s=<ServiceName> - one of [MafftWS, MuscleWS, ClustalWS, ClustalOWS, TcoffeeWS, ProbconsWS, AAConWS, JronnWS, DisemblWS, GlobPlotWS, IUPredWS] + + + ACTIONS: + -i=<inputFile> - full path to fasta formatted sequence file, from which to align sequences + -parameters - lists parameters supported by web service + -presets - lists presets supported by web service + -limits - lists web services limits + Please note that if input file is specified other actions are ignored + + + OPTIONS: (only for use with -i action): + -r=<presetName> - name of the preset to use + -o=<outputFile> - full path to the file where to write an alignment + -f=<parameterInputFile> - the name of the file with the list of parameters to use. + + Please note that -r and -f options cannot be used together. Alignment is done with either preset or aparameters from the file, but not both! + + +------------ + +.. _cli_example: + +Example Usage +------------- + + +Align sequences from input.fasta file using Mafft web service with default settings, print alignment in Clustal format to console. + +.. code:: bash + + java -jar jabaws-min-client.jar -h=http://myhost.compbio.ac.uk:8080/jabaws -s=MafftWS -i=d:\input.fasta + +Content of input.fasta file is show below (please note sequences has been trimmed for clarity) + +:: + + >Foobar + MTADGPRELLQLRAAVRHRPQDFVAWL + >Bar + MGDTTAGEMAVQRGLALHQ + >Foofriend + MTADGPRELLQLRAAV + +Align as in above example, but write output alignment in a file out.clustal, using parameters defined in prm.in file + +.. code:: bash + + java -jar jabaws-min-client.jar -h=http://myhost.compbio.ac.uk:8080/jabaws -s=MafftWS -i=d:\input.fasta -o=d:\out.clustal -f=prm.in + +The content of the prm.in file is shown below + +:: + + --nofft + --noscore + --fastaparttree + --retree=10 + --op=2.2 + +The format of the file is the same for all JABAWS web services. Parameters are specified in exactly the same way as for native executables - alignment programs like Mafft etc. So parameters which you can use with command line version of an alignment program can be used with JABAWS. Most of the settings controlling alignment process are supported, but because any output has to be handled by JABAWS, settings controlling output are not allowed to be changed. For a list of parameters supported by a web service see the next example. In prm.in parameters are separated by the new line, and name of the parameter is separated from its value with an equals sign. This format is constant no matter which JABAWS web service is used. + +.. code:: bash + + java -jar jabaws-min-client.jar -h=http://myhost.compbio.ac.uk:8080/jabaws -s=MafftWS -parameters + +The same client can be used to access JABAWS on different hosts. Just point the client to the host you want to use by changing the value of -h key. + +For example you used ``-h=http://myhost.compbio.ac.uk:8080/jabaws`` server, now you want to use another server to ``-h=http://mylabserver.myuni.edu``. This comes handy if your favorite server is off and you need to do the job yesterday. diff --git a/website/docs/_sources/man/develop.rst.txt b/website/docs/_sources/man/develop.rst.txt new file mode 100644 index 0000000..ca87e99 --- /dev/null +++ b/website/docs/_sources/man/develop.rst.txt @@ -0,0 +1,625 @@ +For Developers +============== + +.. _jabaws_source: + +Source Code +----------- + +.. note:: This is an open source project. If you want to contribute or report an issue have a look at our `Git-tracker`_. + +Publicly available Git repository: http://source.jalview.org/gitweb/?p=jabaws.git + +.. code:: bash + + git clone http://source.jalview.org/git/jabaws.git + + +------------ + +.. _jabaws_api: + +The API +------- + +`Data Model JavaDoc`_ - read this if your are coding against JABA Web Services + +`Complete JavaDoc`_ - for developers who want to use JABAWS framework and use Engines and Executables directly + + +------------- + +.. _jabaws_structure: + +Structure of the project +------------------------ + +| |folder| *binaries* contains native executables e.g. clustalw +| |folder| *src* contains sources of native executables +| |folder| *windows* contains pre-compiled Windows binaries +| |folder| *compilebin.sh* the script to complile binaries +| |folder| *setexecflag.sh* the script to set executable flag for the binaries +| |folder| *conf* contains JABAWS configuration files +| |folder| *ExecutionStatistics* the database for storing collected execution statistics +| |folder| *jobsout* a default folder for temporary job directories +| |folder| *statpages* the web pages for execution statistics display +| |folder| *WEB-INF* default +| |folder| *website* contains the JABAWS web pages +| |folder| *archive* contains JABAWS packages, the WAR and JAR files +| |folder| *datamodel* contains the JABAWS datamodel +| |folder| *engine* contains the JABAWS engine - the code that abstract the execution environment and executes native binaries +| |folder| *runner* contains the JABAWS runners - thin wrappers for native binaries +| |folder| *webservices* contains the JABAWS SOAP web services +| |folder| *testsrc* contains the JABAWS unit tests + + +------------ + +.. _jabaws_code: + +The code structure +------------------ + +.. image:: ../../website/static/img/ws-structure.png + :height: 414 + :width: 282 + :scale: 95 % + :align: left + + +Each source folder depends on the upper folders for compilation. For example, the datamodel is the top level folder so it has no other dependencies on other JABAWS code. The Engine level depends on the datamodel to compile etc. The web services folder is the bottom layer and depends on all the other source code. + +So the JABAWS project is split into 4 layers. From bottom-up the first layer consists from the value classes used by all other layers of the hierarchy, in particular web services. So, to be able to use JABAWS one needs to have these classes. At the same time classes on this layer does not have any dependencies on the layers above. + +The second layer contains code for execution of the wrappers, which are the abstraction describing native executables. JABAWS can execute tasks locally that is on the same machine as JVM and on the cluster. Thus currently code on this layer contain two engines. This layer depends on the layer underneath, the data model layer, but is completely independent from the code above. + +The third layer consists of the wrappers for the native executables and classes to handle their configuration. It depends on the engines and the data model, but know nothing about the web services. + +Finally, the upper layer contains the web services, that depend on all the layers below. + +The layer isolation is archived though specially designed compilation task which is executed sequentially in several stages so that the first layer compiles before any other layers, second layer compiles after that and process continies before all the code is compiled. Any violation of the layer boundaries results in the compilation failure. Use Ant "Compile" or "Complile_with_debug" tasks to perform the staged compilation. + +A client package contains only classes from data model layer and a simple web services client. Framework package is for anyone who want to use JABAWS framework for controlling native executables in local or cluster environments. Framework exclude the web services layer. Server package contains all the code. + + +------------ + +.. _jabaws_tests: + +Running tests +------------- + +JABAWS uses TestNG [test] framework for testing. The test results for the JABAWS package offered for download can be found at: Test Results [link] +JABAWS uses TestNG for testing. There is a TestNG plugin available for Eclipse which has functionality similar to JUnit. However, no plugins are necessary to run the test cases, as testng jar is supplied with JABAWS together with an ant tasks to run the test cases. + + +Several testing groups are supported: + +* All tests ('Test') +* Cluster tests ('Run_cluster_dependent_test') +* Cluster independent tests ('All_cluster_independent_tests') +* Windows only tests ('All_cluster_independent_windows_only_tests') +* Performance and stability tests ('Long_tests') +* Re-run failed tests ('Rerun_failed_tests') +* Run custom test ('CustomTest') + +To run the tests you need to download all sources from repository [link]. Once you have done that, enter into the command line mode, change directory to the project directory and type: + +.. code:: bash + + ant -f build.xml <test group name> + + +Make sure you have Apache Ant [link] installed and path to ant executable is defined in your path environmental variable. Replace test group name with the one of the names given in the list above to run required group of tests e.g for running cluster only tests use the following command: + +.. code:: bash + + ant -f build.xml Run_cluster_dependent_test + + +If you work under Linux you could use a simple script from the root folder of repository called ``runtests.sh``. This script simply contains a collection of the test commands described above and paths to java home directory and an ant executable, which you can define once for your system and then reuse. + +A handy feature of TestNG is its ability to re-run failed tests. Failed test ant file is stored in ``test-output/testng-failed.xml``. and is used in the ant task called ``Rerun_failed_tests``. So re-running failed tests requires no more work than running any other test group and could be accomplished with the command: + +.. code:: bash + + ant -f build.xml Rerun_failed_tests + + +CustomTest runs the test defined in the project root directory file called ``temp-testng-customsuite.xml``. This file is generated by TestNG plugin every time you run the test from Eclipse. Thus an easy way to run a test in a different environment is to run it from Eclipse first and then from ant using a custom test procedure. + +For cluster execution make sure that the property ``LD_LIBRARY_PATH`` defined in build.xml points to cluster engine LD libraries directory in your local system. + + +------------ + +.. _jabaws_conn_services: + +Accessing JABAWS from your program +---------------------------------- + +.. _jabaws_conn_functions: + +Web services functions overview +~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ + + +All JABAWS multiple sequence alignment web services comply to the same interface, thus the function described below are available from all the services. + +Functions for initiating the alignment + +.. code:: bash + + String id = align(List<FastaSequence> list) + String id = customAlign(List<FastaSequence> sequenceList, List<Option> optionList) + String id = presetAlign(List<FastaSequence> sequenceList, Preset preset) + +Functions pertaining to job monitoring and control + +.. code:: bash + + JobStatus status = getJobStatus(String id) + Alignment al = getResult(String id) + boolean cancelled = cancelJob(String id) + ChunkHolder chunk = pullExecStatistics(String id, long marker) + +Functions relating to service features discovery + +.. code:: bash + + RunnerConfig rc = getRunnerOptions() + Limit limit = getLimit(String name) + LimitsManager lm = getLimits() + PresetManager pm = getPresets() + +Please refer to a Data Model JavaDoc for a detailed description of each methods. + + +------------ + +.. _jabaws_conn_functions2: + +Structure of the template command line client +~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ + ++------------------------+------------------------------------------------------------------------+ +| Packages | Classes and Interfaces | ++========================+========================================================================+ +| compbio.data.msa | MsaWS the interface for all multiple sequence alignment web services | ++------------------------+------------------------------------------------------------------------+ +| compbio.data.sequence | JABAWS data types | ++------------------------+------------------------------------------------------------------------+ +| compbio.metadata | JABAWS meta data types | ++------------------------+------------------------------------------------------------------------+ +| compbio.ws.client | JABAWS command line client | ++------------------------+------------------------------------------------------------------------+ + +Additional utility libraries that this client depend upon is the compbio-util-1.3.jar and compbio-annotation-1.0.jar. + +Please refer to a Data Model JavaDoc [link] for a detailed description of each class and its methods. + + +------------ + +.. _jabaws_conn_conn: + +Connecting to JABAWS +~~~~~~~~~~~~~~~~~~~~ + +For a complete working example of JABAWS command line client please see compbio.ws.client.Jws2Client class. JABAWS command line client source code is available from the download page [link]. Please note that for now all the examples are in Java, other languages will follow if there is sufficient demand. + +Download a binary JABAWS client. Add the client to the class path. The following code excerpt will connect your program to Clustal web service deployed in the University of Dundee. + +.. code-block:: java + + import java.net.URL; + import javax.xml.namespace.QName; + import javax.xml.ws.Service; + // (...) + String qualifiedName = "http://msa.data.compbio/01/01/2010/"; + URL url = new URL("http://www.compbio.dundee.ac.uk/jabaws/ClustalWS?wsdl"); + QName qname = new QName(, "ClustalWS"); + Service serv = Service.create(url, qname); + MsaWS msaws = serv.getPort(new QName(qualifiedName, "ClustalWSPort"), + MsaWS.class); + +Line 1 makes a qualified name for JABA web services. + +Line 2 constructs the URL to the web services WSDL. + +Line 3 makes a qualified name instance for Clustal JABA web service. + +Line 4 creates a service instance. + +Line 5 makes a connection to the server. + +A more generic connection method would look like this + +.. code-block:: java + + import java.net.URL; + import javax.xml.namespace.QName; + import javax.xml.ws.Service; + import compbio.ws.client.Services + // (...) + String qualifiedServiceName = "http://msa.data.compbio/01/01/2010/"; + String host = "http://www.compbio.dundee.ac.uk/jabaws"; + // In real life the service name can come from args + Services clustal = Services.ClustalWS; + URL url = new URL(host + "/" + clustal.toString() + "?wsdl"); + QName qname = new QName(qualifiedServiceName, clustal.toString()); + Service serv = Service.create(url, qname); + MsaWS msaws = serv.getPort(new QName(qualifiedServiceName, clustal + "Port"), MsaWS.class); + + +Where Services is enumeration of JABAWS web services. All JABAWS multiple sequence alignment methods confirm to MsaWS specification, thus from the caller point of view all JABAWS web services can be represented by MsaWS interface. The full documentation of MsaWS functions is available from the JavaDoc [link]. + + +------------ + +.. _jabaws_conn_aln: + +Aligning Sequences +~~~~~~~~~~~~~~~~~~ + +Given that *msaws* is web service proxy, created as described in "Connecting to JABAWS" section, the actual alignment can be obtained as follows: + +.. code:: bash + + List<FastaSequence> fastalist = SequenceUtil.readFasta(new FileInputStream(file)); + String jobId = msaws.align(fastalist); + Alignment alignment = msaws.getResult(jobId); + Line one loads FASTA sequence from the file. + +Line two submits them to web service represented by msaws proxy. + +Line three retrieves the alignment from a web service. This line will block the execution until the result is available. Use this with caution. In general, you should make sure that the calculation has been completed before attempting retrieving results. This is to avoid keeping the connection to the server on hold for a prolonged periods of time. While this may be ok with your local server, our public server (www.compbio.dundee.ac.uk/jabaws) will not let you hold the connection for longer than 10 minutes. This is done to prevent excessive load on the server. The next section describes how to check the status of the calculation. +Methods and classes mentioned in the excerpt are available from the JABAWS client library. + + +------------ + +.. _jabaws_conn_status: + +Checking the status of the calculation +~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ + +You may have noticed that there was no pause between submitting the job and retrieving of the results. This is because getResult(jobId) method block the processing until the calculation is completed. However, taking into account that the connection holds server resources, our public server (www.compbio.dundee.ac.uk/jabaws) is configured to reset the connection after 10 minutes of waiting. To work around the connection reset you are encouraged to check whether the calculation has been completed before accessing the results. You can do it like this: + +.. code-block:: java + + while (msaws.getJobStatus(jobId) != JobStatus.FINISHED) { + Thread.sleep(2000); // wait two seconds, then recheck the status + } + + +------------ + +.. _jabaws_conn_aln_presets: + +Aligning with presets +~~~~~~~~~~~~~~~~~~~~~ + +.. code:: bash + + PresetManager presetman = msaws.getPresets(); + Preset preset = presetman.getPresetByName(presetName); + List<FastaSequence> fastalist = SequenceUtil.readFasta(new FileInputStream(file)); + String jobId = msaws.presetAlign(fastalist, preset); + Alignment alignment = msaws.getResult(jobId); + +Line one obtains the lists of presets supported by a web service. + +Line two return a particular Preset by its name. + +Lines three to five are doing the same job as in the first aligning sequences example [link]. + + +------------ + +.. _jabaws_conn_aln_params: + +Aligning with custom parameters +~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ + +.. code:: bash + + RunnerConfig options = msaws.getRunnerOptions(); + Argument matrix = options.getArgument("MATRIX"); + matrix.setValue("PAM300"); + Argument gapopenpenalty = options.getArgument("GAPOPEN"); + gapopenpenalty.setValue("20"); + List<Argument> arguments = new ArrayList<Argument>(); + arguments.add(matrix); arguments.add(gapopenpenalty); + List<FastaSequence> fastalist = SequenceUtil.readFasta(new FileInputStream(file)); + String jobId = msaws.customAlign(fastalist, arguments); + Alignment alignment = msaws.getResult(jobId); + +Line one obtains the ``RunnerConfig`` object that holds information on supported parameters and their values + +Line two retrieve a particular parameter from the holder by its name. + +Lines three sets a value to this parameter which will be used in the calculation. + +Line four and five do the same but for another parameter. + +Line six makes a List to hold the parameters. + +Line seven puts the parameters into that list. + +Line eight and ten is the same as in previous examples. + +Line nine submit an alignment request with the sequences and the parameters. + +The names of all the parameters supported by a web service e.g. "PAM300" can be obtained using ``options.getArguments()`` method. Further details on the methods available from ``RunnerConfig`` object are available from the JavaDoc. + + +------------ + +.. _jabaws_conn_aln_file: + +Writing alignments to a file +~~~~~~~~~~~~~~~~~~~~~~~~~~~~ + +There is a utility method in the client library that does exactly that. + +.. code-block:: java + + Alignment alignment = align(...) + FileOutputStream outStream = new FileOutputStream(file); + ClustalAlignmentUtil.writeClustalAlignment(outStream, align); + + +------------ + +.. _jabaws_conn_aln_example: + +A complete client example +~~~~~~~~~~~~~~~~~~~~~~~~~ + +Finally, a complete example of the program that connects to JABAWS Clustal service and aligns sequences using one of the Clustal web service presets. All you need for this to work is a JABAWS binary client [link]. Please make sure that the client is in the Java class path before running this example. + +.. code-block:: java + + import java.io.ByteArrayInputStream; + import java.io.FileNotFoundException; + import java.io.IOException; + import java.net.URL; + import java.util.List; + + import javax.xml.namespace.QName; + import javax.xml.ws.Service; + + import compbio.data.msa.MsaWS; + import compbio.data.sequence.Alignment; + import compbio.data.sequence.FastaSequence; + import compbio.data.sequence.SequenceUtil; + import compbio.metadata.JobSubmissionException; + import compbio.metadata.LimitExceededException; + import compbio.metadata.Preset; + import compbio.metadata.PresetManager; + import compbio.metadata.ResultNotAvailableException; + import compbio.metadata.UnsupportedRuntimeException; + import compbio.metadata.WrongParameterException; + + public class Example { + + /* + * Input sequences for alignment + */ + static final String input = ">Foo\r\n" + + "MTADGPRELLQLRAAVRHRPQDFVAWLMLADAELGMGDTTAGEMAVQRGLALHPGHPEAVARLGR" + + "VRWTQQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDAGQAEAAAAAYTRAHQLLPEEPYITAQ" + + "LLNWRRRLCDWRALDVLSAQVRAAVAQGVGAVEPFAFLSEDASAAEQLACARTRAQAIAASVRPL" + + "APTRVRSKGPLRVGFVSNGFGAHPTGLLTVALFEALQRRQPDLQMHLFATSGDDGSTLRTRLAQA" + + "STLHDVTALGHLATAKHIRHHGIDLLFDLRGWGGGGRPEVFALRPAPVQVNWLAYPGTSGAPWMD" + + "YVLGDAFALPPALEPFYSEHVLRLQGAFQPSDTSRVVAEPPSRTQCGLPEQGVVLCCFNNSYKLN" + + "PQSMARMLAVLREVPDSVLWLLSGPGEADARLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHAD" + + "LFLDTHPYNAHTTASDALWTGCPVLTTPGETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALAS" + + "DPAALTALHARVDVLRRESGVFEMDGFADDFGALLQALARRHGWLGI\r\n" + + "\r\n" + + ">Bar\r\n" + + "MGDTTAGEMAVQRGLALHQQRHAEAAVLLQQASDAAPEHPGIALWLHALEDAGQAEAAAAYTRAH" + + "QLLPEEPYITAQLLNAVAQGVGAVEPFAFLSEDASAAESVRPLAPTRVRSKGPLRVGFVSNGFGA" + + "HPTGLLTVALFEALQRRQPDLQMHLFATSGDDGSTLRTRLAQASTLHDVTALGHLATAKHIRHHG" + + "IDLLFDLRGWGGGGRPEVFALRPAPVQVNWLAYPGTSGAPWMDYVLGDAFALPPALEPFYSEHVL" + + "RLQGAFQPSDTSRVVAEPPSRTQCGLPEQGVVLCCFNNSYKLNPQSMARMLAVLREVPDSVLWLL" + + "SGPGEADARLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHADLFLDTHPYNAHTTASDALWTGC" + + "PVLTTPGETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALASDPAALTALHARVDVLRRESGV" + + "FEMDGFADDFGALLQALARRHGWLGI\r\n" + + "\r\n" + + ">Friends\r\n" + + "MTADGPRELLQLRAAVRHRPQDVAWLMLADAELGMGDTTAGEMAVQRGLALHPGHPEAVARLGRV" + + "RWTQQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDHQLLPEEPYITAQLDVLSAQVRAAVAQG" + + "VGAVEPFAFLSEDASAAEQLACARTRAQAIAASVRPLAPTRVRSKGPLRVGFVSNGFGAHPTGLL" + + "TVALFEALQRRQPDLQMHLFATSGDDGSTLRTRLAQASTLHDVTALGHLATAKHIRHHGIDLLFD" + + "LRGWGGGGRPEVFALRPAPVQVNWLAYPGTSGAPWMDYVLGDAFALPPALEPFYSEHVLRLQGAF" + + "QPSDTSRVVAEPPSRTQCGLPEQGVVLCCFNNSYKLNPQSMARMLAVLREVPDSVLWLLSGPGEA" + + "DARLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHADLFLDTHPYNAHTTASDALWTGCPVLTTP" + + "GETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALASDPAALTALHARVDVLRRESI"; + + public static void main(String[] args) throws UnsupportedRuntimeException, + LimitExceededException, JobSubmissionException, + WrongParameterException, FileNotFoundException, IOException, + ResultNotAvailableException, InterruptedException { + + String qualifiedServiceName = "http://msa.data.compbio/01/01/2010/"; + + /* Make a URL pointing to web service WSDL */ + URL url = new URL("http://www.compbio.dundee.ac.uk/jabaws/ClustalWS?wsdl"); + + /* + * If you are making a client that connects to different web services + * you can use something like this: + */ + // URL url = new URL(host + "/" + Services.ClustalWS.toString() + + // "?wsdl"); + + QName qname = new QName(qualifiedServiceName, "ClustalWS"); + Service serv = Service.create(url, qname); + /* + * Multiple sequence alignment interface for Clustal web service + * instance + */ + MsaWS msaws = serv.getPort(new QName(qualifiedServiceName, "ClustalWS" + + "Port"), MsaWS.class); + + /* Get the list of available presets */ + PresetManager presetman = msaws.getPresets(); + + /* Get the Preset object by preset name */ + Preset preset = presetman + .getPresetByName("Disable gap weighting (Speed-oriented)"); + + /* + * Load sequences in FASTA format from the file You can use something + * like new FileInputStream(<filename>) to load sequence from the file + */ + List<FastaSequence> fastalist = SequenceUtil + .readFasta(new ByteArrayInputStream(input.getBytes())); + + /* + * Submit loaded sequences for an alignment using preset. The job + * identifier is returned by this method, you can retrieve the results + * with it sometime later. + */ + String jobId = msaws.presetAlign(fastalist, preset); + + /* This method will block for the duration of the calculation */ + Alignment alignment = msaws.getResult(jobId); + + /* + * This is a better way of obtaining results, it does not involve + * holding the connection open for the duration of the calculation, + * Besides, as the University of Dundee public server will reset the + * connection after 10 minutes of idling, this is the only way to obtain + * the results of long running task from our public server. + */ + // while (msaws.getJobStatus(jobId) != JobStatus.FINISHED) { + // Thread.sleep(1000); // wait a second, then recheck the status + // } + + /* Output the alignment to standard out */ + System.out.println(alignment); + + // Alternatively, you can record retrieved alignment into the file in + // ClustalW format + + // ClustalAlignmentUtil.writeClustalAlignment(new FileOutputStream( + // "output.al"), alignment); + + } + } + +For a more detailed description of all available types and their functions please refer to the Data Model JavaDoc [link]. + + +------------ + +.. _jabaws_new_services: + +Adding new web-services +----------------------- + +.. _jabaws_new_guide: + +Brief Guide +~~~~~~~~~~~ + + +1. Add a new executable which you'd like to wrap as a JABAWS web service to the binaries folder. If it has the source code and can be recompiled for different platforms include it under ``binaries/src``. Edit ``setexecutableflag.sh`` and ``compilebin.sh`` scripts in ``binaries/src`` accordingly. + +2. Make sure that all the dependencies of the software being installed are satisfied. If there are other binaries they should be included as well. Keep the dependent binaries in a subfolder for the main executable. Update ``compilebin.sh`` and ``setexecflag.sh`` scripts accordingly. + +3. Make sure that the new executable does not have any hard links to its dependencies, e.g. is able to run from any installation folder and does not contain any hard coded paths. + +4. Describe executable in ``conf/Exectuable.properties`` file. The lowercase name of the wrapper should be included in the name of the property for example Clustal properties all include clustal as a part of the name e.g. ``local.clustalw.bin``. The same property for MAFFT will be called ``local.mafft.bin``. For more help please refer to the Executable.properties file. + +5. Describe the executable supported parameters in the ``<ExecutableName>Parameters.xml``, presets in the ``<ExecutableName>Presets.xml`` and the execution limits in the ``<ExecutableName>Limit.xml``. By convention these files are stored in ``conf/settings``. All of these are optional. If the executable does not support parameters you do not have to mention the ``XXXParameter.xml`` file in the ``Executable.properties`` file at all. The same is true for Presets and Limits. + +6. Create a Java wrapper class for your executable. Create it within runner source directory. Examples of other wrappers can be found in ``compbio.runner.msa`` or in other ``compbio.runner.*`` packages. Wrapper should extend ``SkeletalExecutable<T>`` and implement ``PipedExecutable<T>`` if you need to pass the input or collect the results from the standard in/out. Please see Mafft code as example. Wrapper should expend ``SkeletalExecutable<T>`` if input/output can be set as a parameter for an executable. Please see the ClustalW code as example. + +7. Create a testcase suit for your wrapper in ``testsrc`` and run the test cases. + +8. Create parser for the output files of your executable. Suggested location ``compbio.data.sequence.SequenceUtil``. + +9. Test the parser. + +10. Decide which web services interfaces your executable is going to match. For example if the executable output can be represented as SequenceAnnotation then SequenceAnnotation interface might be appropriate. For multiple sequence alignment an Msa interface should be used. + +11. If you find a web interface that matches your returning data type, then implement a web service which confirms to it within a webservices source folder. + +12. Register web service in ``WEB-INF/web.xml`` and ``WEB-INF/sun-jaxws.xml``. + +13. Add generated wsdl to wsbuild.xml ant script to generate the stubs. + +14. Run build-server task in wsbuild file. Watch for errors. If the task fails that means that JAXB cannot serialize some of your new data structures. Add appropriate annotations to your data types. Also check that: + + * you do not have interfaces to serialize, since JAXB cannot serialize them + * you have a default no args constructor (can be private if you do not need it) + * JAXB cannot serialize Java Map class, use a custom data structure instead + * Enum cannot be serialized as its abstract class (do not confuse with enum which is fine) + * Fields serialization leaves a little more space for manoeuvre. If you do this then you may accept and return interfaces, e.g. List, Map; abstract classes etc, from your methods + + If you have the data on the server side, but nothing is coming through to the client, this is a JAXB serialization problem. They tend to be very silent and thus hard to debug. Check your data structure can be serialized! + +15. Modify the client to work with your new web service. Update Services enumeration to include new service and ensure that all the methods of this enumeration take into account the new service. Update the client help text (``client_help.txt``) and insert it into the Constraints class. + +16. Test the web service with the client. + +17. Test on the cluster. + + +------------ + +.. _jabaws_artifacts: + +Building web services artifacts +~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ + +JABAWS are the standard JAX-WS [link] SOAP web services, which are WS-I [link] basic profile compatible. This means that you could use whatever tool your language has to work with web services. Below is how you can generate portable artifacts to work with JABAWS from Java. However if programming in Java, we recommend using our client library as it provides a handful of useful methods in addition to plain data types. + +.. code:: bash + + wsimport -keep http://www.compbio.dundee.ac.uk/jabaws/ClustalWS?wsdl + + +Server side artifacts should be rebuild whenever the data model, meta model or MSA interface were changed. To do that run build-server task from wsbuild.xml ant build file. WSDL files will be generated in ``webservices/compbio/ws/server/resource`` directory. It is not necessary to edit them if any of the JABAWS clients are used. JABAWS are the standard JAX-WS web services, which are WS-I basic profile compatible. + + +------------ + +.. _jabaws_distributives: + +Preparing Distributives +~~~~~~~~~~~~~~~~~~~~~~~ + +There are a number of ant tasks aimed for preparing distributives for download. Currently a few types of JABAWS packages are offered: + +1. Client only (contains classes required to access JABA Web Services) +2. Platform specific JABAWS (windows and other) +3. JABAWS without binaries +4. JABAWS framework + +Corresponding build task names are: + +1. min-jaba-client +2. jaba-windows, jaba-complete +3. jaba-no-binaries +4. full-jaba-client + +The easiest way to build all distributives is to call ``build-all`` ant task. There are more tasks defined in build.xml than described here. They are mostly self explanatory. + +If you made any changes to the data model and would like to generate a complete JABAWS distro make sure you have rebuilt jaxws artifact as described below. + + + +.. _Git-tracker: https://source.jalview.org/crucible/changelog/jabaws +.. _Data Model JavaDoc: http://www.compbio.dundee.ac.uk/jabaws/dm_javadoc/index.html +.. _Complete JavaDoc: http://www.compbio.dundee.ac.uk/jabaws/full_javadoc/index.html + + + +.. |folder| image:: ../../website/static/img/folder-small.png + :align: middle + :width: 15 diff --git a/website/docs/_sources/man/getting_started.rst.txt b/website/docs/_sources/man/getting_started.rst.txt new file mode 100644 index 0000000..b9c328f --- /dev/null +++ b/website/docs/_sources/man/getting_started.rst.txt @@ -0,0 +1,137 @@ +Getting Started +=============== + +JABAWS stands for JAva Bioinformatics Analysis Web Services. As the name suggests, JABAWS is a collection of web services for bioinformatics, and currently provides services that make it easy to access well-known multiple sequence alignment and protein disorder prediction programs (see the list of currently supported programs [link]). Future versions of JABAWS will incorporate other tools. + +JABAWS consists of a server and a client, but unlike most bioinformatics web-service systems, you can download and run both parts on your own computer! If you want a server just for yourself, then download and install the JABAWS Virtual Appliance (VA) [link]. It requires no configuration and is simple to install. If you want to install JABAWS for your lab or institution then download the JABAWS Web Application aRchive (WAR) [link]. It is slightly more complicated to configure but is very straightforward too. Finally, if you want to script against any version of JABAWS or are interested in writing your own client, the JABAWS command line (CLI) client [link] is what you need. + + +------------ + +.. _benefits: + +JABAWS Benefits +--------------- + +* Can be deployed on most operating systems, as a VMware or compatible Virtual Appliance, as well as a Tomcat Java Web Application. +* Comes complete with sources and binaries for all the bioinformatics programs that it runs. +* Can operate as a stand alone server or one that submits jobs to a cluster via DRMAA [link]. +* Easy to access from Jalview [link] using its graphical client, or using the JABAWS command line client. +* Clients can submit jobs to any JABAWS servers that they might want to access, such as the one running on your local computer, your lab's server, or the publicly available services at the University of Dundee [link]. +* Local or intranet installation eliminates any security concerns you might have about sending sensitive data over the internet. +* Wide range of configuration options to control size of jobs accepted by a server, and the command line options available for the program run by a service. + + +------------ + +.. _distributions: + +JABAWS Distributions +-------------------- + +.. danger:: Merge the downloads here + +.. tip:: To help you choose the JABAWS distribution that better suits your needs and read on the quickstart guides below. + +**I want to use JABAWS for...** + +* :ref:`jabaws-jalview-public` - Running JABAWS services through Jalview on the JABAWS *public* server +* :ref:`jabaws-cli` - Accessing a *public* or *private* JABAWS server using the JABAWS client +* :ref:`jabaws-war` - Running JABAWS for my group, lab, or organization on the *local* infrastructure +* :ref:`jabaws-va` - Running JABAWS services through Jalview or the CLI client on a *private* virtual machine server + + +------------ + +.. _jabaws-jalview-public: + +Jalview and the JABAWS Public Server +~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ + +This is the easiest way to run JABAWS web-services. Simply launch Jalview [link] and run any of the methods provided under the 'Web Service' menu. Jalview uses the public JABAWS server by default. If you are concerned about privacy or want to run sensitive analysis on your own hardware, you can either setup a local JABAWS Virtual Appliance (VA) [link] or configure the JABAWS Web Application aRchive (WAR) [link] in your infrastructure. + + +------------ + +.. _jabaws-cli: + +Command Line Client (CLI) +~~~~~~~~~~~~~~~~~~~~~~~~~ + +This is a single Java archive which contains the JABAWS command line interface (CLI) client. It allows anyone who wants to connect to the JABAWS web-services running at the University of Dundee's Public Server, or to run a local private JABAWS server from their own software. You can read more about how to use JABAWS command line (CLI) client given in the documentation pages [link][fix], but a brief instructions are given below: + +1. Download the Client Jar file [link] +2. Download and install Java (version 1.6) [link] +3. Provided that you have the Java ready to run, you can get command line help by changing to the directory where you downloaded the client jar, and typing: + + .. code:: bash + + java -jar jaba-client.jar + + +The JABA Web Services are WS-I compliant. This means that you can access them from any language that has libraries or functions for consuming interoperable SOAP web services. + + +------------ + +.. _jabaws-va: + +Virtual Appliance (VA) +~~~~~~~~~~~~~~~~~~~~~~ + +The Virtual Appliance (VA) package allows you to run a JABAWS server installed on TurnKey Linux as a virtual machine on your laptop or desktop computer. A complete guide to the JABAWS VA is given in the documentation pages [link][fix], but for the impatient, brief instructions are given below: + +If you work on Windows, Linux or Unix: + +1. Download JABAWS Virtual Appliance [link] +2. Download and install VMWare Player [link] +3. Unpack the JABAWS virtual appliance and open it with VMware Player + +If you work on Mac do the same using VMware Fusion [link]. + +**Testing** + +To check that your JABAWS virtual appliance is working visit the Services Status page available from the main JABAWS menu. For this enter the JABAWS URL for your new server into a web browser. This is shown once the appliance is booted up. + +Alternatively you can use Jalview to complete the testing. + +1. Launch the desktop version of Jalview [link] +2. Open the Jalview desktop's preferences panel (from the Tools->Preferences menu option), select the ``Webservices`` panel and press the ``New Service URL`` button. +3. Enter the JABAWS URL for your new server. This is shown once the appliance is booted up. + + +------------ + +.. _jabaws-war: + +Web Application aRchive (WAR) +~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ + +The JABAWS Web Application aRchive (WAR) is for anyone who wants to run JABAWS for their group, lab or organization, or wants to enable their local JABAWS server to use the cluster or perform very large tasks. Complete documentation is provided in the documentation pages [link][fix], but brief instructions are given below: + +1. Download the JABAWS WAR file [link] +2. Download and install Apache-Tomcat [link] + You will need at least Tomcat version 5.5 of (we would recommend version 7.0) and at least Java 1.6 (i.e. JAVA 6). +3. Drop the JABAWS WAR file into ``tomcat/webapps`` directory. +4. (Re)start the Tomcat. +5. Once the tomcat has started, it should automatically unpack the WAR into the webapps directory (if it doesn't, simply unpack the WAR archive). +6. If you are on Mac or other unix-like architecture with GNU compilers available or you'd like to get a maximum performance + ``cd`` to ``webapps/jabaws/binaries/src/`` and execute ``./compilebin.sh`` script to compile all binaries JABAWS depends on. + +**Testing** + +You can test that your JABAWS server is working in several ways. + +1. Visit Services Status page available from the JABAWS main page using your web browser. +2. If you are working on the command line, then use the command line client shipped with the JABAWS war to test it by running: + + .. code:: bash + + java -jar <Path to tomcat WebApp directory>/jabaws/WEB-INF/lib/jaba-client.jar -h=http://localhost:8080/jabaws + + In this example we assumed that your JABAWS server URL is ``http://localhost:8080`` and JABAWS context path is *jabaws* +3. Alternately, you can point Jalview at your new server: + + 1. Launch the desktop version of Jalview [link] + 2. Open the Jalview desktop's preferences panel (from the Tools->Preferences menu option), elect the Webservices panel and press the New Service URL button. + 3. Enter the URL for the tomcat server, including the context path for the JABAWS web app (e.g. http://localhost:8080/jabaws). diff --git a/website/docs/_sources/man/included_tools.rst.txt b/website/docs/_sources/man/included_tools.rst.txt new file mode 100644 index 0000000..22d6290 --- /dev/null +++ b/website/docs/_sources/man/included_tools.rst.txt @@ -0,0 +1,58 @@ +Included Tools +============== + +.. _msa: + +Multiple Sequence Alignment +--------------------------- + +* `Clustal Omega`_ (version 1.2.4) +* `ClustalW`_ (version 2.1) +* `Mafft`_ (version 7.310) +* `Muscle`_ (version 3.8.31) +* `T-coffee`_ (version 11.00.8cbe486) +* `Probcons`_ (version 1.12) +* `MSAProbs`_ (version 0.9.7) +* `GLProbs`_ (version 0.9.7) + + +.. _pdis: + +Protein Disorder Prediction +--------------------------- + +* `DisEMBL`_ (version 1.5) +* `IUPred`_ (version 1.0) +* Jronn - Java implementation of `Ronn`_ (version 3.1) +* `GlobPlot`_ (version 2.3) + +.. _aac: + +Amino Acid Conservation +----------------------- + +* `AACon`_ (version 1.0) + + +.. _rnass: + +RNA Secondary Structure +----------------------- + +* RNAalifold from `ViennaRNA`_ (version 2.0) + + +.. _Clustal Omega: http://www.clustal.org/omega +.. _ClustalW: http://www.clustal.org/clustal2 +.. _Mafft: http://align.bmr.kyushu-u.ac.jp/mafft/software/ +.. _Muscle: http://www.drive5.com/muscle +.. _T-coffee: http://www.tcoffee.org/Projects_home_page/t_coffee_home_page.html +.. _Probcons: http://probcons.stanford.edu/ +.. _MSAProbs: http://msaprobs.sourceforge.net/ +.. _GLProbs: http://sourceforge.net/projects/glprobs/ +.. _DisEMBL: http://dis.embl.de/ +.. _IUPred: http://iupred.enzim.hu +.. _Ronn: http://www.strubi.ox.ac.uk/RONN +.. _GlobPlot: http://globplot.embl.de/ +.. _AACon: http://www.compbio.dundee.ac.uk/aacon +.. _ViennaRNA: http://www.tbi.univie.ac.at/RNA diff --git a/website/docs/_sources/man/va.rst.txt b/website/docs/_sources/man/va.rst.txt new file mode 100644 index 0000000..24c7de2 --- /dev/null +++ b/website/docs/_sources/man/va.rst.txt @@ -0,0 +1,117 @@ +Virtual Appliance (VA) +====================== + +The JABAWS Virtual Appliance is a way to run a JABAWS server locally, without the need to connect to the internet or configure JABAWS. What the appliance provides is a 'virtual server machine' (or more simply - virtual machine or VM), running an installation of the JABAWS Web Application Archive (WAR) on TurnKey Linux 12.1 (Tomcat edition) [link]. Once this has started up, it displays a message indicating the IP address of the JABAWS server, allowing any JABAWS client (such as Jalview or the JABAWS command line client) to connect to it. +You can run the appliance with freely available program such as VMware Player [link], but you will need to install it first. We have tested the JABAWS appliance with VMware Player v 3.1.2 on Windows and Linux, and VMware Fusion on Mac. However, you are not limited to these virtualization systems and can use the JABAWS Appliance with any other virtualization platform. You can use VMware OVF tool [link] to prepare JABAWS image for a different virtualization platform e.g. VirtualBox [link]. + + +.. note:: The appliance best suits users who would like to use the JABAWS web-services locally. This might be because they do not want to access systems over an internet, or just want to keep their data private. It is also the recommended option for users who want to install JABAWS on Windows, which does not support all the bioinformatics programs that JABAWS can run. + +For servers that will be used heavily, we recommend that a JABAWS Server WAR distribution is deployed, rather than the Virtual Appliance version of JABAWS. This is because the JABAWS appliance is pre-configured to use only 1 CPU and 512M of memory (where the minimum amount of memory required for a JABAWS server is about 378M), which is unlikely to be sufficient for heavy computation. It is possible to reconfigure the virtual appliance so it uses more computation resources, but for most production environments, the JABAWS WAR distribution will be easier to deploy and fine tune to take advantage of the available resources. + + +------------ + +.. _va_installing: + +Installing +---------- + +.. danger:: update for Virtualbox + +The free VMware Player [link] can be used to run the JABAWS services from the Windows and Linux host operating systems. VMware Fusion, a commercial VMware product, offers virtual machine support for Mac. + +To run the JABAWS server on VMware player, unpack the JABAWS VM into one of the folders on your local hard drive. Open VMware Player, click "Open Virtual Machine" and point the Player to the location of the JABAWS, then choose the JABAWS.vmx file to open an appliance. + +When you play the machine for the first time the Player might ask you whether "This virtual machine may have been moved or copied.", say that you have copied it. That is all. + + +------------ + +.. _va_usage: + +Usage +----- + +By default, the JABAWS virtual appliance is configured with 512M of memory and 1 CPU, but you are free to change these settings. If you have more than one CPU or CPU core on your computer you can make them available for the JABAWS virtual machine by editing virtual machine settings. Please bear in mind that more CPU power will not make a single calculation go faster, but it will enable the VM to do calculations in parallel. Similarly, you can add more memory to the virtual machine. More memory lets your VM deal with larger tasks, e.g. work with large alignments. + + +.. image:: ../../website/static/img/VMware_cpu.png + :height: 267 + :width: 708 + :scale: 95 % + :align: left + +The VMware Player screen shot above displays JABAWS VM CPU settings. + + +------------ + +.. _va_config: + + +Configuration +------------- + +.. _va_vm_config: + +VM configuration +~~~~~~~~~~~~~~~~ + +**VMware info** + +* CPUs : 1 +* RAM : 512 MB +* Networking : Host only (the VM has no access to the outside network, nothing from the outside network can access the VM) +* Hard disk : 20 GB (expanding) +* VMware tools : Installed + +**OS information** + +* OS : TurnKey Linux (v. 12.1, Standalone Tomcat) based on Debian 6.0.7 (Squeeze) +* Installation : Oracle Java 6, Tomcat 7, JABAWS v. 2.1 +* IPv4 address : dhcp +* IPv6 address : auto +* DNS name : none +* Name server : dhcp +* Route : dhcp +* Keyboard : US_intl + +**Login credentials** + +* Root password: jabaws +* Tomcat admin password: adminjabaws + +**Services available at the virtial machine IP (e.g. VM_IP = 172.16.232.149)** + +* Tomcat Web Server: http://VM_IP (e.g. http://172.16.232.149) +* Jabaws URL: http://VM_IP/jabaws (e.g. http://172.16.232.149/jabaws) +* Web Shell: https://VM_IP:12320/ (e.g. https://172.16.232.149:12320) +* Webmean: https://VM_IP:12321/ (e.g. https://172.16.232.149:12321) +* SSH/SFTP: root@VM_IP (e.g. ssh root@172.16.232.149) + + +------------ + +.. _va_jabaws_config: + +JABAWS configuration +~~~~~~~~~~~~~~~~~~~~ + +After booting the JABAWS VM, you should see similar screen, however, the IP address of your VM may be different. To enable Jalview to work with your JABAWS appliance you need to go to Jalview->Tools->Preferences->Web Services -> New Service URL, and add JABAWS URL into the box provided. For more information please refer to Jalview help pages [link]. + +.. image:: ../../website/static/img/vm_welcome_screen.png + :height: 461 + :width: 734 + :scale: 95 % + :align: left + +If you click on Advanced Menu, you will see the configuration console, similar to the one below. + +.. image:: ../../website/static/img/VMware_booted.png + :height: 461 + :width: 735 + :scale: 95 % + :align: left + +By default the JABAWS VM is configured to use host-only networking. This means that the host can communicate with the VM via a network, but no other machines can. Similarly, the VM cannot communicate with any other computers apart from the host. If you want to connect to the Internet from the VM, configure your VM to use NAT network. However, you will not be able to connect to the VM from the host in such case. If you want to be able to connect to your VM and let VM connect to the internet at the same time you would have to use a Bridged network. In such a case you would have to configure the VM IP address manually (unless of course your network has a DHCP server to do that). diff --git a/website/docs/_sources/man/war.rst.txt b/website/docs/_sources/man/war.rst.txt new file mode 100644 index 0000000..c9c8462 --- /dev/null +++ b/website/docs/_sources/man/war.rst.txt @@ -0,0 +1,75 @@ +Web Application Archive (WAR) +============================= + +JABAWS requires a Java web application server compliant with version 2.4 of the Java Servlet specification, and a Java 6 runtime environment. We recommend using an official Oracle Java 6 runtime environment, and Apache-Tomcat [link] web application server version 7, but older Tomcat versions above 5.5 will work too. +Please Note: The JABAWS WAR is not generally compatible with older Mac systems based on the PowerPC architecture, since Java 1.6 is not available to run JABAWS. + +JABAWS Web Application aRchive can run on any host operating system that supports Java 1.6. However JABAWS depends on a number of third party programs which are not available for all operating systems. In particular, not all web services are currently available for MS Windows platform. To install Tomcat follow the intructions provided in the following documentation [link]. + +JABAWS comes with pre-compiled MS Windows and Linux x86 binaries, as well as the source code and build scripts necessary to recompile them. + +To run JABAWS on the cluster you must have shared disk space accessible from all cluster nodes. + + +------------ + +.. _war_installing: + +Installing +---------- + +.. danger:: update for java and tomcat + +You need Java vX or higher installed in your machine to be able to run the JABAWS CLI client. +Please see the Java web site [link] for up to date instructions and downloads. + +JABAWS is distributed as a web application archive (WAR). To deploy JABAWS in Apache-Tomcat - simply drop the war file into the webapps directory of a running Tomcat, and it will do the rest. If you used this deployment procedure, do not remove the Jabaws WAR file, otherwise Tomcat will undeploy your application! The context path for your deployed application will be the same as the name of the war file. For example, assuming the Tomcat server is running on the ``localhost:8080`` and *jaba.war* file is put into the ``<tomcat server root>/webapps`` directory, the deployed application from the jabaws.war file then can be accessed by this URL ``http://localhost:8080/jabaws``. + +For any other web application server, please follow your server's specific deployment procedure for 'WAR' files. If you install JABAWS on a MS Windows machine, then at this point your JABAWS installation will already be up and running, and you can try its services out as described here [link]. If you install JABAWS on Linux you will need to set an executable flag for binaries. This is described here [link]. If your host operating system is different from Windows or Linux then read on. + + +------------ + +.. _war_usage: + +Usage +----- + +**Running many JABAWS instances on the same server** + + +JABAWS is supplied as a Web Application aRchive which can be dealt with as any other web applications. So it is perfectly possible to run two JABAWS instances from the same server. Just make two different contexts on your application server and unpack JABAWS in both of them. For example if your server name is http://www.align.ac.uk, and the context names are public and private. Than one group of users could be given a URL http://www.align.ac.uk/public and another http://www.align.ac.uk/private. These contexts will be served by two independent JABAWS instances, and could be configured differently. If you keep local engine enabled, make sure you reduce the number of threads local engine is allowed to use to avoid overloading the server. Alternatively two completely separate web application server instances (e.g. Apache-Tomcat) could be used. This will give you a better resilience and more flexibility in memory settings. + +**JABAWS on a single server** + +You can run JABAWS on a single server. Obviously the capacity will be limited, but it may be sufficient for a small lab. Installed on a single server, JABAWS executes tasks in parallel, so the more cores the server has the more requests it will be able to handle. + + +**JABAWS supported cluster batch management systems** + +JABAWS uses DRMAA [link] v1.0 library to send and manage jobs on the cluster. DRMAA supports many different cluster job management systems. Namely Sun Grid Engine, Condor, PBS, GridWay, Globus 2/4, PBSPro, LSF. For up to date information please consult DRMAA web site. We found that DRMAA implementation differ from platform to platform and were trying to use only the basic functions. We have only tested JABAWS on Sun Grid Engine v 6.2. Please let use know if you have any experience of running JABAWS on other platforms. + + +------------ + +.. _war_troubleshooting: + +Troubleshooting +--------------- + +**If Apache-Tomcat fails to deploy jabaws.war file:** + +* Make sure Tomcat has sufficient access rights to read your war file. +* Restart the Tomcat, sometimes it will not restart after the new war file is added without restart +* If Tomcat still refuses to unpack the war file, unpack it manually into web application folder (the war file is just a zip archive). Restart the Tomcat. + +**If Tomcat undeployes your application:** + +If the war file is automatically removed by Tomcat use an explicit application descriptor. Add a context descriptor file into ``<tomcatRoot>conf/Catalina/localhost`` directory. Name your context file the same as your application folder e.g. if your JABAWS resides in ``webapps/jabaws`` folder, then call the context file jabaws.xml. Below is an example of content this file might have. + +.. code-block:: xml + + <?xml version="1.0" encoding="UTF-8"?> + <Context antiResourceLocking="false" privileged="true" /> + +This should be sufficient to prevent Tomcat from removing your JABAWS from WEBAPPS. For more information about the Tomcat deployer read this documentation on the Apache-Tomcat web site. diff --git a/website/docs/_sources/stats.rst.txt b/website/docs/_sources/stats.rst.txt new file mode 100644 index 0000000..7e5ac8c --- /dev/null +++ b/website/docs/_sources/stats.rst.txt @@ -0,0 +1,171 @@ +Usage Statistics +================ + +JABAWS comes with a web application for visualizing usage statistics. The screenshot below shows the main page of this application. The individual month is linked to detailed usage statistics (described later). Please note, that the links to the detailed monthly statistics are only available for authenticated users in the role admin. There is a link at the bottom of the page that lets you login, if you have not done so. + +If you are using JABAWS VA (Virtual Appliance) then the username is *jabaws* and password is not defined, i.e. empty. + +If you have deployed a JABAWS WAR file, then please see the `configuring privileged access`_ for Tomcat web application server section for further details. + +.. image:: ../website/static/img/usage_statistics_main.gif + :height: 318 + :width: 608 + :scale: 100 % + :align: left + +The table contains the number of jobs processed by JABAWS per month, for the whole period when the statistics was collected. + +For each month the table contains the following information. + +* Month - the period of time for which statistics is displayed. For example Jan 2011 means period of time from the first of January to the first of February +* Total - the total number of jobs accepted by JABAWS +* Incomplete - the number of jobs for which the result file was not found or was empty excluding cancelled +* Cancelled - the number of jobs cancelled by the user +* Abandoned - the number of jobs which result(s) were not collected + +The summary for each column is displayed in the last row of the table. + +------------ + +.. _stat_details: + +Detailed View +------------- + +Detailed execution statistics for each month is available for authenticated users only. + +.. image:: ../website/static/img/usage_statistics_month.gif + :height: 902 + :width: 670 + :scale: 100 % + :align: left + +Each table contains the number of jobs processed by JABAWS during the period of time specified in the title: + +* The "All Jobs" table contains the summary of all jobs +* "Local Jobs" table - contains the summary of the jobs calculated by the local engine +* "Cluster Jobs" table - contains the summary of the jobs calculated by the cluster + +Each table contains the following information for each web service: + +* Total - the total number of jobs accepted by a particular JABA service +* Incomplete - the number of jobs for which the result file was not found or was empty excluding cancelled +* Cancelled - the number of jobs cancelled by the user +* Abandoned - the number of jobs which result(s) were not collected + +------------ + +.. _stat_jobs: + +Job List +-------- + +Please note that if you deployed JABAWS WAR, in order to be able to navigate to the job directory from this view, the application server may need to be configured. Please see the `Configuring JABAWS execution statistics`_ section for further details. + +.. image:: ../website/static/img/usage_statistics_details.gif + :height: 198 + :width: 917 + :scale: 100 % + :align: left + +Columns: + +* JobID - the JABAWS job id, unique for every job +* Cluster JobID - cluster job id +* InputSize - input size in bytes +* ResultSize - result size in bytes +* Runtime (s) - job's runtime in seconds +* Start time (s)- job's start time and date +* Finish time (s)- job's finish time and date +* isCancelled - whether the job was cancelled +* isCollected - whether the job was collected. False for the jobs that has been initiated but which results has never been retrieved +* isFinished - whether the job has finished. This does not necessarily mean that the job has produced the result. The job can sometime finish in failure + +------------ + +.. _stat_dir_contents: + +Job Directory Contents +---------------------- + +.. image:: ../website/static/img/usage_statistics_job_details.gif + :height: 420 + :width: 716 + :scale: 90 % + :align: left + +STARTED and FINISHED files contain Unix timestamp - when the job was started and completed respectively. STARTED is replaced by SUBMITTED if the job has been submitted to the cluster, as opposed to executed locally, on the server. + +COLLECTED file is empty and indicates that the job results were collected by the user. Due to asynchronous nature of the job it is possible that the job was started and finished, but the results has never been requested. + +RunnerConfig.xml file contains a complete description of the job and JABAWS can restart the job based on this description. + +procError.txt and procOutput.txt files contains the content of the standard out and standard error streams of the process. + +result.txt file contains the results. + +input.txt file contains input into the process. + +There are maybe other files depending on the nature of the job, but the one described above will be present in most cases. In this example, stat.log file stories the execution statistics generated by (clustal executable in this example) process. + +If you have deployed JABAWS WAR file or made changes to JABAWS configuration you may need to make a few changes to the Tomcat configuration to be able to see the content of the job directory. Please see the `Configuring JABAWS execution statistics`_ section for further details. + + +.. _stat_config: + +Configuring JABAWS execution statistics +--------------------------------------- + +JABAWS execution statistics is a multi-component system. First is a crawler whose job is to collect and preprocess the statistics from the job temporary directories and record the collected statistics into the database. The second part of the system is a web application whose job is to visualise the statistics from the database. + +It is possible to enable/disable the statistics collector by changing the following properties in the ``conf/Cluster.engine.properties`` and ``conf/Local.engine.properties`` files. + +.. code-block:: bash + + # Enable/disable cluster statistics collector true = enable, false = disable + cluster.stat.collector.enable=false + # Maximum amount of time the job is considered be running in hours. Optional defaults to 7 days (168h) + cluster.stat.maxruntime=24 + +.. code-block:: bash + + # Enable/disable cluster statistics collector true = enable, false = disable + local.stat.collector.enable=true + # Maximum amount of time the job is considered to be running in hours. Optional defaults to 24 hours + local.stat.maxruntime=6 + +If the statistics collector is enabled then the crawler starts automatically soon after (10 minutes for local engine, and 60 minutes for cluster engine) the JABAWS web application and will be collecting the execution statistics every 24 hours after the start. + +The details of the job are only available if the job temporary directory is located within a JABAWS web application. If not, the system administrator can create a symbolic link pointing to the temporary job directories outside of a web application and configure the application server to allow navigation to the links. For the Tomcat application server the context configuration file should be created and copied to the ``<TOMCAT_ROOT>/conf/Catalina/localhost`` directory. The name of the file should be the same as the web application context name, for example *jabaws.xml* for jabaws. Where the ``TOMCAT_ROOT`` is the location of the Tomcat web application server. Here is an example of such a file: + +.. code-block:: xml + + <?xml version="1.0" encoding="UTF-8"?> + <Context antiResourceLocking="false" privileged="true" allowLinking="true"/> + +The key option here is this: ``allowLinking="true"``. Please also make sure that you have defined the user in role *admin* as described `below`_. + + +.. _stat_tomcat_users: + +Configuring a privileged access for Tomcat web application server +----------------------------------------------------------------- + +Access to configuration files, detailed job execution statistics and job directories are allowed only for authenticated users in role *admin*. + +If you use Tomcat, then the simplest way to set up privileged access is to use a plain text configuration file ``conf/tomcat-user.xml``. Here is an example of such configuration file defining user "peter" in role *admin*. + +.. code-block:: xml + + <tomcat-users> + <role rolename="admin"/> + <user username="peter" password="your password here " roles="admin"/> + </tomcat-users> + +For more information on users and roles please consult Apache-Tomcat help pages. + + +.. links +.. _below: stats.htmll#configuring-a-privileged-access-for-tomcat-web-application-server +.. _configuring privileged access: stats.htmll#configuring-a-privileged-access-for-tomcat-web-application-server +.. _Configuring JABAWS execution statistics: stats.html#configuring-jabaws-execution-statistics diff --git a/website/docs/_sources/va.rst.txt b/website/docs/_sources/va.rst.txt new file mode 100644 index 0000000..6c62253 --- /dev/null +++ b/website/docs/_sources/va.rst.txt @@ -0,0 +1,131 @@ +Virtual Appliance (VA) +====================== + +.. warning:: The Virtual Appliance (VA) for JABAWS v2.2 will be provided soon. + +The JABAWS Virtual Appliance is a way to run a JABAWS server locally, without the need to connect to the internet or configure JABAWS. What the appliance provides is a 'virtual server machine' (or more simply - *virtual machine* or *VM*), running an installation of the JABAWS Web Application Archive (WAR) on `TurnKey Linux`_ 12.1 (Standlone Tomcat). Once this has started up, it displays a message indicating the IP address of the JABAWS server, allowing any JABAWS client (such as Jalview or the JABAWS command line client) to connect to it. + +You can run the appliance with freely available program such as `VMware Player`_, but you will need to install it first. We have tested the JABAWS appliance with VMware Player v 3.1.2 on Windows and Linux, and VMware Fusion on Mac. However, you are not limited to these virtualization systems and can use the JABAWS Appliance with any other virtualization platform. You can use `VMware OVF`_ tool to prepare JABAWS image for a different virtualization platform e.g. `VirtualBox`_. + +.. note:: The appliance best suits users who would like to use the JABAWS web-services locally. This might be because they do not want to access systems over an internet, or just want to keep their data private. It is also the recommended option for users who want to install JABAWS on Windows, which does not support all the bioinformatics programs that JABAWS can run. + +For servers that will be used heavily, we recommend that a JABAWS Server WAR distribution is deployed, rather than the Virtual Appliance version of JABAWS. This is because the JABAWS appliance is pre-configured to use only 1 CPU and 512M of memory (where the minimum amount of memory required for a JABAWS server is about 378M), which is unlikely to be sufficient for heavy computation. It is possible to reconfigure the virtual appliance so it uses more computation resources, but for most production environments, the JABAWS WAR distribution will be easier to deploy and fine tune to take advantage of the available resources. + + +------------ + +.. _va_installing: + +Installing +---------- + +.. tip:: Check if you are running the recommended version of VWMare. + +The free `VMware Player`_ can be used to run the JABAWS services from the Windows and Linux host operating systems. `VMware Fusion`_, a commercial VMware product, offers virtual machine support for Mac. + +To run the JABAWS server on VMware player, unpack the JABAWS VM into one of the folders on your local hard drive. Open VMware Player, click "Open Virtual Machine" and point the Player to the location of the JABAWS, then choose the JABAWS.vmx file to open an appliance. + +When you play the machine for the first time the Player might ask you whether "This virtual machine may have been moved or copied.", say that you have copied it. That is all. + + +------------ + +.. _va_usage: + +Usage +----- + +By default, the JABAWS virtual appliance is configured with 512M of memory and 1 CPU, but you are free to change these settings. If you have more than one CPU or CPU core on your computer you can make them available for the JABAWS virtual machine by editing virtual machine settings. Please bear in mind that more CPU power will not make a single calculation go faster, but it will enable the VM to do calculations in parallel. Similarly, you can add more memory to the virtual machine. More memory lets your VM deal with larger tasks, e.g. work with large alignments. + + +.. image:: ../website/static/img/VMware_cpu.png + :height: 267 + :width: 708 + :scale: 95 % + :align: left + +The VMware Player screen shot above displays JABAWS VM CPU settings. + + +------------ + +.. _va_config: + + +Configuration +------------- + +.. _va_vm_config: + +VM configuration +~~~~~~~~~~~~~~~~ + +**VMware info** + +* CPUs : 1 +* RAM : 512 MB +* Networking : Host only (the VM has no access to the outside network, nothing from the outside network can access the VM) +* Hard disk : 20 GB (expanding) +* VMware tools : Installed + +**OS information** + +* OS : TurnKey Linux (v. 12.1, Standalone Tomcat) based on Debian 6.0.7 (Squeeze) +* Installation : Oracle Java 6, Tomcat 7, JABAWS v. 2.1 +* IPv4 address : dhcp +* IPv6 address : auto +* DNS name : none +* Name server : dhcp +* Route : dhcp +* Keyboard : US_intl + +**Login credentials** + +* Root password: jabaws +* Tomcat admin password: adminjabaws + +**Services available at the virtial machine IP (e.g. VM_IP = 172.16.232.149)** + +* Tomcat Web Server: http://VM_IP (e.g. http://172.16.232.149) +* Jabaws URL: http://VM_IP/jabaws (e.g. http://172.16.232.149/jabaws) +* Web Shell: https://VM_IP:12320/ (e.g. https://172.16.232.149:12320) +* Webmean: https://VM_IP:12321/ (e.g. https://172.16.232.149:12321) +* SSH/SFTP: root@VM_IP (e.g. ssh root@172.16.232.149) + + +------------ + +.. _va_jabaws_config: + +JABAWS configuration +~~~~~~~~~~~~~~~~~~~~ + +After booting the JABAWS VM, you should see similar screen, however, the IP address of your VM may be different. To enable Jalview to work with your JABAWS appliance you need to go to Jalview->Tools->Preferences->Web Services -> New Service URL, and add JABAWS URL into the box provided. For more information please refer to `Jalview help pages`_. + +.. _Jalview help pages: http://www.jalview.org/help/html/webServices/JABAWS.html + +.. image:: ../website/static/img/vm_welcome_screen.png + :height: 461 + :width: 734 + :scale: 95 % + :align: left + +If you click on Advanced Menu, you will see the configuration console, similar to the one below. + +.. image:: ../website/static/img/VMware_booted.png + :height: 461 + :width: 735 + :scale: 95 % + :align: left + +By default the JABAWS VM is configured to use host-only networking. This means that the host can communicate with the VM via a network, but no other machines can. Similarly, the VM cannot communicate with any other computers apart from the host. If you want to connect to the Internet from the VM, configure your VM to use NAT network. However, you will not be able to connect to the VM from the host in such case. If you want to be able to connect to your VM and let VM connect to the internet at the same time you would have to use a Bridged network. In such a case you would have to configure the VM IP address manually (unless of course your network has a DHCP server to do that). + + +.. links +.. _Jalview: http://www.jalview.org/ +.. _TurnKey Linux: https://www.turnkeylinux.org/tomcat +.. _JABAWS Virtual Appliance: ../download.jsp#va +.. _VMWare Player: http://www.vmware.com/products/player +.. _VMWare Fusion: http://www.vmware.com/products/fusion/overview.html +.. _VirtualBox: https://www.virtualbox.org/ +.. _VMware OVF: https://code.vmware.com/web/dp/tool/ovf/4.1.0 diff --git a/website/docs/_sources/war.rst.txt b/website/docs/_sources/war.rst.txt new file mode 100644 index 0000000..db43298 --- /dev/null +++ b/website/docs/_sources/war.rst.txt @@ -0,0 +1,80 @@ +Web Application Archive (WAR) +============================= + +JABAWS Web Application aRchive can run on any host operating system that supports `Java`_ and `Apache-Tomcat`_. JABAWS requires a Java web application server compliant with version 2.4 of the Java Servlet specification, and a `Java`_ 7 runtime environment. We recommend using an official Oracle Java 7 runtime environment, and `Apache-Tomcat`_ web application server version 8.5, but older Tomcat versions above 5.5 will work too. + +.. danger:: The JABAWS WAR is not generally compatible with older Mac systems based on the PowerPC architecture, since Java 1.7 is not available to run JABAWS. + +However JABAWS depends on a number of third party programs which are not available for all operating systems. In particular, not all web services are currently available for MS Windows platform. JABAWS comes with pre-compiled MS Windows and Linux x86 binaries, as well as the source code and build scripts necessary to recompile them. + +To run JABAWS on the cluster you must have shared disk space accessible from all cluster nodes. + + +------------ + +.. _war_installing: + +Installing +---------- + +.. tip:: Check if you are running the recommended versions of Java and Apache-Tomcat. + +JABAWS is distributed as a web application archive (WAR). To deploy JABAWS in `Apache-Tomcat`_ - simply drop the war file into the webapps directory of a running Tomcat, and it will do the rest. If you used this deployment procedure, do not remove the Jabaws WAR file, otherwise Tomcat will undeploy your application! The context path for your deployed application will be the same as the name of the war file. For example, assuming the Tomcat server is running on the ``localhost:8080`` and *jaba.war* file is put into the ``<tomcat server root>/webapps`` directory, the deployed application from the jabaws.war file then can be accessed by this URL ``http://localhost:8080/jabaws``. + +For any other web application server, please follow your server's specific deployment procedure for 'WAR' files. If you install JABAWS on a MS Windows machine, then at this point your JABAWS installation will already be up and running, and you can try its services out as described here in the `documentation`_. If you install JABAWS on Linux you will need to compile the binaries for your system and set an executable flag for binaries (`more details here`_ and `here`_). + + +------------ + +.. _war_usage: + +Usage +----- + +**Running many JABAWS instances on the same server** + + +JABAWS is supplied as a Web Application aRchive which can be dealt with as any other web applications. So it is perfectly possible to run two JABAWS instances from the same server. Just make two different contexts on your application server and unpack JABAWS in both of them. For example if your server name is http://www.align.ac.uk, and the context names are public and private. Than one group of users could be given a URL http://www.align.ac.uk/public and another http://www.align.ac.uk/private. These contexts will be served by two independent JABAWS instances, and could be configured differently. If you keep local engine enabled, make sure you reduce the number of threads local engine is allowed to use to avoid overloading the server. Alternatively two completely separate web application server instances (e.g. Apache-Tomcat) could be used. This will give you a better resilience and more flexibility in memory settings. + +**JABAWS on a single server** + +You can run JABAWS on a single server. Obviously the capacity will be limited, but it may be sufficient for a small lab. Installed on a single server, JABAWS executes tasks in parallel, so the more cores the server has the more requests it will be able to handle. + + +**JABAWS supported cluster batch management systems** + +JABAWS uses `DRMAA`_ v1.0 library to send and manage jobs on the cluster. DRMAA supports many different cluster job management systems. Namely Sun Grid Engine, Condor, PBS, GridWay, Globus 2/4, PBSPro, LSF. For up to date information please consult DRMAA web site. We found that DRMAA implementation differ from platform to platform and were trying to use only the basic functions. We have only tested JABAWS on Sun Grid Engine v 6.2. Please let use know if you have any experience of running JABAWS on other platforms. + + +------------ + +.. _war_troubleshooting: + +Troubleshooting +--------------- + +**If Apache-Tomcat fails to deploy jabaws.war file:** + +* Make sure Tomcat has sufficient access rights to read your war file. +* Restart the Tomcat, sometimes it will not restart after the new war file is added without restart +* If Tomcat still refuses to unpack the war file, unpack it manually into web application folder (the war file is just a zip archive). Restart the Tomcat. + +**If Tomcat undeployes your application:** + +If the war file is automatically removed by Tomcat use an explicit application descriptor. Add a context descriptor file into ``<tomcatRoot>conf/Catalina/localhost`` directory. Name your context file the same as your application folder e.g. if your JABAWS resides in ``webapps/jabaws`` folder, then call the context file jabaws.xml. Below is an example of content this file might have. + +.. code-block:: xml + + <?xml version="1.0" encoding="UTF-8"?> + <Context antiResourceLocking="false" privileged="true" /> + +This should be sufficient to prevent Tomcat from removing your JABAWS from WEBAPPS. For more information about the Tomcat deployer read this documentation on the Apache-Tomcat web site. + + +.. links +.. _Java: http://www.oracle.com/technetwork/java/javase/downloads/jre7-downloads-1880261.html +.. _Apache-Tomcat: http://tomcat.apache.org/download-80.cgi +.. _DRMAA: http://www.drmaa.org/ +.. _documentation: advanced.html#testing-the-jabaws-server +.. _more details here: advanced.html#pre-compiled-binaries +.. _here: advanced.html#recompiling-binaries-for-your-system diff --git a/website/docs/_static/ajax-loader.gif b/website/docs/_static/ajax-loader.gif new file mode 100644 index 0000000..61faf8c Binary files /dev/null and b/website/docs/_static/ajax-loader.gif differ diff --git a/website/docs/_static/basic.css b/website/docs/_static/basic.css new file mode 100644 index 0000000..7ed0e58 --- /dev/null +++ b/website/docs/_static/basic.css @@ -0,0 +1,632 @@ +/* + * basic.css + * ~~~~~~~~~ + * + * Sphinx stylesheet -- basic theme. + * + * :copyright: Copyright 2007-2016 by the Sphinx team, see AUTHORS. + * :license: BSD, see LICENSE for details. + * + */ + +/* -- main layout ----------------------------------------------------------- */ + +div.clearer { + clear: both; +} + +/* -- relbar ---------------------------------------------------------------- */ + +div.related { + width: 100%; + font-size: 90%; +} + +div.related h3 { + display: none; +} + +div.related ul { + margin: 0; + padding: 0 0 0 10px; + list-style: none; +} + +div.related li { + display: inline; +} + +div.related li.right { + float: right; + margin-right: 5px; +} + +/* -- sidebar --------------------------------------------------------------- */ + +div.sphinxsidebarwrapper { + padding: 10px 5px 0 10px; +} + +div.sphinxsidebar { + float: left; + width: 230px; + margin-left: -100%; + font-size: 90%; + word-wrap: break-word; + overflow-wrap : break-word; +} + +div.sphinxsidebar ul { + list-style: none; +} + +div.sphinxsidebar ul ul, +div.sphinxsidebar ul.want-points { + margin-left: 20px; + list-style: square; +} + +div.sphinxsidebar ul ul { + margin-top: 0; + margin-bottom: 0; +} + +div.sphinxsidebar form { + margin-top: 10px; +} + +div.sphinxsidebar input { + border: 1px solid #98dbcc; + font-family: sans-serif; + font-size: 1em; +} + +div.sphinxsidebar #searchbox input[type="text"] { + width: 170px; +} + +img { + border: 0; + max-width: 100%; +} + +/* -- search page ----------------------------------------------------------- */ + +ul.search { + margin: 10px 0 0 20px; + padding: 0; +} + +ul.search li { + padding: 5px 0 5px 20px; + background-image: url(file.png); + background-repeat: no-repeat; + background-position: 0 7px; +} + +ul.search li a { + font-weight: bold; +} + +ul.search li div.context { + color: #888; + margin: 2px 0 0 30px; + text-align: left; +} + +ul.keywordmatches li.goodmatch a { + font-weight: bold; +} + +/* -- index page ------------------------------------------------------------ */ + +table.contentstable { + width: 90%; + margin-left: auto; + margin-right: auto; +} + +table.contentstable p.biglink { + line-height: 150%; +} + +a.biglink { + font-size: 1.3em; +} + +span.linkdescr { + font-style: italic; + padding-top: 5px; + font-size: 90%; +} + +/* -- general index --------------------------------------------------------- */ + +table.indextable { + width: 100%; +} + +table.indextable td { + text-align: left; + vertical-align: top; +} + +table.indextable ul { + margin-top: 0; + margin-bottom: 0; + list-style-type: none; +} + +table.indextable > tbody > tr > td > ul { + padding-left: 0em; +} + +table.indextable tr.pcap { + height: 10px; +} + +table.indextable tr.cap { + margin-top: 10px; + background-color: #f2f2f2; +} + +img.toggler { + margin-right: 3px; + margin-top: 3px; + cursor: pointer; +} + +div.modindex-jumpbox { + border-top: 1px solid #ddd; + border-bottom: 1px solid #ddd; + margin: 1em 0 1em 0; + padding: 0.4em; +} + +div.genindex-jumpbox { + border-top: 1px solid #ddd; + border-bottom: 1px solid #ddd; + margin: 1em 0 1em 0; + padding: 0.4em; +} + +/* -- domain module index --------------------------------------------------- */ + +table.modindextable td { + padding: 2px; + border-collapse: collapse; +} + +/* -- general body styles --------------------------------------------------- */ + +div.body p, div.body dd, div.body li, div.body blockquote { + -moz-hyphens: auto; + -ms-hyphens: auto; + -webkit-hyphens: auto; + hyphens: auto; +} + +a.headerlink { + visibility: hidden; +} + +h1:hover > a.headerlink, +h2:hover > a.headerlink, +h3:hover > a.headerlink, +h4:hover > a.headerlink, +h5:hover > a.headerlink, +h6:hover > a.headerlink, +dt:hover > a.headerlink, +caption:hover > a.headerlink, +p.caption:hover > a.headerlink, +div.code-block-caption:hover > a.headerlink { + visibility: visible; +} + +div.body p.caption { + text-align: inherit; +} + +div.body td { + text-align: left; +} + +.first { + margin-top: 0 !important; +} + +p.rubric { + margin-top: 30px; + font-weight: bold; +} + +img.align-left, .figure.align-left, object.align-left { + clear: left; + float: left; + margin-right: 1em; +} + +img.align-right, .figure.align-right, object.align-right { + clear: right; + float: right; + margin-left: 1em; +} + +img.align-center, .figure.align-center, object.align-center { + display: block; + margin-left: auto; + margin-right: auto; +} + +.align-left { + text-align: left; +} + +.align-center { + text-align: center; +} + +.align-right { + text-align: right; +} + +/* -- sidebars -------------------------------------------------------------- */ + +div.sidebar { + margin: 0 0 0.5em 1em; + border: 1px solid #ddb; + padding: 7px 7px 0 7px; + background-color: #ffe; + width: 40%; + float: right; +} + +p.sidebar-title { + font-weight: bold; +} + +/* -- topics ---------------------------------------------------------------- */ + +div.topic { + border: 1px solid #ccc; + padding: 7px 7px 0 7px; + margin: 10px 0 10px 0; +} + +p.topic-title { + font-size: 1.1em; + font-weight: bold; + margin-top: 10px; +} + +/* -- admonitions ----------------------------------------------------------- */ + +div.admonition { + margin-top: 10px; + margin-bottom: 10px; + padding: 7px; +} + +div.admonition dt { + font-weight: bold; +} + +div.admonition dl { + margin-bottom: 0; +} + +p.admonition-title { + margin: 0px 10px 5px 0px; + font-weight: bold; +} + +div.body p.centered { + text-align: center; + margin-top: 25px; +} + +/* -- tables ---------------------------------------------------------------- */ + +table.docutils { + border: 0; + border-collapse: collapse; +} + +table caption span.caption-number { + font-style: italic; +} + +table caption span.caption-text { +} + +table.docutils td, table.docutils th { + padding: 1px 8px 1px 5px; + border-top: 0; + border-left: 0; + border-right: 0; + border-bottom: 1px solid #aaa; +} + +table.footnote td, table.footnote th { + border: 0 !important; +} + +th { + text-align: left; + padding-right: 5px; +} + +table.citation { + border-left: solid 1px gray; + margin-left: 1px; +} + +table.citation td { + border-bottom: none; +} + +/* -- figures --------------------------------------------------------------- */ + +div.figure { + margin: 0.5em; + padding: 0.5em; +} + +div.figure p.caption { + padding: 0.3em; +} + +div.figure p.caption span.caption-number { + font-style: italic; +} + +div.figure p.caption span.caption-text { +} + +/* -- field list styles ----------------------------------------------------- */ + +table.field-list td, table.field-list th { + border: 0 !important; +} + +.field-list ul { + margin: 0; + padding-left: 1em; +} + +.field-list p { + margin: 0; +} + +/* -- other body styles ----------------------------------------------------- */ + +ol.arabic { + list-style: decimal; +} + +ol.loweralpha { + list-style: lower-alpha; +} + +ol.upperalpha { + list-style: upper-alpha; +} + +ol.lowerroman { + list-style: lower-roman; +} + +ol.upperroman { + list-style: upper-roman; +} + +dl { + margin-bottom: 15px; +} + +dd p { + margin-top: 0px; +} + +dd ul, dd table { + margin-bottom: 10px; +} + +dd { + margin-top: 3px; + margin-bottom: 10px; + margin-left: 30px; +} + +dt:target, .highlighted { + background-color: #fbe54e; +} + +dl.glossary dt { + font-weight: bold; + font-size: 1.1em; +} + +.optional { + font-size: 1.3em; +} + +.sig-paren { + font-size: larger; +} + +.versionmodified { + font-style: italic; +} + +.system-message { + background-color: #fda; + padding: 5px; + border: 3px solid red; +} + +.footnote:target { + background-color: #ffa; +} + +.line-block { + display: block; + margin-top: 1em; + margin-bottom: 1em; +} + +.line-block .line-block { + margin-top: 0; + margin-bottom: 0; + margin-left: 1.5em; +} + +.guilabel, .menuselection { + font-family: sans-serif; +} + +.accelerator { + text-decoration: underline; +} + +.classifier { + font-style: oblique; +} + +abbr, acronym { + border-bottom: dotted 1px; + cursor: help; +} + +/* -- code displays --------------------------------------------------------- */ + +pre { + overflow: auto; + overflow-y: hidden; /* fixes display issues on Chrome browsers */ +} + +span.pre { + -moz-hyphens: none; + -ms-hyphens: none; + -webkit-hyphens: none; + hyphens: none; +} + +td.linenos pre { + padding: 5px 0px; + border: 0; + background-color: transparent; + color: #aaa; +} + +table.highlighttable { + margin-left: 0.5em; +} + +table.highlighttable td { + padding: 0 0.5em 0 0.5em; +} + +div.code-block-caption { + padding: 2px 5px; + font-size: small; +} + +div.code-block-caption code { + background-color: transparent; +} + +div.code-block-caption + div > div.highlight > pre { + margin-top: 0; +} + +div.code-block-caption span.caption-number { + padding: 0.1em 0.3em; + font-style: italic; +} + +div.code-block-caption span.caption-text { +} + +div.literal-block-wrapper { + padding: 1em 1em 0; +} + +div.literal-block-wrapper div.highlight { + margin: 0; +} + +code.descname { + background-color: transparent; + font-weight: bold; + font-size: 1.2em; +} + +code.descclassname { + background-color: transparent; +} + +code.xref, a code { + background-color: transparent; + font-weight: bold; +} + +h1 code, h2 code, h3 code, h4 code, h5 code, h6 code { + background-color: transparent; +} + +.viewcode-link { + float: right; +} + +.viewcode-back { + float: right; + font-family: sans-serif; +} + +div.viewcode-block:target { + margin: -1px -10px; + padding: 0 10px; +} + +/* -- math display ---------------------------------------------------------- */ + +img.math { + vertical-align: middle; +} + +div.body div.math p { + text-align: center; +} + +span.eqno { + float: right; +} + +span.eqno a.headerlink { + position: relative; + left: 0px; + z-index: 1; +} + +div.math:hover a.headerlink { + visibility: visible; +} + +/* -- printout stylesheet --------------------------------------------------- */ + +@media print { + div.document, + div.documentwrapper, + div.bodywrapper { + margin: 0 !important; + width: 100%; + } + + div.sphinxsidebar, + div.related, + div.footer, + #top-link { + display: none; + } +} \ No newline at end of file diff --git a/website/docs/_static/comment-bright.png b/website/docs/_static/comment-bright.png new file mode 100644 index 0000000..15e27ed Binary files /dev/null and b/website/docs/_static/comment-bright.png differ diff --git a/website/docs/_static/comment-close.png b/website/docs/_static/comment-close.png new file mode 100644 index 0000000..4d91bcf Binary files /dev/null and b/website/docs/_static/comment-close.png differ diff --git a/website/docs/_static/comment.png b/website/docs/_static/comment.png new file mode 100644 index 0000000..dfbc0cb Binary files /dev/null and b/website/docs/_static/comment.png differ diff --git a/website/docs/_static/css/badge_only.css b/website/docs/_static/css/badge_only.css new file mode 100644 index 0000000..f4b46e9 --- /dev/null +++ b/website/docs/_static/css/badge_only.css @@ -0,0 +1,2 @@ +.fa:before{-webkit-font-smoothing:antialiased}.clearfix{*zoom:1}.clearfix:before,.clearfix:after{display:table;content:""}.clearfix:after{clear:both}@font-face{font-family:FontAwesome;font-weight:normal;font-style:normal;src:url("../fonts/fontawesome-webfont.eot");src:url("../fonts/fontawesome-webfont.eot?#iefix") format("embedded-opentype"),url("../fonts/fontawesome-webfont.woff") format("woff"),url("../fonts/fontawesome-webfont.ttf") format("truetype"),url("../fonts/fontawesome-webfont.svg#FontAwesome") format("svg")}.fa:before{display:inline-block;font-family:FontAwesome;font-style:normal;font-weight:normal;line-height:1;text-decoration:inherit}a .fa{display:inline-block;text-decoration:inherit}li .fa{display:inline-block}li .fa-large:before,li .fa-large:before{width:1.875em}ul.fas{list-style-type:none;margin-left:2em;text-indent:-0.8em}ul.fas li .fa{width:0.8em}ul.fas li .fa-large:before,ul.fas li .fa-large:before{vertical-align:baseline}.fa-book:before{content:"ï"}.icon-book:before{content:"ï"}.fa-caret-down:before{content:"ï"}.icon-caret-down:before{content:"ï"}.fa-caret-up:before{content:"ï"}.icon-caret-up:before{content:"ï"}.fa-caret-left:before{content:"ï"}.icon-caret-left:before{content:"ï"}.fa-caret-right:before{content:"ï"}.icon-caret-right:before{content:"ï"}.rst-versions{position:fixed;bottom:0;left:0;width:300px;color:#fcfcfc;background:#1f1d1d;border-top:solid 10px #343131;font-family:"Lato","proxima-nova","Helvetica Neue",Arial,sans-serif;z-index:400}.rst-versions a{color:#2980B9;text-decoration:none}.rst-versions .rst-badge-small{display:none}.rst-versions .rst-current-version{padding:12px;background-color:#272525;display:block;text-align:right;font-size:90%;cursor:pointer;color:#27AE60;*zoom:1}.rst-versions .rst-current-version:before,.rst-versions .rst-current-version:after{display:table;content:""}.rst-versions .rst-current-version:after{clear:both}.rst-versions .rst-current-version .fa{color:#fcfcfc}.rst-versions .rst-current-version .fa-book{float:left}.rst-versions .rst-current-version .icon-book{float:left}.rst-versions .rst-current-version.rst-out-of-date{background-color:#E74C3C;color:#fff}.rst-versions .rst-current-version.rst-active-old-version{background-color:#F1C40F;color:#000}.rst-versions.shift-up .rst-other-versions{display:block}.rst-versions .rst-other-versions{font-size:90%;padding:12px;color:gray;display:none}.rst-versions .rst-other-versions hr{display:block;height:1px;border:0;margin:20px 0;padding:0;border-top:solid 1px #413d3d}.rst-versions .rst-other-versions dd{display:inline-block;margin:0}.rst-versions .rst-other-versions dd a{display:inline-block;padding:6px;color:#fcfcfc}.rst-versions.rst-badge{width:auto;bottom:20px;right:20px;left:auto;border:none;max-width:300px}.rst-versions.rst-badge .icon-book{float:none}.rst-versions.rst-badge .fa-book{float:none}.rst-versions.rst-badge.shift-up .rst-current-version{text-align:right}.rst-versions.rst-badge.shift-up .rst-current-version .fa-book{float:left}.rst-versions.rst-badge.shift-up .rst-current-version .icon-book{float:left}.rst-versions.rst-badge .rst-current-version{width:auto;height:30px;line-height:30px;padding:0 6px;display:block;text-align:center}@media screen and (max-width: 768px){.rst-versions{width:85%;display:none}.rst-versions.shift{display:block}} +/*# sourceMappingURL=badge_only.css.map */ diff --git a/website/docs/_static/css/badge_only.css.map b/website/docs/_static/css/badge_only.css.map new file mode 100644 index 0000000..a302a9f --- /dev/null +++ b/website/docs/_static/css/badge_only.css.map @@ -0,0 +1,7 @@ +{ +"version": 3, +"mappings": "CAyDA,SAAY,EACV,qBAAsB,EAAE,UAAW,EAqDrC,QAAS,EARP,IAAK,EAAE,AAAC,EACR,+BAAS,EAEP,MAAO,EAAE,IAAK,EACd,MAAO,EAAE,CAAE,EACb,cAAO,EACL,IAAK,EAAE,GAAI,EC1Gb,SAkBC,EAjBC,UAAW,ECFJ,UAAW,EDGlB,UAAW,EAHqC,KAAM,EAItD,SAAU,EAJsD,KAAM,EAapE,EAAG,EAAE,sCAAwB,EAC7B,EAAG,EAAE,8PAG2D,ECftE,SAAU,EACR,MAAO,EAAE,WAAY,EACrB,UAAW,EAAE,UAAW,EACxB,SAAU,EAAE,KAAM,EAClB,UAAW,EAAE,KAAM,EACnB,UAAW,EAAE,AAAC,EACd,cAAe,EAAE,MAAO,EAG1B,IAAK,EACH,MAAO,EAAE,WAAY,EACrB,cAAe,EAAE,MAAO,EAIxB,KAAG,EACD,MAAO,EAAE,WAAY,EACvB,sCAAiB,EAGf,IAAK,EAAE,MAAY,EAEvB,KAAM,EACJ,cAAe,EAAE,GAAI,EACrB,UAAW,EAAE,EAAG,EAChB,UAAW,EAAE,KAAM,EAEjB,YAAG,EACD,IAAK,EAAE,IAAI,EACb,oDAAiB,EAGf,aAAc,EAAE,OAAQ,EAG9B,cAAe,EACb,MAAO,EAAE,EAAO,EAElB,gBAAiB,EACf,MAAO,EAAE,EAAO,EAElB,oBAAqB,EACnB,MAAO,EAAE,EAAO,EAElB,sBAAuB,EACrB,MAAO,EAAE,EAAO,EAElB,kBAAmB,EACjB,MAAO,EAAE,EAAO,EAElB,oBAAqB,EACnB,MAAO,EAAE,EAAO,EAElB,oBAAqB,EACnB,MAAO,EAAE,EAAO,EAElB,sBAAuB,EACrB,MAAO,EAAE,EAAO,EAElB,qBAAsB,EACpB,MAAO,EAAE,EAAO,EAElB,uBAAwB,EACtB,MAAO,EAAE,EAAO,ECnElB,YAAa,EACX,OAAQ,EAAE,IAAK,EACf,KAAM,EAAE,AAAC,EACT,GAAI,EAAE,AAAC,EACP,IAAK,EC6E+B,IAAK,ED5EzC,IAAK,EEuC+B,MAAyB,EFtC7D,SAAU,EAAE,MAAkC,EAC9C,SAAU,EAAE,iBAAiC,EAC7C,UAAW,EEkDyB,sDAA2D,EFjD/F,MAAO,EC+E6B,EAAG,ED9EvC,cAAC,EACC,IAAK,EEkC6B,MAAK,EFjCvC,cAAe,EAAE,GAAI,EACvB,6BAAgB,EACd,MAAO,EAAE,GAAI,EACf,iCAAoB,EAClB,MAAO,EAAE,GAAqB,EAC9B,eAAgB,EAAE,MAAkC,EACpD,MAAO,EAAE,IAAK,EACd,SAAU,EAAE,IAAK,EACjB,QAAS,EAAE,EAAG,EACd,KAAM,EAAE,MAAO,EACf,IAAK,EEX6B,MAAM,EL4F1C,IAAK,EAAE,AAAC,EACR,iFAAS,EAEP,MAAO,EAAE,IAAK,EACd,MAAO,EAAE,CAAE,EACb,uCAAO,EACL,IAAK,EAAE,GAAI,EGrFX,qCAAG,EACD,IAAK,EEmB2B,MAAyB,EFlB3D,0CAAQ,EACN,IAAK,EAAE,GAAI,EACb,4CAAU,EACR,IAAK,EAAE,GAAI,EACb,iDAAiB,EACf,eAAgB,ECQgB,MAAI,EDPpC,IAAK,EEO2B,GAAM,EFNxC,wDAAwB,EACtB,eAAgB,EEsBgB,MAAO,EFrBvC,IAAK,ECzB2B,GAAI,ED0BxC,yCAA8B,EAC5B,MAAO,EAAE,IAAK,EAChB,gCAAmB,EACjB,QAAS,EAAE,EAAG,EACd,MAAO,EAAE,GAAqB,EAC9B,IAAK,EEJ6B,GAAY,EFK9C,MAAO,EAAE,GAAI,EACb,mCAAE,EACA,MAAO,EAAE,IAAK,EACd,KAAM,EAAE,EAAG,EACX,KAAM,EAAE,AAAC,EACT,KAAM,EAAE,KAAM,EACd,MAAO,EAAE,AAAC,EACV,SAAU,EAAE,gBAA6C,EAC3D,mCAAE,EACA,MAAO,EAAE,WAAY,EACrB,KAAM,EAAE,AAAC,EACT,qCAAC,EACC,MAAO,EAAE,WAAY,EACrB,MAAO,EAAE,EAAqB,EAC9B,IAAK,EEZyB,MAAyB,EFa7D,sBAAW,EACT,IAAK,EAAE,GAAI,EACX,KAAM,EAAE,GAAI,EACZ,IAAK,EAAE,GAAI,EACX,GAAI,EAAE,GAAI,EACV,KAAM,EAAE,GAAI,EACZ,QAAS,ECkByB,IAAK,EDjBvC,iCAAU,EACR,IAAK,EAAE,GAAI,EACb,+BAAQ,EACN,IAAK,EAAE,GAAI,EACb,oDAA+B,EAC7B,SAAU,EAAE,IAAK,EACjB,6DAAQ,EACN,IAAK,EAAE,GAAI,EACb,+DAAU,EACR,IAAK,EAAE,GAAI,EACf,2CAAoB,EAClB,IAAK,EAAE,GAAI,EACX,KAAM,EAAE,GAAI,EACZ,UAAW,EAAE,GAAI,EACjB,MAAO,EAAE,IAAuB,EAChC,MAAO,EAAE,IAAK,EACd,SAAU,EAAE,KAAM,EGhDpB,mCAAsB,EHmDxB,YAAa,EACX,IAAK,EAAE,EAAG,EACV,MAAO,EAAE,GAAI,EACb,kBAAO,EACL,MAAO,EAAE,IAAK", +"sources": ["../../../bower_components/wyrm/sass/wyrm_core/_mixin.sass","../../../bower_components/bourbon/dist/css3/_font-face.scss","../../../sass/_theme_badge_fa.sass","../../../sass/_theme_badge.sass","../../../bower_components/wyrm/sass/wyrm_core/_wy_variables.sass","../../../sass/_theme_variables.sass","../../../bower_components/neat/app/assets/stylesheets/grid/_media.scss"], +"names": [], +"file": "badge_only.css" +} diff --git a/website/docs/_static/css/theme.css b/website/docs/_static/css/theme.css new file mode 100644 index 0000000..252eef5 --- /dev/null +++ b/website/docs/_static/css/theme.css @@ -0,0 +1,5 @@ +*{-webkit-box-sizing:border-box;-moz-box-sizing:border-box;box-sizing:border-box}article,aside,details,figcaption,figure,footer,header,hgroup,nav,section{display:block}audio,canvas,video{display:inline-block;*display:inline;*zoom:1}audio:not([controls]){display:none}[hidden]{display:none}*{-webkit-box-sizing:border-box;-moz-box-sizing:border-box;box-sizing:border-box}html{font-size:100%;-webkit-text-size-adjust:100%;-ms-text-size-adjust:100%}body{margin:0}a:hover,a:active{outline:0}abbr[title]{border-bottom:1px dotted}b,strong{font-weight:bold}blockquote{margin:0}dfn{font-style:italic}ins{background:#ff9;color:#000;text-decoration:none}mark{background:#ff0;color:#000;font-style:italic;font-weight:bold}pre,code,.rst-content tt,.rst-content code,kbd,samp{font-family:monospace,serif;_font-family:"courier new",monospace;font-size:1em}pre{white-space:pre}q{quotes:none}q:before,q:after{content:"";content:none}small{font-size:85%}sub,sup{font-size:75%;line-height:0;position:relative;vertical-align:baseline}sup{top:-0.5em}sub{bottom:-0.25em}ul,ol,dl{margin:0;padding:0;list-style:none;list-style-image:none}li{list-style:none}dd{margin:0}img{border:0;-ms-interpolation-mode:bicubic;vertical-align:middle;max-width:100%}svg:not(:root){overflow:hidden}figure{margin:0}form{margin:0}fieldset{border:0;margin:0;padding:0}label{cursor:pointer}legend{border:0;*margin-left:-7px;padding:0;white-space:normal}button,input,select,textarea{font-size:100%;margin:0;vertical-align:baseline;*vertical-align:middle}button,input{line-height:normal}button,input[type="button"],input[type="reset"],input[type="submit"]{cursor:pointer;-webkit-appearance:button;*overflow:visible}button[disabled],input[disabled]{cursor:default}input[type="checkbox"],input[type="radio"]{box-sizing:border-box;padding:0;*width:13px;*height:13px}input[type="search"]{-webkit-appearance:textfield;-moz-box-sizing:content-box;-webkit-box-sizing:content-box;box-sizing:content-box}input[type="search"]::-webkit-search-decoration,input[type="search"]::-webkit-search-cancel-button{-webkit-appearance:none}button::-moz-focus-inner,input::-moz-focus-inner{border:0;padding:0}textarea{overflow:auto;vertical-align:top;resize:vertical}table{border-collapse:collapse;border-spacing:0}td{vertical-align:top}.chromeframe{margin:0.2em 0;background:#ccc;color:#000;padding:0.2em 0}.ir{display:block;border:0;text-indent:-999em;overflow:hidden;background-color:transparent;background-repeat:no-repeat;text-align:left;direction:ltr;*line-height:0}.ir br{display:none}.hidden{display:none !important;visibility:hidden}.visuallyhidden{border:0;clip:rect(0 0 0 0);height:1px;margin:-1px;overflow:hidden;padding:0;position:absolute;width:1px}.visuallyhidden.focusable:active,.visuallyhidden.focusable:focus{clip:auto;height:auto;margin:0;overflow:visible;position:static;width:auto}.invisible{visibility:hidden}.relative{position:relative}big,small{font-size:100%}@media print{html,body,section{background:none !important}*{box-shadow:none !important;text-shadow:none !important;filter:none !important;-ms-filter:none !important}a,a:visited{text-decoration:underline}.ir a:after,a[href^="javascript:"]:after,a[href^="#"]:after{content:""}pre,blockquote{page-break-inside:avoid}thead{display:table-header-group}tr,img{page-break-inside:avoid}img{max-width:100% !important}@page{margin:0.5cm}p,h2,.rst-content .toctree-wrapper p.caption,h3{orphans:3;widows:3}h2,.rst-content .toctree-wrapper p.caption,h3{page-break-after:avoid}}.fa:before,.wy-menu-vertical li span.toctree-expand:before,.wy-menu-vertical li.on a span.toctree-expand:before,.wy-menu-vertical li.current>a span.toctree-expand:before,.rst-content .admonition-title:before,.rst-content h1 .headerlink:before,.rst-content h2 .headerlink:before,.rst-content h3 .headerlink:before,.rst-content h4 .headerlink:before,.rst-content h5 .headerlink:before,.rst-content h6 .headerlink:before,.rst-content dl dt .headerlink:before,.rst-content p.caption .headerlink:before,.rst-content tt.download span:first-child:before,.rst-content code.download span:first-child:before,.icon:before,.wy-dropdown .caret:before,.wy-inline-validate.wy-inline-validate-success .wy-input-context:before,.wy-inline-validate.wy-inline-validate-danger .wy-input-context:before,.wy-inline-validate.wy-inline-validate-warning .wy-input-context:before,.wy-inline-validate.wy-inline-validate-info .wy-input-context:before,.wy-alert,.rst-content .note,.rst-content .attention,.rst-content .caution,.rst-content .danger,.rst-content .error,.rst-content .hint,.rst-content .important,.rst-content .tip,.rst-content .warning,.rst-content .seealso,.rst-content .admonition-todo,.btn,input[type="text"],input[type="password"],input[type="email"],input[type="url"],input[type="date"],input[type="month"],input[type="time"],input[type="datetime"],input[type="datetime-local"],input[type="week"],input[type="number"],input[type="search"],input[type="tel"],input[type="color"],select,textarea,.wy-menu-vertical li.on a,.wy-menu-vertical li.current>a,.wy-side-nav-search>a,.wy-side-nav-search .wy-dropdown>a,.wy-nav-top a{-webkit-font-smoothing:antialiased}.clearfix{*zoom:1}.clearfix:before,.clearfix:after{display:table;content:""}.clearfix:after{clear:both}/*! + * Font Awesome 4.7.0 by @davegandy - http://fontawesome.io - @fontawesome + * License - http://fontawesome.io/license (Font: SIL OFL 1.1, CSS: MIT License) + */@font-face{font-family:'FontAwesome';src:url("../fonts/fontawesome-webfont.eot?v=4.7.0");src:url("../fonts/fontawesome-webfont.eot?#iefix&v=4.7.0") format("embedded-opentype"),url("../fonts/fontawesome-webfont.woff2?v=4.7.0") format("woff2"),url("../fonts/fontawesome-webfont.woff?v=4.7.0") format("woff"),url("../fonts/fontawesome-webfont.ttf?v=4.7.0") format("truetype"),url("../fonts/fontawesome-webfont.svg?v=4.7.0#fontawesomeregular") format("svg");font-weight:normal;font-style:normal}.fa,.wy-menu-vertical li span.toctree-expand,.wy-menu-vertical li.on a span.toctree-expand,.wy-menu-vertical li.current>a span.toctree-expand,.rst-content .admonition-title,.rst-content h1 .headerlink,.rst-content h2 .headerlink,.rst-content h3 .headerlink,.rst-content h4 .headerlink,.rst-content h5 .headerlink,.rst-content h6 .headerlink,.rst-content dl dt .headerlink,.rst-content p.caption .headerlink,.rst-content tt.download span:first-child,.rst-content code.download span:first-child,.icon{display:inline-block;font:normal normal normal 14px/1 FontAwesome;font-size:inherit;text-rendering:auto;-webkit-font-smoothing:antialiased;-moz-osx-font-smoothing:grayscale}.fa-lg{font-size:1.33333em;line-height:.75em;vertical-align:-15%}.fa-2x{font-size:2em}.fa-3x{font-size:3em}.fa-4x{font-size:4em}.fa-5x{font-size:5em}.fa-fw{width:1.28571em;text-align:center}.fa-ul{padding-left:0;margin-left:2.14286em;list-style-type:none}.fa-ul>li{position:relative}.fa-li{position:absolute;left:-2.14286em;width:2.14286em;top:.14286em;text-align:center}.fa-li.fa-lg{left:-1.85714em}.fa-border{padding:.2em .25em .15em;border:solid 0.08em #eee;border-radius:.1em}.fa-pull-left{float:left}.fa-pull-right{float:right}.fa.fa-pull-left,.wy-menu-vertical li span.fa-pull-left.toctree-expand,.wy-menu-vertical li.on a span.fa-pull-left.toctree-expand,.wy-menu-vertical li.current>a span.fa-pull-left.toctree-expand,.rst-content .fa-pull-left.admonition-title,.rst-content h1 .fa-pull-left.headerlink,.rst-content h2 .fa-pull-left.headerlink,.rst-content h3 .fa-pull-left.headerlink,.rst-content h4 .fa-pull-left.headerlink,.rst-content h5 .fa-pull-left.headerlink,.rst-content h6 .fa-pull-left.headerlink,.rst-content dl dt .fa-pull-left.headerlink,.rst-content p.caption .fa-pull-left.headerlink,.rst-content tt.download span.fa-pull-left:first-child,.rst-content code.download span.fa-pull-left:first-child,.fa-pull-left.icon{margin-right:.3em}.fa.fa-pull-right,.wy-menu-vertical li span.fa-pull-right.toctree-expand,.wy-menu-vertical li.on a span.fa-pull-right.toctree-expand,.wy-menu-vertical li.current>a span.fa-pull-right.toctree-expand,.rst-content .fa-pull-right.admonition-title,.rst-content h1 .fa-pull-right.headerlink,.rst-content h2 .fa-pull-right.headerlink,.rst-content h3 .fa-pull-right.headerlink,.rst-content h4 .fa-pull-right.headerlink,.rst-content h5 .fa-pull-right.headerlink,.rst-content h6 .fa-pull-right.headerlink,.rst-content dl dt .fa-pull-right.headerlink,.rst-content p.caption .fa-pull-right.headerlink,.rst-content tt.download span.fa-pull-right:first-child,.rst-content code.download span.fa-pull-right:first-child,.fa-pull-right.icon{margin-left:.3em}.pull-right{float:right}.pull-left{float:left}.fa.pull-left,.wy-menu-vertical li span.pull-left.toctree-expand,.wy-menu-vertical li.on a span.pull-left.toctree-expand,.wy-menu-vertical li.current>a span.pull-left.toctree-expand,.rst-content .pull-left.admonition-title,.rst-content h1 .pull-left.headerlink,.rst-content h2 .pull-left.headerlink,.rst-content h3 .pull-left.headerlink,.rst-content h4 .pull-left.headerlink,.rst-content h5 .pull-left.headerlink,.rst-content h6 .pull-left.headerlink,.rst-content dl dt .pull-left.headerlink,.rst-content p.caption .pull-left.headerlink,.rst-content tt.download span.pull-left:first-child,.rst-content code.download span.pull-left:first-child,.pull-left.icon{margin-right:.3em}.fa.pull-right,.wy-menu-vertical li span.pull-right.toctree-expand,.wy-menu-vertical li.on a span.pull-right.toctree-expand,.wy-menu-vertical li.current>a span.pull-right.toctree-expand,.rst-content .pull-right.admonition-title,.rst-content h1 .pull-right.headerlink,.rst-content h2 .pull-right.headerlink,.rst-content h3 .pull-right.headerlink,.rst-content h4 .pull-right.headerlink,.rst-content h5 .pull-right.headerlink,.rst-content h6 .pull-right.headerlink,.rst-content dl dt .pull-right.headerlink,.rst-content p.caption .pull-right.headerlink,.rst-content tt.download span.pull-right:first-child,.rst-content code.download span.pull-right:first-child,.pull-right.icon{margin-left:.3em}.fa-spin{-webkit-animation:fa-spin 2s infinite linear;animation:fa-spin 2s infinite linear}.fa-pulse{-webkit-animation:fa-spin 1s infinite steps(8);animation:fa-spin 1s infinite steps(8)}@-webkit-keyframes fa-spin{0%{-webkit-transform:rotate(0deg);transform:rotate(0deg)}100%{-webkit-transform:rotate(359deg);transform:rotate(359deg)}}@keyframes fa-spin{0%{-webkit-transform:rotate(0deg);transform:rotate(0deg)}100%{-webkit-transform:rotate(359deg);transform:rotate(359deg)}}.fa-rotate-90{-ms-filter:"progid:DXImageTransform.Microsoft.BasicImage(rotation=1)";-webkit-transform:rotate(90deg);-ms-transform:rotate(90deg);transform:rotate(90deg)}.fa-rotate-180{-ms-filter:"progid:DXImageTransform.Microsoft.BasicImage(rotation=2)";-webkit-transform:rotate(180deg);-ms-transform:rotate(180deg);transform:rotate(180deg)}.fa-rotate-270{-ms-filter:"progid:DXImageTransform.Microsoft.BasicImage(rotation=3)";-webkit-transform:rotate(270deg);-ms-transform:rotate(270deg);transform:rotate(270deg)}.fa-flip-horizontal{-ms-filter:"progid:DXImageTransform.Microsoft.BasicImage(rotation=0, mirror=1)";-webkit-transform:scale(-1, 1);-ms-transform:scale(-1, 1);transform:scale(-1, 1)}.fa-flip-vertical{-ms-filter:"progid:DXImageTransform.Microsoft.BasicImage(rotation=2, mirror=1)";-webkit-transform:scale(1, -1);-ms-transform:scale(1, -1);transform:scale(1, -1)}:root .fa-rotate-90,:root .fa-rotate-180,:root .fa-rotate-270,:root .fa-flip-horizontal,:root .fa-flip-vertical{filter:none}.fa-stack{position:relative;display:inline-block;width:2em;height:2em;line-height:2em;vertical-align:middle}.fa-stack-1x,.fa-stack-2x{position:absolute;left:0;width:100%;text-align:center}.fa-stack-1x{line-height:inherit}.fa-stack-2x{font-size:2em}.fa-inverse{color:#fff}.fa-glass:before{content:"ï"}.fa-music:before{content:"ï"}.fa-search:before,.icon-search:before{content:"ï"}.fa-envelope-o:before{content:"ï"}.fa-heart:before{content:"ï"}.fa-star:before{content:"ï "}.fa-star-o:before{content:"ï"}.fa-user:before{content:"ï"}.fa-film:before{content:"ï"}.fa-th-large:before{content:"ï"}.fa-th:before{content:"ï"}.fa-th-list:before{content:"ï"}.fa-check:before{content:"ï"}.fa-remove:before,.fa-close:before,.fa-times:before{content:"ï"}.fa-search-plus:before{content:"ï"}.fa-search-minus:before{content:"ï"}.fa-power-off:before{content:"ï"}.fa-signal:before{content:"ï"}.fa-gear:before,.fa-cog:before{content:"ï"}.fa-trash-o:before{content:"ï"}.fa-home:before,.icon-home:before{content:"ï"}.fa-file-o:before{content:"ï"}.fa-clock-o:before{content:"ï"}.fa-road:before{content:"ï"}.fa-download:before,.rst-content tt.download span:first-child:before,.rst-content code.download span:first-child:before{content:"ï"}.fa-arrow-circle-o-down:before{content:"ï"}.fa-arrow-circle-o-up:before{content:"ï"}.fa-inbox:before{content:"ï"}.fa-play-circle-o:before{content:"ï"}.fa-rotate-right:before,.fa-repeat:before{content:"ï"}.fa-refresh:before{content:"ï¡"}.fa-list-alt:before{content:"ï¢"}.fa-lock:before{content:"ï£"}.fa-flag:before{content:"ï¤"}.fa-headphones:before{content:"ï¥"}.fa-volume-off:before{content:"ï¦"}.fa-volume-down:before{content:"ï§"}.fa-volume-up:before{content:"ï¨"}.fa-qrcode:before{content:"ï©"}.fa-barcode:before{content:"ïª"}.fa-tag:before{content:"ï«"}.fa-tags:before{content:"ï¬"}.fa-book:before,.icon-book:before{content:"ï"}.fa-bookmark:before{content:"ï®"}.fa-print:before{content:"ï¯"}.fa-camera:before{content:"ï°"}.fa-font:before{content:"ï±"}.fa-bold:before{content:"ï²"}.fa-italic:before{content:"ï³"}.fa-text-height:before{content:"ï´"}.fa-text-width:before{content:"ïµ"}.fa-align-left:before{content:"ï¶"}.fa-align-center:before{content:"ï·"}.fa-align-right:before{content:"ï¸"}.fa-align-justify:before{content:"ï¹"}.fa-list:before{content:"ïº"}.fa-dedent:before,.fa-outdent:before{content:"ï»"}.fa-indent:before{content:"ï¼"}.fa-video-camera:before{content:"ï½"}.fa-photo:before,.fa-image:before,.fa-picture-o:before{content:"ï¾"}.fa-pencil:before{content:"ï"}.fa-map-marker:before{content:"ï"}.fa-adjust:before{content:"ï"}.fa-tint:before{content:"ï"}.fa-edit:before,.fa-pencil-square-o:before{content:"ï"}.fa-share-square-o:before{content:"ï "}.fa-check-square-o:before{content:"ï"}.fa-arrows:before{content:"ï"}.fa-step-backward:before{content:"ï"}.fa-fast-backward:before{content:"ï"}.fa-backward:before{content:"ï"}.fa-play:before{content:"ï"}.fa-pause:before{content:"ï"}.fa-stop:before{content:"ï"}.fa-forward:before{content:"ï"}.fa-fast-forward:before{content:"ï"}.fa-step-forward:before{content:"ï"}.fa-eject:before{content:"ï"}.fa-chevron-left:before{content:"ï"}.fa-chevron-right:before{content:"ï"}.fa-plus-circle:before{content:"ï"}.fa-minus-circle:before{content:"ï"}.fa-times-circle:before,.wy-inline-validate.wy-inline-validate-danger .wy-input-context:before{content:"ï"}.fa-check-circle:before,.wy-inline-validate.wy-inline-validate-success .wy-input-context:before{content:"ï"}.fa-question-circle:before{content:"ï"}.fa-info-circle:before{content:"ï"}.fa-crosshairs:before{content:"ï"}.fa-times-circle-o:before{content:"ï"}.fa-check-circle-o:before{content:"ï"}.fa-ban:before{content:"ï"}.fa-arrow-left:before{content:"ï "}.fa-arrow-right:before{content:"ï¡"}.fa-arrow-up:before{content:"ï¢"}.fa-arrow-down:before{content:"ï£"}.fa-mail-forward:before,.fa-share:before{content:"ï¤"}.fa-expand:before{content:"ï¥"}.fa-compress:before{content:"ï¦"}.fa-plus:before{content:"ï§"}.fa-minus:before{content:"ï¨"}.fa-asterisk:before{content:"ï©"}.fa-exclamation-circle:before,.wy-inline-validate.wy-inline-validate-warning .wy-input-context:before,.wy-inline-validate.wy-inline-validate-info .wy-input-context:before,.rst-content .admonition-title:before{content:"ïª"}.fa-gift:before{content:"ï«"}.fa-leaf:before{content:"ï¬"}.fa-fire:before,.icon-fire:before{content:"ï"}.fa-eye:before{content:"ï®"}.fa-eye-slash:before{content:"ï°"}.fa-warning:before,.fa-exclamation-triangle:before{content:"ï±"}.fa-plane:before{content:"ï²"}.fa-calendar:before{content:"ï³"}.fa-random:before{content:"ï´"}.fa-comment:before{content:"ïµ"}.fa-magnet:before{content:"ï¶"}.fa-chevron-up:before{content:"ï·"}.fa-chevron-down:before{content:"ï¸"}.fa-retweet:before{content:"ï¹"}.fa-shopping-cart:before{content:"ïº"}.fa-folder:before{content:"ï»"}.fa-folder-open:before{content:"ï¼"}.fa-arrows-v:before{content:"ï½"}.fa-arrows-h:before{content:"ï¾"}.fa-bar-chart-o:before,.fa-bar-chart:before{content:"ï"}.fa-twitter-square:before{content:"ï"}.fa-facebook-square:before{content:"ï"}.fa-camera-retro:before{content:"ï"}.fa-key:before{content:"ï"}.fa-gears:before,.fa-cogs:before{content:"ï "}.fa-comments:before{content:"ï"}.fa-thumbs-o-up:before{content:"ï"}.fa-thumbs-o-down:before{content:"ï"}.fa-star-half:before{content:"ï"}.fa-heart-o:before{content:"ï"}.fa-sign-out:before{content:"ï"}.fa-linkedin-square:before{content:"ï"}.fa-thumb-tack:before{content:"ï"}.fa-external-link:before{content:"ï"}.fa-sign-in:before{content:"ï"}.fa-trophy:before{content:"ï"}.fa-github-square:before{content:"ï"}.fa-upload:before{content:"ï"}.fa-lemon-o:before{content:"ï"}.fa-phone:before{content:"ï"}.fa-square-o:before{content:"ï"}.fa-bookmark-o:before{content:"ï"}.fa-phone-square:before{content:"ï"}.fa-twitter:before{content:"ï"}.fa-facebook-f:before,.fa-facebook:before{content:"ï"}.fa-github:before,.icon-github:before{content:"ï"}.fa-unlock:before{content:"ï"}.fa-credit-card:before{content:"ï"}.fa-feed:before,.fa-rss:before{content:"ï"}.fa-hdd-o:before{content:"ï "}.fa-bullhorn:before{content:"ï¡"}.fa-bell:before{content:"ï³"}.fa-certificate:before{content:"ï£"}.fa-hand-o-right:before{content:"ï¤"}.fa-hand-o-left:before{content:"ï¥"}.fa-hand-o-up:before{content:"ï¦"}.fa-hand-o-down:before{content:"ï§"}.fa-arrow-circle-left:before,.icon-circle-arrow-left:before{content:"ï¨"}.fa-arrow-circle-right:before,.icon-circle-arrow-right:before{content:"ï©"}.fa-arrow-circle-up:before{content:"ïª"}.fa-arrow-circle-down:before{content:"ï«"}.fa-globe:before{content:"ï¬"}.fa-wrench:before{content:"ï"}.fa-tasks:before{content:"ï®"}.fa-filter:before{content:"ï°"}.fa-briefcase:before{content:"ï±"}.fa-arrows-alt:before{content:"ï²"}.fa-group:before,.fa-users:before{content:"ï"}.fa-chain:before,.fa-link:before,.icon-link:before{content:"ï"}.fa-cloud:before{content:"ï"}.fa-flask:before{content:"ï"}.fa-cut:before,.fa-scissors:before{content:"ï"}.fa-copy:before,.fa-files-o:before{content:"ï "}.fa-paperclip:before{content:"ï"}.fa-save:before,.fa-floppy-o:before{content:"ï"}.fa-square:before{content:"ï"}.fa-navicon:before,.fa-reorder:before,.fa-bars:before{content:"ï"}.fa-list-ul:before{content:"ï"}.fa-list-ol:before{content:"ï"}.fa-strikethrough:before{content:"ï"}.fa-underline:before{content:"ï"}.fa-table:before{content:"ï"}.fa-magic:before{content:"ï"}.fa-truck:before{content:"ï"}.fa-pinterest:before{content:"ï"}.fa-pinterest-square:before{content:"ï"}.fa-google-plus-square:before{content:"ï"}.fa-google-plus:before{content:"ï"}.fa-money:before{content:"ï"}.fa-caret-down:before,.wy-dropdown .caret:before,.icon-caret-down:before{content:"ï"}.fa-caret-up:before{content:"ï"}.fa-caret-left:before{content:"ï"}.fa-caret-right:before{content:"ï"}.fa-columns:before{content:"ï"}.fa-unsorted:before,.fa-sort:before{content:"ï"}.fa-sort-down:before,.fa-sort-desc:before{content:"ï"}.fa-sort-up:before,.fa-sort-asc:before{content:"ï"}.fa-envelope:before{content:"ï "}.fa-linkedin:before{content:"ï¡"}.fa-rotate-left:before,.fa-undo:before{content:"ï¢"}.fa-legal:before,.fa-gavel:before{content:"ï£"}.fa-dashboard:before,.fa-tachometer:before{content:"ï¤"}.fa-comment-o:before{content:"ï¥"}.fa-comments-o:before{content:"ï¦"}.fa-flash:before,.fa-bolt:before{content:"ï§"}.fa-sitemap:before{content:"ï¨"}.fa-umbrella:before{content:"ï©"}.fa-paste:before,.fa-clipboard:before{content:"ïª"}.fa-lightbulb-o:before{content:"ï«"}.fa-exchange:before{content:"ï¬"}.fa-cloud-download:before{content:"ï"}.fa-cloud-upload:before{content:"ï®"}.fa-user-md:before{content:"ï°"}.fa-stethoscope:before{content:"ï±"}.fa-suitcase:before{content:"ï²"}.fa-bell-o:before{content:"ï¢"}.fa-coffee:before{content:"ï´"}.fa-cutlery:before{content:"ïµ"}.fa-file-text-o:before{content:"ï¶"}.fa-building-o:before{content:"ï·"}.fa-hospital-o:before{content:"ï¸"}.fa-ambulance:before{content:"ï¹"}.fa-medkit:before{content:"ïº"}.fa-fighter-jet:before{content:"ï»"}.fa-beer:before{content:"ï¼"}.fa-h-square:before{content:"ï½"}.fa-plus-square:before{content:"ï¾"}.fa-angle-double-left:before{content:"ï"}.fa-angle-double-right:before{content:"ï"}.fa-angle-double-up:before{content:"ï"}.fa-angle-double-down:before{content:"ï"}.fa-angle-left:before{content:"ï"}.fa-angle-right:before{content:"ï "}.fa-angle-up:before{content:"ï"}.fa-angle-down:before{content:"ï"}.fa-desktop:before{content:"ï"}.fa-laptop:before{content:"ï"}.fa-tablet:before{content:"ï"}.fa-mobile-phone:before,.fa-mobile:before{content:"ï"}.fa-circle-o:before{content:"ï"}.fa-quote-left:before{content:"ï"}.fa-quote-right:before{content:"ï"}.fa-spinner:before{content:"ï"}.fa-circle:before{content:"ï"}.fa-mail-reply:before,.fa-reply:before{content:"ï"}.fa-github-alt:before{content:"ï"}.fa-folder-o:before{content:"ï"}.fa-folder-open-o:before{content:"ï"}.fa-smile-o:before{content:"ï"}.fa-frown-o:before{content:"ï"}.fa-meh-o:before{content:"ï"}.fa-gamepad:before{content:"ï"}.fa-keyboard-o:before{content:"ï"}.fa-flag-o:before{content:"ï"}.fa-flag-checkered:before{content:"ï"}.fa-terminal:before{content:"ï "}.fa-code:before{content:"ï¡"}.fa-mail-reply-all:before,.fa-reply-all:before{content:"ï¢"}.fa-star-half-empty:before,.fa-star-half-full:before,.fa-star-half-o:before{content:"ï£"}.fa-location-arrow:before{content:"ï¤"}.fa-crop:before{content:"ï¥"}.fa-code-fork:before{content:"ï¦"}.fa-unlink:before,.fa-chain-broken:before{content:"ï§"}.fa-question:before{content:"ï¨"}.fa-info:before{content:"ï©"}.fa-exclamation:before{content:"ïª"}.fa-superscript:before{content:"ï«"}.fa-subscript:before{content:"ï¬"}.fa-eraser:before{content:"ï"}.fa-puzzle-piece:before{content:"ï®"}.fa-microphone:before{content:"ï°"}.fa-microphone-slash:before{content:"ï±"}.fa-shield:before{content:"ï²"}.fa-calendar-o:before{content:"ï³"}.fa-fire-extinguisher:before{content:"ï´"}.fa-rocket:before{content:"ïµ"}.fa-maxcdn:before{content:"ï¶"}.fa-chevron-circle-left:before{content:"ï·"}.fa-chevron-circle-right:before{content:"ï¸"}.fa-chevron-circle-up:before{content:"ï¹"}.fa-chevron-circle-down:before{content:"ïº"}.fa-html5:before{content:"ï»"}.fa-css3:before{content:"ï¼"}.fa-anchor:before{content:"ï½"}.fa-unlock-alt:before{content:"ï¾"}.fa-bullseye:before{content:"ï "}.fa-ellipsis-h:before{content:"ï "}.fa-ellipsis-v:before{content:"ï "}.fa-rss-square:before{content:"ï "}.fa-play-circle:before{content:"ï "}.fa-ticket:before{content:"ï "}.fa-minus-square:before{content:"ï "}.fa-minus-square-o:before,.wy-menu-vertical li.on a span.toctree-expand:before,.wy-menu-vertical li.current>a span.toctree-expand:before{content:"ï "}.fa-level-up:before{content:"ï "}.fa-level-down:before{content:"ï "}.fa-check-square:before{content:"ï "}.fa-pencil-square:before{content:"ï "}.fa-external-link-square:before{content:"ï "}.fa-share-square:before{content:"ï "}.fa-compass:before{content:"ï "}.fa-toggle-down:before,.fa-caret-square-o-down:before{content:"ï "}.fa-toggle-up:before,.fa-caret-square-o-up:before{content:"ï "}.fa-toggle-right:before,.fa-caret-square-o-right:before{content:"ï "}.fa-euro:before,.fa-eur:before{content:"ï "}.fa-gbp:before{content:"ï "}.fa-dollar:before,.fa-usd:before{content:"ï "}.fa-rupee:before,.fa-inr:before{content:"ï "}.fa-cny:before,.fa-rmb:before,.fa-yen:before,.fa-jpy:before{content:"ï "}.fa-ruble:before,.fa-rouble:before,.fa-rub:before{content:"ï "}.fa-won:before,.fa-krw:before{content:"ï "}.fa-bitcoin:before,.fa-btc:before{content:"ï "}.fa-file:before{content:"ï "}.fa-file-text:before{content:"ï "}.fa-sort-alpha-asc:before{content:"ï "}.fa-sort-alpha-desc:before{content:"ï "}.fa-sort-amount-asc:before{content:"ï "}.fa-sort-amount-desc:before{content:"ï ¡"}.fa-sort-numeric-asc:before{content:"ï ¢"}.fa-sort-numeric-desc:before{content:"ï £"}.fa-thumbs-up:before{content:"ï ¤"}.fa-thumbs-down:before{content:"ï ¥"}.fa-youtube-square:before{content:"ï ¦"}.fa-youtube:before{content:"ï §"}.fa-xing:before{content:"ï ¨"}.fa-xing-square:before{content:"ï ©"}.fa-youtube-play:before{content:"ï ª"}.fa-dropbox:before{content:"ï «"}.fa-stack-overflow:before{content:"ï ¬"}.fa-instagram:before{content:"ï "}.fa-flickr:before{content:"ï ®"}.fa-adn:before{content:"ï °"}.fa-bitbucket:before,.icon-bitbucket:before{content:"ï ±"}.fa-bitbucket-square:before{content:"ï ²"}.fa-tumblr:before{content:"ï ³"}.fa-tumblr-square:before{content:"ï ´"}.fa-long-arrow-down:before{content:"ï µ"}.fa-long-arrow-up:before{content:"ï ¶"}.fa-long-arrow-left:before{content:"ï ·"}.fa-long-arrow-right:before{content:"ï ¸"}.fa-apple:before{content:"ï ¹"}.fa-windows:before{content:"ï º"}.fa-android:before{content:"ï »"}.fa-linux:before{content:"ï ¼"}.fa-dribbble:before{content:"ï ½"}.fa-skype:before{content:"ï ¾"}.fa-foursquare:before{content:"ï"}.fa-trello:before{content:"ï"}.fa-female:before{content:"ï"}.fa-male:before{content:"ï"}.fa-gittip:before,.fa-gratipay:before{content:"ï"}.fa-sun-o:before{content:"ï "}.fa-moon-o:before{content:"ï"}.fa-archive:before{content:"ï"}.fa-bug:before{content:"ï"}.fa-vk:before{content:"ï"}.fa-weibo:before{content:"ï"}.fa-renren:before{content:"ï"}.fa-pagelines:before{content:"ï"}.fa-stack-exchange:before{content:"ï"}.fa-arrow-circle-o-right:before{content:"ï"}.fa-arrow-circle-o-left:before{content:"ï"}.fa-toggle-left:before,.fa-caret-square-o-left:before{content:"ï"}.fa-dot-circle-o:before{content:"ï"}.fa-wheelchair:before{content:"ï"}.fa-vimeo-square:before{content:"ï"}.fa-turkish-lira:before,.fa-try:before{content:"ï"}.fa-plus-square-o:before,.wy-menu-vertical li span.toctree-expand:before{content:"ï"}.fa-space-shuttle:before{content:"ï"}.fa-slack:before{content:"ï"}.fa-envelope-square:before{content:"ï"}.fa-wordpress:before{content:"ï"}.fa-openid:before{content:"ï"}.fa-institution:before,.fa-bank:before,.fa-university:before{content:"ï"}.fa-mortar-board:before,.fa-graduation-cap:before{content:"ï"}.fa-yahoo:before{content:"ï"}.fa-google:before{content:"ï "}.fa-reddit:before{content:"ï¡"}.fa-reddit-square:before{content:"ï¢"}.fa-stumbleupon-circle:before{content:"ï£"}.fa-stumbleupon:before{content:"ï¤"}.fa-delicious:before{content:"ï¥"}.fa-digg:before{content:"ï¦"}.fa-pied-piper-pp:before{content:"ï§"}.fa-pied-piper-alt:before{content:"ï¨"}.fa-drupal:before{content:"ï©"}.fa-joomla:before{content:"ïª"}.fa-language:before{content:"ï«"}.fa-fax:before{content:"ï¬"}.fa-building:before{content:"ï"}.fa-child:before{content:"ï®"}.fa-paw:before{content:"ï°"}.fa-spoon:before{content:"ï±"}.fa-cube:before{content:"ï²"}.fa-cubes:before{content:"ï³"}.fa-behance:before{content:"ï´"}.fa-behance-square:before{content:"ïµ"}.fa-steam:before{content:"ï¶"}.fa-steam-square:before{content:"ï·"}.fa-recycle:before{content:"ï¸"}.fa-automobile:before,.fa-car:before{content:"ï¹"}.fa-cab:before,.fa-taxi:before{content:"ïº"}.fa-tree:before{content:"ï»"}.fa-spotify:before{content:"ï¼"}.fa-deviantart:before{content:"ï½"}.fa-soundcloud:before{content:"ï¾"}.fa-database:before{content:"ï"}.fa-file-pdf-o:before{content:"ï"}.fa-file-word-o:before{content:"ï"}.fa-file-excel-o:before{content:"ï"}.fa-file-powerpoint-o:before{content:"ï"}.fa-file-photo-o:before,.fa-file-picture-o:before,.fa-file-image-o:before{content:"ï "}.fa-file-zip-o:before,.fa-file-archive-o:before{content:"ï"}.fa-file-sound-o:before,.fa-file-audio-o:before{content:"ï"}.fa-file-movie-o:before,.fa-file-video-o:before{content:"ï"}.fa-file-code-o:before{content:"ï"}.fa-vine:before{content:"ï"}.fa-codepen:before{content:"ï"}.fa-jsfiddle:before{content:"ï"}.fa-life-bouy:before,.fa-life-buoy:before,.fa-life-saver:before,.fa-support:before,.fa-life-ring:before{content:"ï"}.fa-circle-o-notch:before{content:"ï"}.fa-ra:before,.fa-resistance:before,.fa-rebel:before{content:"ï"}.fa-ge:before,.fa-empire:before{content:"ï"}.fa-git-square:before{content:"ï"}.fa-git:before{content:"ï"}.fa-y-combinator-square:before,.fa-yc-square:before,.fa-hacker-news:before{content:"ï"}.fa-tencent-weibo:before{content:"ï"}.fa-qq:before{content:"ï"}.fa-wechat:before,.fa-weixin:before{content:"ï"}.fa-send:before,.fa-paper-plane:before{content:"ï"}.fa-send-o:before,.fa-paper-plane-o:before{content:"ï"}.fa-history:before{content:"ï"}.fa-circle-thin:before{content:"ï"}.fa-header:before{content:"ï"}.fa-paragraph:before{content:"ï"}.fa-sliders:before{content:"ï"}.fa-share-alt:before{content:"ï "}.fa-share-alt-square:before{content:"ï¡"}.fa-bomb:before{content:"ï¢"}.fa-soccer-ball-o:before,.fa-futbol-o:before{content:"ï£"}.fa-tty:before{content:"ï¤"}.fa-binoculars:before{content:"ï¥"}.fa-plug:before{content:"ï¦"}.fa-slideshare:before{content:"ï§"}.fa-twitch:before{content:"ï¨"}.fa-yelp:before{content:"ï©"}.fa-newspaper-o:before{content:"ïª"}.fa-wifi:before{content:"ï«"}.fa-calculator:before{content:"ï¬"}.fa-paypal:before{content:"ï"}.fa-google-wallet:before{content:"ï®"}.fa-cc-visa:before{content:"ï°"}.fa-cc-mastercard:before{content:"ï±"}.fa-cc-discover:before{content:"ï²"}.fa-cc-amex:before{content:"ï³"}.fa-cc-paypal:before{content:"ï´"}.fa-cc-stripe:before{content:"ïµ"}.fa-bell-slash:before{content:"ï¶"}.fa-bell-slash-o:before{content:"ï·"}.fa-trash:before{content:"ï¸"}.fa-copyright:before{content:"ï¹"}.fa-at:before{content:"ïº"}.fa-eyedropper:before{content:"ï»"}.fa-paint-brush:before{content:"ï¼"}.fa-birthday-cake:before{content:"ï½"}.fa-area-chart:before{content:"ï¾"}.fa-pie-chart:before{content:"ï"}.fa-line-chart:before{content:"ï"}.fa-lastfm:before{content:"ï"}.fa-lastfm-square:before{content:"ï"}.fa-toggle-off:before{content:"ï"}.fa-toggle-on:before{content:"ï "}.fa-bicycle:before{content:"ï"}.fa-bus:before{content:"ï"}.fa-ioxhost:before{content:"ï"}.fa-angellist:before{content:"ï"}.fa-cc:before{content:"ï"}.fa-shekel:before,.fa-sheqel:before,.fa-ils:before{content:"ï"}.fa-meanpath:before{content:"ï"}.fa-buysellads:before{content:"ï"}.fa-connectdevelop:before{content:"ï"}.fa-dashcube:before{content:"ï"}.fa-forumbee:before{content:"ï"}.fa-leanpub:before{content:"ï"}.fa-sellsy:before{content:"ï"}.fa-shirtsinbulk:before{content:"ï"}.fa-simplybuilt:before{content:"ï"}.fa-skyatlas:before{content:"ï"}.fa-cart-plus:before{content:"ï"}.fa-cart-arrow-down:before{content:"ï"}.fa-diamond:before{content:"ï"}.fa-ship:before{content:"ï"}.fa-user-secret:before{content:"ï"}.fa-motorcycle:before{content:"ï"}.fa-street-view:before{content:"ï"}.fa-heartbeat:before{content:"ï"}.fa-venus:before{content:"ï¡"}.fa-mars:before{content:"ï¢"}.fa-mercury:before{content:"ï£"}.fa-intersex:before,.fa-transgender:before{content:"ï¤"}.fa-transgender-alt:before{content:"ï¥"}.fa-venus-double:before{content:"ï¦"}.fa-mars-double:before{content:"ï§"}.fa-venus-mars:before{content:"ï¨"}.fa-mars-stroke:before{content:"ï©"}.fa-mars-stroke-v:before{content:"ïª"}.fa-mars-stroke-h:before{content:"ï«"}.fa-neuter:before{content:"ï¬"}.fa-genderless:before{content:"ï"}.fa-facebook-official:before{content:"ï°"}.fa-pinterest-p:before{content:"ï±"}.fa-whatsapp:before{content:"ï²"}.fa-server:before{content:"ï³"}.fa-user-plus:before{content:"ï´"}.fa-user-times:before{content:"ïµ"}.fa-hotel:before,.fa-bed:before{content:"ï¶"}.fa-viacoin:before{content:"ï·"}.fa-train:before{content:"ï¸"}.fa-subway:before{content:"ï¹"}.fa-medium:before{content:"ïº"}.fa-yc:before,.fa-y-combinator:before{content:"ï»"}.fa-optin-monster:before{content:"ï¼"}.fa-opencart:before{content:"ï½"}.fa-expeditedssl:before{content:"ï¾"}.fa-battery-4:before,.fa-battery:before,.fa-battery-full:before{content:"ï"}.fa-battery-3:before,.fa-battery-three-quarters:before{content:"ï"}.fa-battery-2:before,.fa-battery-half:before{content:"ï"}.fa-battery-1:before,.fa-battery-quarter:before{content:"ï"}.fa-battery-0:before,.fa-battery-empty:before{content:"ï"}.fa-mouse-pointer:before{content:"ï "}.fa-i-cursor:before{content:"ï"}.fa-object-group:before{content:"ï"}.fa-object-ungroup:before{content:"ï"}.fa-sticky-note:before{content:"ï"}.fa-sticky-note-o:before{content:"ï"}.fa-cc-jcb:before{content:"ï"}.fa-cc-diners-club:before{content:"ï"}.fa-clone:before{content:"ï"}.fa-balance-scale:before{content:"ï"}.fa-hourglass-o:before{content:"ï"}.fa-hourglass-1:before,.fa-hourglass-start:before{content:"ï"}.fa-hourglass-2:before,.fa-hourglass-half:before{content:"ï"}.fa-hourglass-3:before,.fa-hourglass-end:before{content:"ï"}.fa-hourglass:before{content:"ï"}.fa-hand-grab-o:before,.fa-hand-rock-o:before{content:"ï"}.fa-hand-stop-o:before,.fa-hand-paper-o:before{content:"ï"}.fa-hand-scissors-o:before{content:"ï"}.fa-hand-lizard-o:before{content:"ï"}.fa-hand-spock-o:before{content:"ï"}.fa-hand-pointer-o:before{content:"ï"}.fa-hand-peace-o:before{content:"ï"}.fa-trademark:before{content:"ï"}.fa-registered:before{content:"ï"}.fa-creative-commons:before{content:"ï"}.fa-gg:before{content:"ï "}.fa-gg-circle:before{content:"ï¡"}.fa-tripadvisor:before{content:"ï¢"}.fa-odnoklassniki:before{content:"ï£"}.fa-odnoklassniki-square:before{content:"ï¤"}.fa-get-pocket:before{content:"ï¥"}.fa-wikipedia-w:before{content:"ï¦"}.fa-safari:before{content:"ï§"}.fa-chrome:before{content:"ï¨"}.fa-firefox:before{content:"ï©"}.fa-opera:before{content:"ïª"}.fa-internet-explorer:before{content:"ï«"}.fa-tv:before,.fa-television:before{content:"ï¬"}.fa-contao:before{content:"ï"}.fa-500px:before{content:"ï®"}.fa-amazon:before{content:"ï°"}.fa-calendar-plus-o:before{content:"ï±"}.fa-calendar-minus-o:before{content:"ï²"}.fa-calendar-times-o:before{content:"ï³"}.fa-calendar-check-o:before{content:"ï´"}.fa-industry:before{content:"ïµ"}.fa-map-pin:before{content:"ï¶"}.fa-map-signs:before{content:"ï·"}.fa-map-o:before{content:"ï¸"}.fa-map:before{content:"ï¹"}.fa-commenting:before{content:"ïº"}.fa-commenting-o:before{content:"ï»"}.fa-houzz:before{content:"ï¼"}.fa-vimeo:before{content:"ï½"}.fa-black-tie:before{content:"ï¾"}.fa-fonticons:before{content:"ï"}.fa-reddit-alien:before{content:"ï"}.fa-edge:before{content:"ï"}.fa-credit-card-alt:before{content:"ï"}.fa-codiepie:before{content:"ï"}.fa-modx:before{content:"ï "}.fa-fort-awesome:before{content:"ï"}.fa-usb:before{content:"ï"}.fa-product-hunt:before{content:"ï"}.fa-mixcloud:before{content:"ï"}.fa-scribd:before{content:"ï"}.fa-pause-circle:before{content:"ï"}.fa-pause-circle-o:before{content:"ï"}.fa-stop-circle:before{content:"ï"}.fa-stop-circle-o:before{content:"ï"}.fa-shopping-bag:before{content:"ï"}.fa-shopping-basket:before{content:"ï"}.fa-hashtag:before{content:"ï"}.fa-bluetooth:before{content:"ï"}.fa-bluetooth-b:before{content:"ï"}.fa-percent:before{content:"ï"}.fa-gitlab:before,.icon-gitlab:before{content:"ï"}.fa-wpbeginner:before{content:"ï"}.fa-wpforms:before{content:"ï"}.fa-envira:before{content:"ï"}.fa-universal-access:before{content:"ï"}.fa-wheelchair-alt:before{content:"ï"}.fa-question-circle-o:before{content:"ï"}.fa-blind:before{content:"ï"}.fa-audio-description:before{content:"ï"}.fa-volume-control-phone:before{content:"ï "}.fa-braille:before{content:"ï¡"}.fa-assistive-listening-systems:before{content:"ï¢"}.fa-asl-interpreting:before,.fa-american-sign-language-interpreting:before{content:"ï£"}.fa-deafness:before,.fa-hard-of-hearing:before,.fa-deaf:before{content:"ï¤"}.fa-glide:before{content:"ï¥"}.fa-glide-g:before{content:"ï¦"}.fa-signing:before,.fa-sign-language:before{content:"ï§"}.fa-low-vision:before{content:"ï¨"}.fa-viadeo:before{content:"ï©"}.fa-viadeo-square:before{content:"ïª"}.fa-snapchat:before{content:"ï«"}.fa-snapchat-ghost:before{content:"ï¬"}.fa-snapchat-square:before{content:"ï"}.fa-pied-piper:before{content:"ï®"}.fa-first-order:before{content:"ï°"}.fa-yoast:before{content:"ï±"}.fa-themeisle:before{content:"ï²"}.fa-google-plus-circle:before,.fa-google-plus-official:before{content:"ï³"}.fa-fa:before,.fa-font-awesome:before{content:"ï´"}.fa-handshake-o:before{content:"ïµ"}.fa-envelope-open:before{content:"ï¶"}.fa-envelope-open-o:before{content:"ï·"}.fa-linode:before{content:"ï¸"}.fa-address-book:before{content:"ï¹"}.fa-address-book-o:before{content:"ïº"}.fa-vcard:before,.fa-address-card:before{content:"ï»"}.fa-vcard-o:before,.fa-address-card-o:before{content:"ï¼"}.fa-user-circle:before{content:"ï½"}.fa-user-circle-o:before{content:"ï¾"}.fa-user-o:before{content:"ï"}.fa-id-badge:before{content:"ï"}.fa-drivers-license:before,.fa-id-card:before{content:"ï"}.fa-drivers-license-o:before,.fa-id-card-o:before{content:"ï"}.fa-quora:before{content:"ï"}.fa-free-code-camp:before{content:"ï "}.fa-telegram:before{content:"ï"}.fa-thermometer-4:before,.fa-thermometer:before,.fa-thermometer-full:before{content:"ï"}.fa-thermometer-3:before,.fa-thermometer-three-quarters:before{content:"ï"}.fa-thermometer-2:before,.fa-thermometer-half:before{content:"ï"}.fa-thermometer-1:before,.fa-thermometer-quarter:before{content:"ï"}.fa-thermometer-0:before,.fa-thermometer-empty:before{content:"ï"}.fa-shower:before{content:"ï"}.fa-bathtub:before,.fa-s15:before,.fa-bath:before{content:"ï"}.fa-podcast:before{content:"ï"}.fa-window-maximize:before{content:"ï"}.fa-window-minimize:before{content:"ï"}.fa-window-restore:before{content:"ï"}.fa-times-rectangle:before,.fa-window-close:before{content:"ï"}.fa-times-rectangle-o:before,.fa-window-close-o:before{content:"ï"}.fa-bandcamp:before{content:"ï"}.fa-grav:before{content:"ï"}.fa-etsy:before{content:"ï"}.fa-imdb:before{content:"ï"}.fa-ravelry:before{content:"ï"}.fa-eercast:before{content:"ï"}.fa-microchip:before{content:"ï"}.fa-snowflake-o:before{content:"ï"}.fa-superpowers:before{content:"ï"}.fa-wpexplorer:before{content:"ï"}.fa-meetup:before{content:"ï "}.sr-only{position:absolute;width:1px;height:1px;padding:0;margin:-1px;overflow:hidden;clip:rect(0, 0, 0, 0);border:0}.sr-only-focusable:active,.sr-only-focusable:focus{position:static;width:auto;height:auto;margin:0;overflow:visible;clip:auto}.fa,.wy-menu-vertical li span.toctree-expand,.wy-menu-vertical li.on a span.toctree-expand,.wy-menu-vertical li.current>a span.toctree-expand,.rst-content .admonition-title,.rst-content h1 .headerlink,.rst-content h2 .headerlink,.rst-content h3 .headerlink,.rst-content h4 .headerlink,.rst-content h5 .headerlink,.rst-content h6 .headerlink,.rst-content dl dt .headerlink,.rst-content p.caption .headerlink,.rst-content tt.download span:first-child,.rst-content code.download span:first-child,.icon,.wy-dropdown .caret,.wy-inline-validate.wy-inline-validate-success .wy-input-context,.wy-inline-validate.wy-inline-validate-danger .wy-input-context,.wy-inline-validate.wy-inline-validate-warning .wy-input-context,.wy-inline-validate.wy-inline-validate-info .wy-input-context{font-family:inherit}.fa:before,.wy-menu-vertical li span.toctree-expand:before,.wy-menu-vertical li.on a span.toctree-expand:before,.wy-menu-vertical li.current>a span.toctree-expand:before,.rst-content .admonition-title:before,.rst-content h1 .headerlink:before,.rst-content h2 .headerlink:before,.rst-content h3 .headerlink:before,.rst-content h4 .headerlink:before,.rst-content h5 .headerlink:before,.rst-content h6 .headerlink:before,.rst-content dl dt .headerlink:before,.rst-content p.caption .headerlink:before,.rst-content tt.download span:first-child:before,.rst-content code.download span:first-child:before,.icon:before,.wy-dropdown .caret:before,.wy-inline-validate.wy-inline-validate-success .wy-input-context:before,.wy-inline-validate.wy-inline-validate-danger .wy-input-context:before,.wy-inline-validate.wy-inline-validate-warning .wy-input-context:before,.wy-inline-validate.wy-inline-validate-info .wy-input-context:before{font-family:"FontAwesome";display:inline-block;font-style:normal;font-weight:normal;line-height:1;text-decoration:inherit}a .fa,a .wy-menu-vertical li span.toctree-expand,.wy-menu-vertical li a span.toctree-expand,.wy-menu-vertical li.on a span.toctree-expand,.wy-menu-vertical li.current>a span.toctree-expand,a .rst-content .admonition-title,.rst-content a .admonition-title,a .rst-content h1 .headerlink,.rst-content h1 a .headerlink,a .rst-content h2 .headerlink,.rst-content h2 a .headerlink,a .rst-content h3 .headerlink,.rst-content h3 a .headerlink,a .rst-content h4 .headerlink,.rst-content h4 a .headerlink,a .rst-content h5 .headerlink,.rst-content h5 a .headerlink,a .rst-content h6 .headerlink,.rst-content h6 a .headerlink,a .rst-content dl dt .headerlink,.rst-content dl dt a .headerlink,a .rst-content p.caption .headerlink,.rst-content p.caption a .headerlink,a .rst-content tt.download span:first-child,.rst-content tt.download a span:first-child,a .rst-content code.download span:first-child,.rst-content code.download a span:first-child,a .icon{display:inline-block;text-decoration:inherit}.btn .fa,.btn .wy-menu-vertical li span.toctree-expand,.wy-menu-vertical li .btn span.toctree-expand,.btn .wy-menu-vertical li.on a span.toctree-expand,.wy-menu-vertical li.on a .btn span.toctree-expand,.btn .wy-menu-vertical li.current>a span.toctree-expand,.wy-menu-vertical li.current>a .btn span.toctree-expand,.btn .rst-content .admonition-title,.rst-content .btn .admonition-title,.btn .rst-content h1 .headerlink,.rst-content h1 .btn .headerlink,.btn .rst-content h2 .headerlink,.rst-content h2 .btn .headerlink,.btn .rst-content h3 .headerlink,.rst-content h3 .btn .headerlink,.btn .rst-content h4 .headerlink,.rst-content h4 .btn .headerlink,.btn .rst-content h5 .headerlink,.rst-content h5 .btn .headerlink,.btn .rst-content h6 .headerlink,.rst-content h6 .btn .headerlink,.btn .rst-content dl dt .headerlink,.rst-content dl dt .btn .headerlink,.btn .rst-content p.caption .headerlink,.rst-content p.caption .btn .headerlink,.btn .rst-content tt.download span:first-child,.rst-content tt.download .btn span:first-child,.btn .rst-content code.download span:first-child,.rst-content code.download .btn span:first-child,.btn .icon,.nav .fa,.nav .wy-menu-vertical li span.toctree-expand,.wy-menu-vertical li .nav span.toctree-expand,.nav .wy-menu-vertical li.on a span.toctree-expand,.wy-menu-vertical li.on a .nav span.toctree-expand,.nav .wy-menu-vertical li.current>a span.toctree-expand,.wy-menu-vertical li.current>a .nav span.toctree-expand,.nav .rst-content .admonition-title,.rst-content .nav .admonition-title,.nav .rst-content h1 .headerlink,.rst-content h1 .nav .headerlink,.nav .rst-content h2 .headerlink,.rst-content h2 .nav .headerlink,.nav .rst-content h3 .headerlink,.rst-content h3 .nav .headerlink,.nav .rst-content h4 .headerlink,.rst-content h4 .nav .headerlink,.nav .rst-content h5 .headerlink,.rst-content h5 .nav .headerlink,.nav .rst-content h6 .headerlink,.rst-content h6 .nav .headerlink,.nav .rst-content dl dt .headerlink,.rst-content dl dt .nav .headerlink,.nav .rst-content p.caption .headerlink,.rst-content p.caption .nav .headerlink,.nav .rst-content tt.download span:first-child,.rst-content tt.download .nav span:first-child,.nav .rst-content code.download span:first-child,.rst-content code.download .nav span:first-child,.nav .icon{display:inline}.btn .fa.fa-large,.btn .wy-menu-vertical li span.fa-large.toctree-expand,.wy-menu-vertical li .btn span.fa-large.toctree-expand,.btn .rst-content .fa-large.admonition-title,.rst-content .btn .fa-large.admonition-title,.btn .rst-content h1 .fa-large.headerlink,.rst-content h1 .btn .fa-large.headerlink,.btn .rst-content h2 .fa-large.headerlink,.rst-content h2 .btn .fa-large.headerlink,.btn .rst-content h3 .fa-large.headerlink,.rst-content h3 .btn .fa-large.headerlink,.btn .rst-content h4 .fa-large.headerlink,.rst-content h4 .btn .fa-large.headerlink,.btn .rst-content h5 .fa-large.headerlink,.rst-content h5 .btn .fa-large.headerlink,.btn .rst-content h6 .fa-large.headerlink,.rst-content h6 .btn .fa-large.headerlink,.btn .rst-content dl dt .fa-large.headerlink,.rst-content dl dt .btn .fa-large.headerlink,.btn .rst-content p.caption .fa-large.headerlink,.rst-content p.caption .btn .fa-large.headerlink,.btn .rst-content tt.download span.fa-large:first-child,.rst-content tt.download .btn span.fa-large:first-child,.btn .rst-content code.download span.fa-large:first-child,.rst-content code.download .btn span.fa-large:first-child,.btn .fa-large.icon,.nav .fa.fa-large,.nav .wy-menu-vertical li span.fa-large.toctree-expand,.wy-menu-vertical li .nav span.fa-large.toctree-expand,.nav .rst-content .fa-large.admonition-title,.rst-content .nav .fa-large.admonition-title,.nav .rst-content h1 .fa-large.headerlink,.rst-content h1 .nav .fa-large.headerlink,.nav .rst-content h2 .fa-large.headerlink,.rst-content h2 .nav .fa-large.headerlink,.nav .rst-content h3 .fa-large.headerlink,.rst-content h3 .nav .fa-large.headerlink,.nav .rst-content h4 .fa-large.headerlink,.rst-content h4 .nav .fa-large.headerlink,.nav .rst-content h5 .fa-large.headerlink,.rst-content h5 .nav .fa-large.headerlink,.nav .rst-content h6 .fa-large.headerlink,.rst-content h6 .nav .fa-large.headerlink,.nav .rst-content dl dt .fa-large.headerlink,.rst-content dl dt .nav .fa-large.headerlink,.nav .rst-content p.caption .fa-large.headerlink,.rst-content p.caption .nav .fa-large.headerlink,.nav .rst-content tt.download span.fa-large:first-child,.rst-content tt.download .nav span.fa-large:first-child,.nav .rst-content code.download span.fa-large:first-child,.rst-content code.download .nav span.fa-large:first-child,.nav .fa-large.icon{line-height:0.9em}.btn .fa.fa-spin,.btn .wy-menu-vertical li span.fa-spin.toctree-expand,.wy-menu-vertical li .btn span.fa-spin.toctree-expand,.btn .rst-content .fa-spin.admonition-title,.rst-content .btn .fa-spin.admonition-title,.btn .rst-content h1 .fa-spin.headerlink,.rst-content h1 .btn .fa-spin.headerlink,.btn .rst-content h2 .fa-spin.headerlink,.rst-content h2 .btn .fa-spin.headerlink,.btn .rst-content h3 .fa-spin.headerlink,.rst-content h3 .btn .fa-spin.headerlink,.btn .rst-content h4 .fa-spin.headerlink,.rst-content h4 .btn .fa-spin.headerlink,.btn .rst-content h5 .fa-spin.headerlink,.rst-content h5 .btn .fa-spin.headerlink,.btn .rst-content h6 .fa-spin.headerlink,.rst-content h6 .btn .fa-spin.headerlink,.btn .rst-content dl dt .fa-spin.headerlink,.rst-content dl dt .btn .fa-spin.headerlink,.btn .rst-content p.caption .fa-spin.headerlink,.rst-content p.caption .btn .fa-spin.headerlink,.btn .rst-content tt.download span.fa-spin:first-child,.rst-content tt.download .btn span.fa-spin:first-child,.btn .rst-content code.download span.fa-spin:first-child,.rst-content code.download .btn span.fa-spin:first-child,.btn .fa-spin.icon,.nav .fa.fa-spin,.nav .wy-menu-vertical li span.fa-spin.toctree-expand,.wy-menu-vertical li .nav span.fa-spin.toctree-expand,.nav .rst-content .fa-spin.admonition-title,.rst-content .nav .fa-spin.admonition-title,.nav .rst-content h1 .fa-spin.headerlink,.rst-content h1 .nav .fa-spin.headerlink,.nav .rst-content h2 .fa-spin.headerlink,.rst-content h2 .nav .fa-spin.headerlink,.nav .rst-content h3 .fa-spin.headerlink,.rst-content h3 .nav .fa-spin.headerlink,.nav .rst-content h4 .fa-spin.headerlink,.rst-content h4 .nav .fa-spin.headerlink,.nav .rst-content h5 .fa-spin.headerlink,.rst-content h5 .nav .fa-spin.headerlink,.nav .rst-content h6 .fa-spin.headerlink,.rst-content h6 .nav .fa-spin.headerlink,.nav .rst-content dl dt .fa-spin.headerlink,.rst-content dl dt .nav .fa-spin.headerlink,.nav .rst-content p.caption .fa-spin.headerlink,.rst-content p.caption .nav .fa-spin.headerlink,.nav .rst-content tt.download span.fa-spin:first-child,.rst-content tt.download .nav span.fa-spin:first-child,.nav .rst-content code.download span.fa-spin:first-child,.rst-content code.download .nav span.fa-spin:first-child,.nav .fa-spin.icon{display:inline-block}.btn.fa:before,.wy-menu-vertical li span.btn.toctree-expand:before,.rst-content .btn.admonition-title:before,.rst-content h1 .btn.headerlink:before,.rst-content h2 .btn.headerlink:before,.rst-content h3 .btn.headerlink:before,.rst-content h4 .btn.headerlink:before,.rst-content h5 .btn.headerlink:before,.rst-content h6 .btn.headerlink:before,.rst-content dl dt .btn.headerlink:before,.rst-content p.caption .btn.headerlink:before,.rst-content tt.download span.btn:first-child:before,.rst-content code.download span.btn:first-child:before,.btn.icon:before{opacity:0.5;-webkit-transition:opacity 0.05s ease-in;-moz-transition:opacity 0.05s ease-in;transition:opacity 0.05s ease-in}.btn.fa:hover:before,.wy-menu-vertical li span.btn.toctree-expand:hover:before,.rst-content .btn.admonition-title:hover:before,.rst-content h1 .btn.headerlink:hover:before,.rst-content h2 .btn.headerlink:hover:before,.rst-content h3 .btn.headerlink:hover:before,.rst-content h4 .btn.headerlink:hover:before,.rst-content h5 .btn.headerlink:hover:before,.rst-content h6 .btn.headerlink:hover:before,.rst-content dl dt .btn.headerlink:hover:before,.rst-content p.caption .btn.headerlink:hover:before,.rst-content tt.download span.btn:first-child:hover:before,.rst-content code.download span.btn:first-child:hover:before,.btn.icon:hover:before{opacity:1}.btn-mini .fa:before,.btn-mini .wy-menu-vertical li span.toctree-expand:before,.wy-menu-vertical li .btn-mini span.toctree-expand:before,.btn-mini .rst-content .admonition-title:before,.rst-content .btn-mini .admonition-title:before,.btn-mini .rst-content h1 .headerlink:before,.rst-content h1 .btn-mini .headerlink:before,.btn-mini .rst-content h2 .headerlink:before,.rst-content h2 .btn-mini .headerlink:before,.btn-mini .rst-content h3 .headerlink:before,.rst-content h3 .btn-mini .headerlink:before,.btn-mini .rst-content h4 .headerlink:before,.rst-content h4 .btn-mini .headerlink:before,.btn-mini .rst-content h5 .headerlink:before,.rst-content h5 .btn-mini .headerlink:before,.btn-mini .rst-content h6 .headerlink:before,.rst-content h6 .btn-mini .headerlink:before,.btn-mini .rst-content dl dt .headerlink:before,.rst-content dl dt .btn-mini .headerlink:before,.btn-mini .rst-content p.caption .headerlink:before,.rst-content p.caption .btn-mini .headerlink:before,.btn-mini .rst-content tt.download span:first-child:before,.rst-content tt.download .btn-mini span:first-child:before,.btn-mini .rst-content code.download span:first-child:before,.rst-content code.download .btn-mini span:first-child:before,.btn-mini .icon:before{font-size:14px;vertical-align:-15%}.wy-alert,.rst-content .note,.rst-content .attention,.rst-content .caution,.rst-content .danger,.rst-content .error,.rst-content .hint,.rst-content .important,.rst-content .tip,.rst-content .warning,.rst-content .seealso,.rst-content .admonition-todo{padding:12px;line-height:24px;margin-bottom:24px;background:#e7f2fa}.wy-alert-title,.rst-content .admonition-title{color:#fff;font-weight:bold;display:block;color:#fff;background:#6ab0de;margin:-12px;padding:6px 12px;margin-bottom:12px}.wy-alert.wy-alert-danger,.rst-content .wy-alert-danger.note,.rst-content .wy-alert-danger.attention,.rst-content .wy-alert-danger.caution,.rst-content .danger,.rst-content .error,.rst-content .wy-alert-danger.hint,.rst-content .wy-alert-danger.important,.rst-content .wy-alert-danger.tip,.rst-content .wy-alert-danger.warning,.rst-content .wy-alert-danger.seealso,.rst-content .wy-alert-danger.admonition-todo{background:#fdf3f2}.wy-alert.wy-alert-danger .wy-alert-title,.rst-content .wy-alert-danger.note .wy-alert-title,.rst-content .wy-alert-danger.attention .wy-alert-title,.rst-content .wy-alert-danger.caution .wy-alert-title,.rst-content .danger .wy-alert-title,.rst-content .error .wy-alert-title,.rst-content .wy-alert-danger.hint .wy-alert-title,.rst-content .wy-alert-danger.important .wy-alert-title,.rst-content .wy-alert-danger.tip .wy-alert-title,.rst-content .wy-alert-danger.warning .wy-alert-title,.rst-content .wy-alert-danger.seealso .wy-alert-title,.rst-content .wy-alert-danger.admonition-todo .wy-alert-title,.wy-alert.wy-alert-danger .rst-content .admonition-title,.rst-content .wy-alert.wy-alert-danger .admonition-title,.rst-content .wy-alert-danger.note .admonition-title,.rst-content .wy-alert-danger.attention .admonition-title,.rst-content .wy-alert-danger.caution .admonition-title,.rst-content .danger .admonition-title,.rst-content .error .admonition-title,.rst-content .wy-alert-danger.hint .admonition-title,.rst-content .wy-alert-danger.important .admonition-title,.rst-content .wy-alert-danger.tip .admonition-title,.rst-content .wy-alert-danger.warning .admonition-title,.rst-content .wy-alert-danger.seealso .admonition-title,.rst-content .wy-alert-danger.admonition-todo .admonition-title{background:#f29f97}.wy-alert.wy-alert-warning,.rst-content .wy-alert-warning.note,.rst-content .attention,.rst-content .caution,.rst-content .wy-alert-warning.danger,.rst-content .wy-alert-warning.error,.rst-content .wy-alert-warning.hint,.rst-content .wy-alert-warning.important,.rst-content .wy-alert-warning.tip,.rst-content .warning,.rst-content .wy-alert-warning.seealso,.rst-content .admonition-todo{background:#ffedcc}.wy-alert.wy-alert-warning .wy-alert-title,.rst-content .wy-alert-warning.note .wy-alert-title,.rst-content .attention .wy-alert-title,.rst-content .caution .wy-alert-title,.rst-content .wy-alert-warning.danger .wy-alert-title,.rst-content .wy-alert-warning.error .wy-alert-title,.rst-content .wy-alert-warning.hint .wy-alert-title,.rst-content .wy-alert-warning.important .wy-alert-title,.rst-content .wy-alert-warning.tip .wy-alert-title,.rst-content .warning .wy-alert-title,.rst-content .wy-alert-warning.seealso .wy-alert-title,.rst-content .admonition-todo .wy-alert-title,.wy-alert.wy-alert-warning .rst-content .admonition-title,.rst-content .wy-alert.wy-alert-warning .admonition-title,.rst-content .wy-alert-warning.note .admonition-title,.rst-content .attention .admonition-title,.rst-content .caution .admonition-title,.rst-content .wy-alert-warning.danger .admonition-title,.rst-content .wy-alert-warning.error .admonition-title,.rst-content .wy-alert-warning.hint .admonition-title,.rst-content .wy-alert-warning.important .admonition-title,.rst-content .wy-alert-warning.tip .admonition-title,.rst-content .warning .admonition-title,.rst-content .wy-alert-warning.seealso .admonition-title,.rst-content .admonition-todo .admonition-title{background:#f0b37e}.wy-alert.wy-alert-info,.rst-content .note,.rst-content .wy-alert-info.attention,.rst-content .wy-alert-info.caution,.rst-content .wy-alert-info.danger,.rst-content .wy-alert-info.error,.rst-content .wy-alert-info.hint,.rst-content .wy-alert-info.important,.rst-content .wy-alert-info.tip,.rst-content .wy-alert-info.warning,.rst-content .seealso,.rst-content .wy-alert-info.admonition-todo{background:#e7f2fa}.wy-alert.wy-alert-info .wy-alert-title,.rst-content .note .wy-alert-title,.rst-content .wy-alert-info.attention .wy-alert-title,.rst-content .wy-alert-info.caution .wy-alert-title,.rst-content .wy-alert-info.danger .wy-alert-title,.rst-content .wy-alert-info.error .wy-alert-title,.rst-content .wy-alert-info.hint .wy-alert-title,.rst-content .wy-alert-info.important .wy-alert-title,.rst-content .wy-alert-info.tip .wy-alert-title,.rst-content .wy-alert-info.warning .wy-alert-title,.rst-content .seealso .wy-alert-title,.rst-content .wy-alert-info.admonition-todo .wy-alert-title,.wy-alert.wy-alert-info .rst-content .admonition-title,.rst-content .wy-alert.wy-alert-info .admonition-title,.rst-content .note .admonition-title,.rst-content .wy-alert-info.attention .admonition-title,.rst-content .wy-alert-info.caution .admonition-title,.rst-content .wy-alert-info.danger .admonition-title,.rst-content .wy-alert-info.error .admonition-title,.rst-content .wy-alert-info.hint .admonition-title,.rst-content .wy-alert-info.important .admonition-title,.rst-content .wy-alert-info.tip .admonition-title,.rst-content .wy-alert-info.warning .admonition-title,.rst-content .seealso .admonition-title,.rst-content .wy-alert-info.admonition-todo .admonition-title{background:#6ab0de}.wy-alert.wy-alert-success,.rst-content .wy-alert-success.note,.rst-content .wy-alert-success.attention,.rst-content .wy-alert-success.caution,.rst-content .wy-alert-success.danger,.rst-content .wy-alert-success.error,.rst-content .hint,.rst-content .important,.rst-content .tip,.rst-content .wy-alert-success.warning,.rst-content .wy-alert-success.seealso,.rst-content .wy-alert-success.admonition-todo{background:#dbfaf4}.wy-alert.wy-alert-success .wy-alert-title,.rst-content .wy-alert-success.note .wy-alert-title,.rst-content .wy-alert-success.attention .wy-alert-title,.rst-content .wy-alert-success.caution .wy-alert-title,.rst-content .wy-alert-success.danger .wy-alert-title,.rst-content .wy-alert-success.error .wy-alert-title,.rst-content .hint .wy-alert-title,.rst-content .important .wy-alert-title,.rst-content .tip .wy-alert-title,.rst-content .wy-alert-success.warning .wy-alert-title,.rst-content .wy-alert-success.seealso .wy-alert-title,.rst-content .wy-alert-success.admonition-todo .wy-alert-title,.wy-alert.wy-alert-success .rst-content .admonition-title,.rst-content .wy-alert.wy-alert-success .admonition-title,.rst-content .wy-alert-success.note .admonition-title,.rst-content .wy-alert-success.attention .admonition-title,.rst-content .wy-alert-success.caution .admonition-title,.rst-content .wy-alert-success.danger .admonition-title,.rst-content .wy-alert-success.error .admonition-title,.rst-content .hint .admonition-title,.rst-content .important .admonition-title,.rst-content .tip .admonition-title,.rst-content .wy-alert-success.warning .admonition-title,.rst-content .wy-alert-success.seealso .admonition-title,.rst-content .wy-alert-success.admonition-todo .admonition-title{background:#1abc9c}.wy-alert.wy-alert-neutral,.rst-content .wy-alert-neutral.note,.rst-content .wy-alert-neutral.attention,.rst-content .wy-alert-neutral.caution,.rst-content .wy-alert-neutral.danger,.rst-content .wy-alert-neutral.error,.rst-content .wy-alert-neutral.hint,.rst-content .wy-alert-neutral.important,.rst-content .wy-alert-neutral.tip,.rst-content .wy-alert-neutral.warning,.rst-content .wy-alert-neutral.seealso,.rst-content .wy-alert-neutral.admonition-todo{background:#f3f6f6}.wy-alert.wy-alert-neutral .wy-alert-title,.rst-content .wy-alert-neutral.note .wy-alert-title,.rst-content .wy-alert-neutral.attention .wy-alert-title,.rst-content .wy-alert-neutral.caution .wy-alert-title,.rst-content .wy-alert-neutral.danger .wy-alert-title,.rst-content .wy-alert-neutral.error .wy-alert-title,.rst-content .wy-alert-neutral.hint .wy-alert-title,.rst-content .wy-alert-neutral.important .wy-alert-title,.rst-content .wy-alert-neutral.tip .wy-alert-title,.rst-content .wy-alert-neutral.warning .wy-alert-title,.rst-content .wy-alert-neutral.seealso .wy-alert-title,.rst-content .wy-alert-neutral.admonition-todo .wy-alert-title,.wy-alert.wy-alert-neutral .rst-content .admonition-title,.rst-content .wy-alert.wy-alert-neutral .admonition-title,.rst-content .wy-alert-neutral.note .admonition-title,.rst-content .wy-alert-neutral.attention .admonition-title,.rst-content .wy-alert-neutral.caution .admonition-title,.rst-content .wy-alert-neutral.danger .admonition-title,.rst-content .wy-alert-neutral.error .admonition-title,.rst-content .wy-alert-neutral.hint .admonition-title,.rst-content .wy-alert-neutral.important .admonition-title,.rst-content .wy-alert-neutral.tip .admonition-title,.rst-content .wy-alert-neutral.warning .admonition-title,.rst-content .wy-alert-neutral.seealso .admonition-title,.rst-content .wy-alert-neutral.admonition-todo .admonition-title{color:#404040;background:#e1e4e5}.wy-alert.wy-alert-neutral a,.rst-content .wy-alert-neutral.note a,.rst-content .wy-alert-neutral.attention a,.rst-content .wy-alert-neutral.caution a,.rst-content .wy-alert-neutral.danger a,.rst-content .wy-alert-neutral.error a,.rst-content .wy-alert-neutral.hint a,.rst-content .wy-alert-neutral.important a,.rst-content .wy-alert-neutral.tip a,.rst-content .wy-alert-neutral.warning a,.rst-content .wy-alert-neutral.seealso a,.rst-content .wy-alert-neutral.admonition-todo a{color:#2980B9}.wy-alert p:last-child,.rst-content .note p:last-child,.rst-content .attention p:last-child,.rst-content .caution p:last-child,.rst-content .danger p:last-child,.rst-content .error p:last-child,.rst-content .hint p:last-child,.rst-content .important p:last-child,.rst-content .tip p:last-child,.rst-content .warning p:last-child,.rst-content .seealso p:last-child,.rst-content .admonition-todo p:last-child{margin-bottom:0}.wy-tray-container{position:fixed;bottom:0px;left:0;z-index:600}.wy-tray-container li{display:block;width:300px;background:transparent;color:#fff;text-align:center;box-shadow:0 5px 5px 0 rgba(0,0,0,0.1);padding:0 24px;min-width:20%;opacity:0;height:0;line-height:56px;overflow:hidden;-webkit-transition:all 0.3s ease-in;-moz-transition:all 0.3s ease-in;transition:all 0.3s ease-in}.wy-tray-container li.wy-tray-item-success{background:#27AE60}.wy-tray-container li.wy-tray-item-info{background:#2980B9}.wy-tray-container li.wy-tray-item-warning{background:#E67E22}.wy-tray-container li.wy-tray-item-danger{background:#E74C3C}.wy-tray-container li.on{opacity:1;height:56px}@media screen and (max-width: 768px){.wy-tray-container{bottom:auto;top:0;width:100%}.wy-tray-container li{width:100%}}button{font-size:100%;margin:0;vertical-align:baseline;*vertical-align:middle;cursor:pointer;line-height:normal;-webkit-appearance:button;*overflow:visible}button::-moz-focus-inner,input::-moz-focus-inner{border:0;padding:0}button[disabled]{cursor:default}.btn{display:inline-block;border-radius:2px;line-height:normal;white-space:nowrap;text-align:center;cursor:pointer;font-size:100%;padding:6px 12px 8px 12px;color:#fff;border:1px solid rgba(0,0,0,0.1);background-color:#27AE60;text-decoration:none;font-weight:normal;font-family:"Lato","proxima-nova","Helvetica Neue",Arial,sans-serif;box-shadow:0px 1px 2px -1px rgba(255,255,255,0.5) inset,0px -2px 0px 0px rgba(0,0,0,0.1) inset;outline-none:false;vertical-align:middle;*display:inline;zoom:1;-webkit-user-drag:none;-webkit-user-select:none;-moz-user-select:none;-ms-user-select:none;user-select:none;-webkit-transition:all 0.1s linear;-moz-transition:all 0.1s linear;transition:all 0.1s linear}.btn-hover{background:#2e8ece;color:#fff}.btn:hover{background:#2cc36b;color:#fff}.btn:focus{background:#2cc36b;outline:0}.btn:active{box-shadow:0px -1px 0px 0px rgba(0,0,0,0.05) inset,0px 2px 0px 0px rgba(0,0,0,0.1) inset;padding:8px 12px 6px 12px}.btn:visited{color:#fff}.btn:disabled{background-image:none;filter:progid:DXImageTransform.Microsoft.gradient(enabled = false);filter:alpha(opacity=40);opacity:0.4;cursor:not-allowed;box-shadow:none}.btn-disabled{background-image:none;filter:progid:DXImageTransform.Microsoft.gradient(enabled = false);filter:alpha(opacity=40);opacity:0.4;cursor:not-allowed;box-shadow:none}.btn-disabled:hover,.btn-disabled:focus,.btn-disabled:active{background-image:none;filter:progid:DXImageTransform.Microsoft.gradient(enabled = false);filter:alpha(opacity=40);opacity:0.4;cursor:not-allowed;box-shadow:none}.btn::-moz-focus-inner{padding:0;border:0}.btn-small{font-size:80%}.btn-info{background-color:#2980B9 !important}.btn-info:hover{background-color:#2e8ece !important}.btn-neutral{background-color:#f3f6f6 !important;color:#404040 !important}.btn-neutral:hover{background-color:#e5ebeb !important;color:#404040}.btn-neutral:visited{color:#404040 !important}.btn-success{background-color:#27AE60 !important}.btn-success:hover{background-color:#295 !important}.btn-danger{background-color:#E74C3C !important}.btn-danger:hover{background-color:#ea6153 !important}.btn-warning{background-color:#E67E22 !important}.btn-warning:hover{background-color:#e98b39 !important}.btn-invert{background-color:#222}.btn-invert:hover{background-color:#2f2f2f !important}.btn-link{background-color:transparent !important;color:#2980B9;box-shadow:none;border-color:transparent !important}.btn-link:hover{background-color:transparent !important;color:#409ad5 !important;box-shadow:none}.btn-link:active{background-color:transparent !important;color:#409ad5 !important;box-shadow:none}.btn-link:visited{color:#9B59B6}.wy-btn-group .btn,.wy-control .btn{vertical-align:middle}.wy-btn-group{margin-bottom:24px;*zoom:1}.wy-btn-group:before,.wy-btn-group:after{display:table;content:""}.wy-btn-group:after{clear:both}.wy-dropdown{position:relative;display:inline-block}.wy-dropdown-active .wy-dropdown-menu{display:block}.wy-dropdown-menu{position:absolute;left:0;display:none;float:left;top:100%;min-width:100%;background:#fcfcfc;z-index:100;border:solid 1px #cfd7dd;box-shadow:0 2px 2px 0 rgba(0,0,0,0.1);padding:12px}.wy-dropdown-menu>dd>a{display:block;clear:both;color:#404040;white-space:nowrap;font-size:90%;padding:0 12px;cursor:pointer}.wy-dropdown-menu>dd>a:hover{background:#2980B9;color:#fff}.wy-dropdown-menu>dd.divider{border-top:solid 1px #cfd7dd;margin:6px 0}.wy-dropdown-menu>dd.search{padding-bottom:12px}.wy-dropdown-menu>dd.search input[type="search"]{width:100%}.wy-dropdown-menu>dd.call-to-action{background:#e3e3e3;text-transform:uppercase;font-weight:500;font-size:80%}.wy-dropdown-menu>dd.call-to-action:hover{background:#e3e3e3}.wy-dropdown-menu>dd.call-to-action .btn{color:#fff}.wy-dropdown.wy-dropdown-up .wy-dropdown-menu{bottom:100%;top:auto;left:auto;right:0}.wy-dropdown.wy-dropdown-bubble .wy-dropdown-menu{background:#fcfcfc;margin-top:2px}.wy-dropdown.wy-dropdown-bubble .wy-dropdown-menu a{padding:6px 12px}.wy-dropdown.wy-dropdown-bubble .wy-dropdown-menu a:hover{background:#2980B9;color:#fff}.wy-dropdown.wy-dropdown-left .wy-dropdown-menu{right:0;left:auto;text-align:right}.wy-dropdown-arrow:before{content:" ";border-bottom:5px solid #f5f5f5;border-left:5px solid transparent;border-right:5px solid transparent;position:absolute;display:block;top:-4px;left:50%;margin-left:-3px}.wy-dropdown-arrow.wy-dropdown-arrow-left:before{left:11px}.wy-form-stacked select{display:block}.wy-form-aligned input,.wy-form-aligned textarea,.wy-form-aligned select,.wy-form-aligned .wy-help-inline,.wy-form-aligned label{display:inline-block;*display:inline;*zoom:1;vertical-align:middle}.wy-form-aligned .wy-control-group>label{display:inline-block;vertical-align:middle;width:10em;margin:6px 12px 0 0;float:left}.wy-form-aligned .wy-control{float:left}.wy-form-aligned .wy-control label{display:block}.wy-form-aligned .wy-control select{margin-top:6px}fieldset{border:0;margin:0;padding:0}legend{display:block;width:100%;border:0;padding:0;white-space:normal;margin-bottom:24px;font-size:150%;*margin-left:-7px}label{display:block;margin:0 0 .3125em 0;color:#333;font-size:90%}input,select,textarea{font-size:100%;margin:0;vertical-align:baseline;*vertical-align:middle}.wy-control-group{margin-bottom:24px;*zoom:1;max-width:68em;margin-left:auto;margin-right:auto;*zoom:1}.wy-control-group:before,.wy-control-group:after{display:table;content:""}.wy-control-group:after{clear:both}.wy-control-group:before,.wy-control-group:after{display:table;content:""}.wy-control-group:after{clear:both}.wy-control-group.wy-control-group-required>label:after{content:" *";color:#E74C3C}.wy-control-group .wy-form-full,.wy-control-group .wy-form-halves,.wy-control-group .wy-form-thirds{padding-bottom:12px}.wy-control-group .wy-form-full select,.wy-control-group .wy-form-halves select,.wy-control-group .wy-form-thirds select{width:100%}.wy-control-group .wy-form-full input[type="text"],.wy-control-group .wy-form-full input[type="password"],.wy-control-group .wy-form-full input[type="email"],.wy-control-group .wy-form-full input[type="url"],.wy-control-group .wy-form-full input[type="date"],.wy-control-group .wy-form-full input[type="month"],.wy-control-group .wy-form-full input[type="time"],.wy-control-group .wy-form-full input[type="datetime"],.wy-control-group .wy-form-full input[type="datetime-local"],.wy-control-group .wy-form-full input[type="week"],.wy-control-group .wy-form-full input[type="number"],.wy-control-group .wy-form-full input[type="search"],.wy-control-group .wy-form-full input[type="tel"],.wy-control-group .wy-form-full input[type="color"],.wy-control-group .wy-form-halves input[type="text"],.wy-control-group .wy-form-halves input[type="password"],.wy-control-group .wy-form-halves input[type="email"],.wy-control-group .wy-form-halves input[type="url"],.wy-control-group .wy-form-halves input[type="date"],.wy-control-group .wy-form-halves input[type="month"],.wy-control-group .wy-form-halves input[type="time"],.wy-control-group .wy-form-halves input[type="datetime"],.wy-control-group .wy-form-halves input[type="datetime-local"],.wy-control-group .wy-form-halves input[type="week"],.wy-control-group .wy-form-halves input[type="number"],.wy-control-group .wy-form-halves input[type="search"],.wy-control-group .wy-form-halves input[type="tel"],.wy-control-group .wy-form-halves input[type="color"],.wy-control-group .wy-form-thirds input[type="text"],.wy-control-group .wy-form-thirds input[type="password"],.wy-control-group .wy-form-thirds input[type="email"],.wy-control-group .wy-form-thirds input[type="url"],.wy-control-group .wy-form-thirds input[type="date"],.wy-control-group .wy-form-thirds input[type="month"],.wy-control-group .wy-form-thirds input[type="time"],.wy-control-group .wy-form-thirds input[type="datetime"],.wy-control-group .wy-form-thirds input[type="datetime-local"],.wy-control-group .wy-form-thirds input[type="week"],.wy-control-group .wy-form-thirds input[type="number"],.wy-control-group .wy-form-thirds input[type="search"],.wy-control-group .wy-form-thirds input[type="tel"],.wy-control-group .wy-form-thirds input[type="color"]{width:100%}.wy-control-group .wy-form-full{float:left;display:block;margin-right:2.35765%;width:100%;margin-right:0}.wy-control-group .wy-form-full:last-child{margin-right:0}.wy-control-group .wy-form-halves{float:left;display:block;margin-right:2.35765%;width:48.82117%}.wy-control-group .wy-form-halves:last-child{margin-right:0}.wy-control-group .wy-form-halves:nth-of-type(2n){margin-right:0}.wy-control-group .wy-form-halves:nth-of-type(2n+1){clear:left}.wy-control-group .wy-form-thirds{float:left;display:block;margin-right:2.35765%;width:31.76157%}.wy-control-group .wy-form-thirds:last-child{margin-right:0}.wy-control-group .wy-form-thirds:nth-of-type(3n){margin-right:0}.wy-control-group .wy-form-thirds:nth-of-type(3n+1){clear:left}.wy-control-group.wy-control-group-no-input .wy-control{margin:6px 0 0 0;font-size:90%}.wy-control-no-input{display:inline-block;margin:6px 0 0 0;font-size:90%}.wy-control-group.fluid-input input[type="text"],.wy-control-group.fluid-input input[type="password"],.wy-control-group.fluid-input input[type="email"],.wy-control-group.fluid-input input[type="url"],.wy-control-group.fluid-input input[type="date"],.wy-control-group.fluid-input input[type="month"],.wy-control-group.fluid-input input[type="time"],.wy-control-group.fluid-input input[type="datetime"],.wy-control-group.fluid-input input[type="datetime-local"],.wy-control-group.fluid-input input[type="week"],.wy-control-group.fluid-input input[type="number"],.wy-control-group.fluid-input input[type="search"],.wy-control-group.fluid-input input[type="tel"],.wy-control-group.fluid-input input[type="color"]{width:100%}.wy-form-message-inline{display:inline-block;padding-left:0.3em;color:#666;vertical-align:middle;font-size:90%}.wy-form-message{display:block;color:#999;font-size:70%;margin-top:.3125em;font-style:italic}.wy-form-message p{font-size:inherit;font-style:italic;margin-bottom:6px}.wy-form-message p:last-child{margin-bottom:0}input{line-height:normal}input[type="button"],input[type="reset"],input[type="submit"]{-webkit-appearance:button;cursor:pointer;font-family:"Lato","proxima-nova","Helvetica Neue",Arial,sans-serif;*overflow:visible}input[type="text"],input[type="password"],input[type="email"],input[type="url"],input[type="date"],input[type="month"],input[type="time"],input[type="datetime"],input[type="datetime-local"],input[type="week"],input[type="number"],input[type="search"],input[type="tel"],input[type="color"]{-webkit-appearance:none;padding:6px;display:inline-block;border:1px solid #ccc;font-size:80%;font-family:"Lato","proxima-nova","Helvetica Neue",Arial,sans-serif;box-shadow:inset 0 1px 3px #ddd;border-radius:0;-webkit-transition:border 0.3s linear;-moz-transition:border 0.3s linear;transition:border 0.3s linear}input[type="datetime-local"]{padding:.34375em .625em}input[disabled]{cursor:default}input[type="checkbox"],input[type="radio"]{-webkit-box-sizing:border-box;-moz-box-sizing:border-box;box-sizing:border-box;padding:0;margin-right:.3125em;*height:13px;*width:13px}input[type="search"]{-webkit-box-sizing:border-box;-moz-box-sizing:border-box;box-sizing:border-box}input[type="search"]::-webkit-search-cancel-button,input[type="search"]::-webkit-search-decoration{-webkit-appearance:none}input[type="text"]:focus,input[type="password"]:focus,input[type="email"]:focus,input[type="url"]:focus,input[type="date"]:focus,input[type="month"]:focus,input[type="time"]:focus,input[type="datetime"]:focus,input[type="datetime-local"]:focus,input[type="week"]:focus,input[type="number"]:focus,input[type="search"]:focus,input[type="tel"]:focus,input[type="color"]:focus{outline:0;outline:thin dotted \9;border-color:#333}input.no-focus:focus{border-color:#ccc !important}input[type="file"]:focus,input[type="radio"]:focus,input[type="checkbox"]:focus{outline:thin dotted #333;outline:1px auto #129FEA}input[type="text"][disabled],input[type="password"][disabled],input[type="email"][disabled],input[type="url"][disabled],input[type="date"][disabled],input[type="month"][disabled],input[type="time"][disabled],input[type="datetime"][disabled],input[type="datetime-local"][disabled],input[type="week"][disabled],input[type="number"][disabled],input[type="search"][disabled],input[type="tel"][disabled],input[type="color"][disabled]{cursor:not-allowed;background-color:#fafafa}input:focus:invalid,textarea:focus:invalid,select:focus:invalid{color:#E74C3C;border:1px solid #E74C3C}input:focus:invalid:focus,textarea:focus:invalid:focus,select:focus:invalid:focus{border-color:#E74C3C}input[type="file"]:focus:invalid:focus,input[type="radio"]:focus:invalid:focus,input[type="checkbox"]:focus:invalid:focus{outline-color:#E74C3C}input.wy-input-large{padding:12px;font-size:100%}textarea{overflow:auto;vertical-align:top;width:100%;font-family:"Lato","proxima-nova","Helvetica Neue",Arial,sans-serif}select,textarea{padding:.5em .625em;display:inline-block;border:1px solid #ccc;font-size:80%;box-shadow:inset 0 1px 3px #ddd;-webkit-transition:border 0.3s linear;-moz-transition:border 0.3s linear;transition:border 0.3s linear}select{border:1px solid #ccc;background-color:#fff}select[multiple]{height:auto}select:focus,textarea:focus{outline:0}select[disabled],textarea[disabled],input[readonly],select[readonly],textarea[readonly]{cursor:not-allowed;background-color:#fafafa}input[type="radio"][disabled],input[type="checkbox"][disabled]{cursor:not-allowed}.wy-checkbox,.wy-radio{margin:6px 0;color:#404040;display:block}.wy-checkbox input,.wy-radio input{vertical-align:baseline}.wy-form-message-inline{display:inline-block;*display:inline;*zoom:1;vertical-align:middle}.wy-input-prefix,.wy-input-suffix{white-space:nowrap;padding:6px}.wy-input-prefix .wy-input-context,.wy-input-suffix .wy-input-context{line-height:27px;padding:0 8px;display:inline-block;font-size:80%;background-color:#f3f6f6;border:solid 1px #ccc;color:#999}.wy-input-suffix .wy-input-context{border-left:0}.wy-input-prefix .wy-input-context{border-right:0}.wy-switch{position:relative;display:block;height:24px;margin-top:12px;cursor:pointer}.wy-switch:before{position:absolute;content:"";display:block;left:0;top:0;width:36px;height:12px;border-radius:4px;background:#ccc;-webkit-transition:all 0.2s ease-in-out;-moz-transition:all 0.2s ease-in-out;transition:all 0.2s ease-in-out}.wy-switch:after{position:absolute;content:"";display:block;width:18px;height:18px;border-radius:4px;background:#999;left:-3px;top:-3px;-webkit-transition:all 0.2s ease-in-out;-moz-transition:all 0.2s ease-in-out;transition:all 0.2s ease-in-out}.wy-switch span{position:absolute;left:48px;display:block;font-size:12px;color:#ccc;line-height:1}.wy-switch.active:before{background:#1e8449}.wy-switch.active:after{left:24px;background:#27AE60}.wy-switch.disabled{cursor:not-allowed;opacity:0.8}.wy-control-group.wy-control-group-error .wy-form-message,.wy-control-group.wy-control-group-error>label{color:#E74C3C}.wy-control-group.wy-control-group-error input[type="text"],.wy-control-group.wy-control-group-error input[type="password"],.wy-control-group.wy-control-group-error input[type="email"],.wy-control-group.wy-control-group-error input[type="url"],.wy-control-group.wy-control-group-error input[type="date"],.wy-control-group.wy-control-group-error input[type="month"],.wy-control-group.wy-control-group-error input[type="time"],.wy-control-group.wy-control-group-error input[type="datetime"],.wy-control-group.wy-control-group-error input[type="datetime-local"],.wy-control-group.wy-control-group-error input[type="week"],.wy-control-group.wy-control-group-error input[type="number"],.wy-control-group.wy-control-group-error input[type="search"],.wy-control-group.wy-control-group-error input[type="tel"],.wy-control-group.wy-control-group-error input[type="color"]{border:solid 1px #E74C3C}.wy-control-group.wy-control-group-error textarea{border:solid 1px #E74C3C}.wy-inline-validate{white-space:nowrap}.wy-inline-validate .wy-input-context{padding:.5em .625em;display:inline-block;font-size:80%}.wy-inline-validate.wy-inline-validate-success .wy-input-context{color:#27AE60}.wy-inline-validate.wy-inline-validate-danger .wy-input-context{color:#E74C3C}.wy-inline-validate.wy-inline-validate-warning .wy-input-context{color:#E67E22}.wy-inline-validate.wy-inline-validate-info .wy-input-context{color:#2980B9}.rotate-90{-webkit-transform:rotate(90deg);-moz-transform:rotate(90deg);-ms-transform:rotate(90deg);-o-transform:rotate(90deg);transform:rotate(90deg)}.rotate-180{-webkit-transform:rotate(180deg);-moz-transform:rotate(180deg);-ms-transform:rotate(180deg);-o-transform:rotate(180deg);transform:rotate(180deg)}.rotate-270{-webkit-transform:rotate(270deg);-moz-transform:rotate(270deg);-ms-transform:rotate(270deg);-o-transform:rotate(270deg);transform:rotate(270deg)}.mirror{-webkit-transform:scaleX(-1);-moz-transform:scaleX(-1);-ms-transform:scaleX(-1);-o-transform:scaleX(-1);transform:scaleX(-1)}.mirror.rotate-90{-webkit-transform:scaleX(-1) rotate(90deg);-moz-transform:scaleX(-1) rotate(90deg);-ms-transform:scaleX(-1) rotate(90deg);-o-transform:scaleX(-1) rotate(90deg);transform:scaleX(-1) rotate(90deg)}.mirror.rotate-180{-webkit-transform:scaleX(-1) rotate(180deg);-moz-transform:scaleX(-1) rotate(180deg);-ms-transform:scaleX(-1) rotate(180deg);-o-transform:scaleX(-1) rotate(180deg);transform:scaleX(-1) rotate(180deg)}.mirror.rotate-270{-webkit-transform:scaleX(-1) rotate(270deg);-moz-transform:scaleX(-1) rotate(270deg);-ms-transform:scaleX(-1) rotate(270deg);-o-transform:scaleX(-1) rotate(270deg);transform:scaleX(-1) rotate(270deg)}@media only screen and (max-width: 480px){.wy-form button[type="submit"]{margin:0.7em 0 0}.wy-form input[type="text"],.wy-form input[type="password"],.wy-form input[type="email"],.wy-form input[type="url"],.wy-form input[type="date"],.wy-form input[type="month"],.wy-form input[type="time"],.wy-form input[type="datetime"],.wy-form input[type="datetime-local"],.wy-form input[type="week"],.wy-form input[type="number"],.wy-form input[type="search"],.wy-form input[type="tel"],.wy-form input[type="color"]{margin-bottom:0.3em;display:block}.wy-form label{margin-bottom:0.3em;display:block}.wy-form input[type="password"],.wy-form input[type="email"],.wy-form input[type="url"],.wy-form input[type="date"],.wy-form input[type="month"],.wy-form input[type="time"],.wy-form input[type="datetime"],.wy-form input[type="datetime-local"],.wy-form input[type="week"],.wy-form input[type="number"],.wy-form input[type="search"],.wy-form input[type="tel"],.wy-form input[type="color"]{margin-bottom:0}.wy-form-aligned .wy-control-group label{margin-bottom:0.3em;text-align:left;display:block;width:100%}.wy-form-aligned .wy-control{margin:1.5em 0 0 0}.wy-form .wy-help-inline,.wy-form-message-inline,.wy-form-message{display:block;font-size:80%;padding:6px 0}}@media screen and (max-width: 768px){.tablet-hide{display:none}}@media screen and (max-width: 480px){.mobile-hide{display:none}}.float-left{float:left}.float-right{float:right}.full-width{width:100%}.wy-table,.rst-content table.docutils,.rst-content table.field-list{border-collapse:collapse;border-spacing:0;empty-cells:show;margin-bottom:24px}.wy-table caption,.rst-content table.docutils caption,.rst-content table.field-list caption{color:#000;font:italic 85%/1 arial,sans-serif;padding:1em 0;text-align:center}.wy-table td,.rst-content table.docutils td,.rst-content table.field-list td,.wy-table th,.rst-content table.docutils th,.rst-content table.field-list th{font-size:90%;margin:0;overflow:visible;padding:8px 16px}.wy-table td:first-child,.rst-content table.docutils td:first-child,.rst-content table.field-list td:first-child,.wy-table th:first-child,.rst-content table.docutils th:first-child,.rst-content table.field-list th:first-child{border-left-width:0}.wy-table thead,.rst-content table.docutils thead,.rst-content table.field-list thead{color:#000;text-align:left;vertical-align:bottom;white-space:nowrap}.wy-table thead th,.rst-content table.docutils thead th,.rst-content table.field-list thead th{font-weight:bold;border-bottom:solid 2px #e1e4e5}.wy-table td,.rst-content table.docutils td,.rst-content table.field-list td{background-color:transparent;vertical-align:middle}.wy-table td p,.rst-content table.docutils td p,.rst-content table.field-list td p{line-height:18px}.wy-table td p:last-child,.rst-content table.docutils td p:last-child,.rst-content table.field-list td p:last-child{margin-bottom:0}.wy-table .wy-table-cell-min,.rst-content table.docutils .wy-table-cell-min,.rst-content table.field-list .wy-table-cell-min{width:1%;padding-right:0}.wy-table .wy-table-cell-min input[type=checkbox],.rst-content table.docutils .wy-table-cell-min input[type=checkbox],.rst-content table.field-list .wy-table-cell-min input[type=checkbox],.wy-table .wy-table-cell-min input[type=checkbox],.rst-content table.docutils .wy-table-cell-min input[type=checkbox],.rst-content table.field-list .wy-table-cell-min input[type=checkbox]{margin:0}.wy-table-secondary{color:gray;font-size:90%}.wy-table-tertiary{color:gray;font-size:80%}.wy-table-odd td,.wy-table-striped tr:nth-child(2n-1) td,.rst-content table.docutils:not(.field-list) tr:nth-child(2n-1) td{background-color:#f3f6f6}.wy-table-backed{background-color:#f3f6f6}.wy-table-bordered-all,.rst-content table.docutils{border:1px solid #e1e4e5}.wy-table-bordered-all td,.rst-content table.docutils td{border-bottom:1px solid #e1e4e5;border-left:1px solid #e1e4e5}.wy-table-bordered-all tbody>tr:last-child td,.rst-content table.docutils tbody>tr:last-child td{border-bottom-width:0}.wy-table-bordered{border:1px solid #e1e4e5}.wy-table-bordered-rows td{border-bottom:1px solid #e1e4e5}.wy-table-bordered-rows tbody>tr:last-child td{border-bottom-width:0}.wy-table-horizontal tbody>tr:last-child td{border-bottom-width:0}.wy-table-horizontal td,.wy-table-horizontal th{border-width:0 0 1px 0;border-bottom:1px solid #e1e4e5}.wy-table-horizontal tbody>tr:last-child td{border-bottom-width:0}.wy-table-responsive{margin-bottom:24px;max-width:100%;overflow:auto}.wy-table-responsive table{margin-bottom:0 !important}.wy-table-responsive table td,.wy-table-responsive table th{white-space:nowrap}a{color:#2980B9;text-decoration:none;cursor:pointer}a:hover{color:#3091d1}a:visited{color:#9B59B6}html{height:100%;overflow-x:hidden}body{font-family:"Lato","proxima-nova","Helvetica Neue",Arial,sans-serif;font-weight:normal;color:#404040;min-height:100%;overflow-x:hidden;background:#edf0f2}.wy-text-left{text-align:left}.wy-text-center{text-align:center}.wy-text-right{text-align:right}.wy-text-large{font-size:120%}.wy-text-normal{font-size:100%}.wy-text-small,small{font-size:80%}.wy-text-strike{text-decoration:line-through}.wy-text-warning{color:#E67E22 !important}a.wy-text-warning:hover{color:#eb9950 !important}.wy-text-info{color:#2980B9 !important}a.wy-text-info:hover{color:#409ad5 !important}.wy-text-success{color:#27AE60 !important}a.wy-text-success:hover{color:#36d278 !important}.wy-text-danger{color:#E74C3C !important}a.wy-text-danger:hover{color:#ed7669 !important}.wy-text-neutral{color:#404040 !important}a.wy-text-neutral:hover{color:#595959 !important}h1,h2,.rst-content .toctree-wrapper p.caption,h3,h4,h5,h6,legend{margin-top:0;font-weight:700;font-family:"Roboto Slab","ff-tisa-web-pro","Georgia",Arial,sans-serif}p{line-height:24px;margin:0;font-size:16px;margin-bottom:24px}h1{font-size:175%}h2,.rst-content .toctree-wrapper p.caption{font-size:150%}h3{font-size:125%}h4{font-size:115%}h5{font-size:110%}h6{font-size:100%}hr{display:block;height:1px;border:0;border-top:1px solid #e1e4e5;margin:24px 0;padding:0}code,.rst-content tt,.rst-content code{white-space:nowrap;max-width:100%;background:#fff;border:solid 1px #e1e4e5;font-size:75%;padding:0 5px;font-family:Consolas,"Andale Mono WT","Andale Mono","Lucida Console","Lucida Sans Typewriter","DejaVu Sans Mono","Bitstream Vera Sans Mono","Liberation Mono","Nimbus Mono L",Monaco,"Courier New",Courier,monospace;color:#E74C3C;overflow-x:auto}code.code-large,.rst-content tt.code-large{font-size:90%}.wy-plain-list-disc,.rst-content .section ul,.rst-content .toctree-wrapper ul,article ul{list-style:disc;line-height:24px;margin-bottom:24px}.wy-plain-list-disc li,.rst-content .section ul li,.rst-content .toctree-wrapper ul li,article ul li{list-style:disc;margin-left:24px}.wy-plain-list-disc li p:last-child,.rst-content .section ul li p:last-child,.rst-content .toctree-wrapper ul li p:last-child,article ul li p:last-child{margin-bottom:0}.wy-plain-list-disc li ul,.rst-content .section ul li ul,.rst-content .toctree-wrapper ul li ul,article ul li ul{margin-bottom:0}.wy-plain-list-disc li li,.rst-content .section ul li li,.rst-content .toctree-wrapper ul li li,article ul li li{list-style:circle}.wy-plain-list-disc li li li,.rst-content .section ul li li li,.rst-content .toctree-wrapper ul li li li,article ul li li li{list-style:square}.wy-plain-list-disc li ol li,.rst-content .section ul li ol li,.rst-content .toctree-wrapper ul li ol li,article ul li ol li{list-style:decimal}.wy-plain-list-decimal,.rst-content .section ol,.rst-content ol.arabic,article ol{list-style:decimal;line-height:24px;margin-bottom:24px}.wy-plain-list-decimal li,.rst-content .section ol li,.rst-content ol.arabic li,article ol li{list-style:decimal;margin-left:24px}.wy-plain-list-decimal li p:last-child,.rst-content .section ol li p:last-child,.rst-content ol.arabic li p:last-child,article ol li p:last-child{margin-bottom:0}.wy-plain-list-decimal li ul,.rst-content .section ol li ul,.rst-content ol.arabic li ul,article ol li ul{margin-bottom:0}.wy-plain-list-decimal li ul li,.rst-content .section ol li ul li,.rst-content ol.arabic li ul li,article ol li ul li{list-style:disc}.codeblock-example{border:1px solid #e1e4e5;border-bottom:none;padding:24px;padding-top:48px;font-weight:500;background:#fff;position:relative}.codeblock-example:after{content:"Example";position:absolute;top:0px;left:0px;background:#9B59B6;color:#fff;padding:6px 12px}.codeblock-example.prettyprint-example-only{border:1px solid #e1e4e5;margin-bottom:24px}.codeblock,pre.literal-block,.rst-content .literal-block,.rst-content pre.literal-block,div[class^='highlight']{border:1px solid #e1e4e5;padding:0px;overflow-x:auto;background:#fff;margin:1px 0 24px 0}.codeblock div[class^='highlight'],pre.literal-block div[class^='highlight'],.rst-content .literal-block div[class^='highlight'],div[class^='highlight'] div[class^='highlight']{border:none;background:none;margin:0}div[class^='highlight'] td.code{width:100%}.linenodiv pre{border-right:solid 1px #e6e9ea;margin:0;padding:12px 12px;font-family:Consolas,"Andale Mono WT","Andale Mono","Lucida Console","Lucida Sans Typewriter","DejaVu Sans Mono","Bitstream Vera Sans Mono","Liberation Mono","Nimbus Mono L",Monaco,"Courier New",Courier,monospace;font-size:12px;line-height:1.5;color:#d9d9d9}div[class^='highlight'] pre{white-space:pre;margin:0;padding:12px 12px;font-family:Consolas,"Andale Mono WT","Andale Mono","Lucida Console","Lucida Sans Typewriter","DejaVu Sans Mono","Bitstream Vera Sans Mono","Liberation Mono","Nimbus Mono L",Monaco,"Courier New",Courier,monospace;font-size:12px;line-height:1.5;display:block;overflow:auto;color:#404040}@media print{.codeblock,pre.literal-block,.rst-content .literal-block,.rst-content pre.literal-block,div[class^='highlight'],div[class^='highlight'] pre{white-space:pre-wrap}}.hll{background-color:#ffc;margin:0 -12px;padding:0 12px;display:block}.c{color:#998;font-style:italic}.err{color:#a61717;background-color:#e3d2d2}.k{font-weight:bold}.o{font-weight:bold}.cm{color:#998;font-style:italic}.cp{color:#999;font-weight:bold}.c1{color:#998;font-style:italic}.cs{color:#999;font-weight:bold;font-style:italic}.gd{color:#000;background-color:#fdd}.gd .x{color:#000;background-color:#faa}.ge{font-style:italic}.gr{color:#a00}.gh{color:#999}.gi{color:#000;background-color:#dfd}.gi .x{color:#000;background-color:#afa}.go{color:#888}.gp{color:#555}.gs{font-weight:bold}.gu{color:purple;font-weight:bold}.gt{color:#a00}.kc{font-weight:bold}.kd{font-weight:bold}.kn{font-weight:bold}.kp{font-weight:bold}.kr{font-weight:bold}.kt{color:#458;font-weight:bold}.m{color:#099}.s{color:#d14}.n{color:#333}.na{color:teal}.nb{color:#0086b3}.nc{color:#458;font-weight:bold}.no{color:teal}.ni{color:purple}.ne{color:#900;font-weight:bold}.nf{color:#900;font-weight:bold}.nn{color:#555}.nt{color:navy}.nv{color:teal}.ow{font-weight:bold}.w{color:#bbb}.mf{color:#099}.mh{color:#099}.mi{color:#099}.mo{color:#099}.sb{color:#d14}.sc{color:#d14}.sd{color:#d14}.s2{color:#d14}.se{color:#d14}.sh{color:#d14}.si{color:#d14}.sx{color:#d14}.sr{color:#009926}.s1{color:#d14}.ss{color:#990073}.bp{color:#999}.vc{color:teal}.vg{color:teal}.vi{color:teal}.il{color:#099}.gc{color:#999;background-color:#EAF2F5}.wy-breadcrumbs li{display:inline-block}.wy-breadcrumbs li.wy-breadcrumbs-aside{float:right}.wy-breadcrumbs li a{display:inline-block;padding:5px}.wy-breadcrumbs li a:first-child{padding-left:0}.wy-breadcrumbs li code,.wy-breadcrumbs li .rst-content tt,.rst-content .wy-breadcrumbs li tt{padding:5px;border:none;background:none}.wy-breadcrumbs li code.literal,.wy-breadcrumbs li .rst-content tt.literal,.rst-content .wy-breadcrumbs li tt.literal{color:#404040}.wy-breadcrumbs-extra{margin-bottom:0;color:#b3b3b3;font-size:80%;display:inline-block}@media screen and (max-width: 480px){.wy-breadcrumbs-extra{display:none}.wy-breadcrumbs li.wy-breadcrumbs-aside{display:none}}@media print{.wy-breadcrumbs li.wy-breadcrumbs-aside{display:none}}.wy-affix{position:fixed;top:1.618em}.wy-menu a:hover{text-decoration:none}.wy-menu-horiz{*zoom:1}.wy-menu-horiz:before,.wy-menu-horiz:after{display:table;content:""}.wy-menu-horiz:after{clear:both}.wy-menu-horiz ul,.wy-menu-horiz li{display:inline-block}.wy-menu-horiz li:hover{background:rgba(255,255,255,0.1)}.wy-menu-horiz li.divide-left{border-left:solid 1px #404040}.wy-menu-horiz li.divide-right{border-right:solid 1px #404040}.wy-menu-horiz a{height:32px;display:inline-block;line-height:32px;padding:0 16px}.wy-menu-vertical{width:300px}.wy-menu-vertical header,.wy-menu-vertical p.caption{height:32px;display:inline-block;line-height:32px;padding:0 1.618em;margin-bottom:0;display:block;font-weight:bold;text-transform:uppercase;font-size:80%;color:#6f6f6f;white-space:nowrap}.wy-menu-vertical ul{margin-bottom:0}.wy-menu-vertical li.divide-top{border-top:solid 1px #404040}.wy-menu-vertical li.divide-bottom{border-bottom:solid 1px #404040}.wy-menu-vertical li.current{background:#e3e3e3}.wy-menu-vertical li.current a{color:gray;border-right:solid 1px #c9c9c9;padding:.4045em 2.427em}.wy-menu-vertical li.current a:hover{background:#d6d6d6}.wy-menu-vertical li code,.wy-menu-vertical li .rst-content tt,.rst-content .wy-menu-vertical li tt{border:none;background:inherit;color:inherit;padding-left:0;padding-right:0}.wy-menu-vertical li span.toctree-expand{display:block;float:left;margin-left:-1.2em;font-size:.8em;line-height:1.6em;color:#4d4d4d}.wy-menu-vertical li.on a,.wy-menu-vertical li.current>a{color:#404040;padding:.4045em 1.618em;font-weight:bold;position:relative;background:#fcfcfc;border:none;border-bottom:solid 1px #c9c9c9;border-top:solid 1px #c9c9c9;padding-left:1.618em -4px}.wy-menu-vertical li.on a:hover,.wy-menu-vertical li.current>a:hover{background:#fcfcfc}.wy-menu-vertical li.on a:hover span.toctree-expand,.wy-menu-vertical li.current>a:hover span.toctree-expand{color:gray}.wy-menu-vertical li.on a span.toctree-expand,.wy-menu-vertical li.current>a span.toctree-expand{display:block;font-size:.8em;line-height:1.6em;color:#333}.wy-menu-vertical li.toctree-l1.current li.toctree-l2>ul,.wy-menu-vertical li.toctree-l2.current li.toctree-l3>ul{display:none}.wy-menu-vertical li.toctree-l1.current li.toctree-l2.current>ul,.wy-menu-vertical li.toctree-l2.current li.toctree-l3.current>ul{display:block}.wy-menu-vertical li.toctree-l2.current>a{background:#c9c9c9;padding:.4045em 2.427em}.wy-menu-vertical li.toctree-l2.current li.toctree-l3>a{display:block;background:#c9c9c9;padding:.4045em 4.045em}.wy-menu-vertical li.toctree-l2 a:hover span.toctree-expand{color:gray}.wy-menu-vertical li.toctree-l2 span.toctree-expand{color:#a3a3a3}.wy-menu-vertical li.toctree-l3{font-size:.9em}.wy-menu-vertical li.toctree-l3.current>a{background:#bdbdbd;padding:.4045em 4.045em}.wy-menu-vertical li.toctree-l3.current li.toctree-l4>a{display:block;background:#bdbdbd;padding:.4045em 5.663em;border-top:none;border-bottom:none}.wy-menu-vertical li.toctree-l3 a:hover span.toctree-expand{color:gray}.wy-menu-vertical li.toctree-l3 span.toctree-expand{color:#969696}.wy-menu-vertical li.toctree-l4{font-size:.9em}.wy-menu-vertical li.current ul{display:block}.wy-menu-vertical li ul{margin-bottom:0;display:none}.wy-menu-vertical .local-toc li ul{display:block}.wy-menu-vertical li ul li a{margin-bottom:0;color:#b3b3b3;font-weight:normal}.wy-menu-vertical a{display:inline-block;line-height:18px;padding:.4045em 1.618em;display:block;position:relative;font-size:90%;color:#b3b3b3}.wy-menu-vertical a:hover{background-color:#4e4a4a;cursor:pointer}.wy-menu-vertical a:hover span.toctree-expand{color:#b3b3b3}.wy-menu-vertical a:active{background-color:#2980B9;cursor:pointer;color:#fff}.wy-menu-vertical a:active span.toctree-expand{color:#fff}.wy-side-nav-search{display:block;width:300px;padding:.809em;margin-bottom:.809em;z-index:200;background-color:#2980B9;text-align:center;padding:.809em;display:block;color:#fcfcfc;margin-bottom:.809em}.wy-side-nav-search input[type=text]{width:100%;border-radius:50px;padding:6px 12px;border-color:#2472a4}.wy-side-nav-search img{display:block;margin:auto auto .809em auto;height:45px;width:45px;background-color:#2980B9;padding:5px;border-radius:100%}.wy-side-nav-search>a,.wy-side-nav-search .wy-dropdown>a{color:#fcfcfc;font-size:100%;font-weight:bold;display:inline-block;padding:4px 6px;margin-bottom:.809em}.wy-side-nav-search>a:hover,.wy-side-nav-search .wy-dropdown>a:hover{background:rgba(255,255,255,0.1)}.wy-side-nav-search>a img.logo,.wy-side-nav-search .wy-dropdown>a img.logo{display:block;margin:0 auto;height:auto;width:auto;border-radius:0;max-width:100%;background:transparent}.wy-side-nav-search>a.icon img.logo,.wy-side-nav-search .wy-dropdown>a.icon img.logo{margin-top:.85em}.wy-side-nav-search>div.version{margin-top:-.4045em;margin-bottom:.809em;font-weight:normal;color:rgba(255,255,255,0.3)}.wy-nav .wy-menu-vertical header{color:#2980B9}.wy-nav .wy-menu-vertical a{color:#b3b3b3}.wy-nav .wy-menu-vertical a:hover{background-color:#2980B9;color:#fff}[data-menu-wrap]{-webkit-transition:all .2s ease-in;-moz-transition:all .2s ease-in;transition:all .2s ease-in;position:absolute;opacity:1;width:100%;opacity:0}[data-menu-wrap].move-center{left:0;right:auto;opacity:1}[data-menu-wrap].move-left{right:auto;left:-100%;opacity:0}[data-menu-wrap].move-right{right:-100%;left:auto;opacity:0}.wy-body-for-nav{background:left repeat-y #fcfcfc;background-image:url(data:image/png;base64,iVBORw0KGgoAAAANSUhEUgAAAAEAAAABCAIAAACQd1PeAAAAGXRFWHRTb2Z0d2FyZQBBZG9iZSBJbWFnZVJlYWR5ccllPAAAAyRpVFh0WE1MOmNvbS5hZG9iZS54bXAAAAAAADw/eHBhY2tldCBiZWdpbj0i77u/IiBpZD0iVzVNME1wQ2VoaUh6cmVTek5UY3prYzlkIj8+IDx4OnhtcG1ldGEgeG1sbnM6eD0iYWRvYmU6bnM6bWV0YS8iIHg6eG1wdGs9IkFkb2JlIFhNUCBDb3JlIDUuMy1jMDExIDY2LjE0NTY2MSwgMjAxMi8wMi8wNi0xNDo1NjoyNyAgICAgICAgIj4gPHJkZjpSREYgeG1sbnM6cmRmPSJodHRwOi8vd3d3LnczLm9yZy8xOTk5LzAyLzIyLXJkZi1zeW50YXgtbnMjIj4gPHJkZjpEZXNjcmlwdGlvbiByZGY6YWJvdXQ9IiIgeG1sbnM6eG1wPSJodHRwOi8vbnMuYWRvYmUuY29tL3hhcC8xLjAvIiB4bWxuczp4bXBNTT0iaHR0cDovL25zLmFkb2JlLmNvbS94YXAvMS4wL21tLyIgeG1sbnM6c3RSZWY9Imh0dHA6Ly9ucy5hZG9iZS5jb20veGFwLzEuMC9zVHlwZS9SZXNvdXJjZVJlZiMiIHhtcDpDcmVhdG9yVG9vbD0iQWRvYmUgUGhvdG9zaG9wIENTNiAoTWFjaW50b3NoKSIgeG1wTU06SW5zdGFuY2VJRD0ieG1wLmlpZDoxOERBMTRGRDBFMUUxMUUzODUwMkJCOThDMEVFNURFMCIgeG1wTU06RG9jdW1lbnRJRD0ieG1wLmRpZDoxOERBMTRGRTBFMUUxMUUzODUwMkJCOThDMEVFNURFMCI+IDx4bXBNTTpEZXJpdmVkRnJvbSBzdFJlZjppbnN0YW5jZUlEPSJ4bXAuaWlkOjE4REExNEZCMEUxRTExRTM4NTAyQkI5OEMwRUU1REUwIiBzdFJlZjpkb2N1bWVudElEPSJ4bXAuZGlkOjE4REExNEZDMEUxRTExRTM4NTAyQkI5OEMwRUU1REUwIi8+IDwvcmRmOkRlc2NyaXB0aW9uPiA8L3JkZjpSREY+IDwveDp4bXBtZXRhPiA8P3hwYWNrZXQgZW5kPSJyIj8+EwrlwAAAAA5JREFUeNpiMDU0BAgwAAE2AJgB9BnaAAAAAElFTkSuQmCC);background-size:300px 1px}.wy-grid-for-nav{position:absolute;width:100%;height:100%}.wy-nav-side{position:fixed;top:0;bottom:0;left:0;padding-bottom:2em;width:300px;overflow-x:hidden;overflow-y:hidden;min-height:100%;background:#343131;z-index:200}.wy-side-scroll{width:320px;position:relative;overflow-x:hidden;overflow-y:scroll;height:100%}.wy-nav-top{display:none;background:#2980B9;color:#fff;padding:.4045em .809em;position:relative;line-height:50px;text-align:center;font-size:100%;*zoom:1}.wy-nav-top:before,.wy-nav-top:after{display:table;content:""}.wy-nav-top:after{clear:both}.wy-nav-top a{color:#fff;font-weight:bold}.wy-nav-top img{margin-right:12px;height:45px;width:45px;background-color:#2980B9;padding:5px;border-radius:100%}.wy-nav-top i{font-size:30px;float:left;cursor:pointer;padding-top:inherit}.wy-nav-content-wrap{margin-left:300px;background:#fcfcfc;min-height:100%}.wy-nav-content{padding:1.618em 3.236em;height:100%;max-width:800px;margin:auto}.wy-body-mask{position:fixed;width:100%;height:100%;background:rgba(0,0,0,0.2);display:none;z-index:499}.wy-body-mask.on{display:block}footer{color:gray}footer p{margin-bottom:12px}footer span.commit code,footer span.commit .rst-content tt,.rst-content footer span.commit tt{padding:0px;font-family:Consolas,"Andale Mono WT","Andale Mono","Lucida Console","Lucida Sans Typewriter","DejaVu Sans Mono","Bitstream Vera Sans Mono","Liberation Mono","Nimbus Mono L",Monaco,"Courier New",Courier,monospace;font-size:1em;background:none;border:none;color:gray}.rst-footer-buttons{*zoom:1}.rst-footer-buttons:before,.rst-footer-buttons:after{width:100%}.rst-footer-buttons:before,.rst-footer-buttons:after{display:table;content:""}.rst-footer-buttons:after{clear:both}.rst-breadcrumbs-buttons{margin-top:12px;*zoom:1}.rst-breadcrumbs-buttons:before,.rst-breadcrumbs-buttons:after{display:table;content:""}.rst-breadcrumbs-buttons:after{clear:both}#search-results .search li{margin-bottom:24px;border-bottom:solid 1px #e1e4e5;padding-bottom:24px}#search-results .search li:first-child{border-top:solid 1px #e1e4e5;padding-top:24px}#search-results .search li a{font-size:120%;margin-bottom:12px;display:inline-block}#search-results .context{color:gray;font-size:90%}@media screen and (max-width: 768px){.wy-body-for-nav{background:#fcfcfc}.wy-nav-top{display:block}.wy-nav-side{left:-300px}.wy-nav-side.shift{width:85%;left:0}.wy-side-scroll{width:auto}.wy-side-nav-search{width:auto}.wy-menu.wy-menu-vertical{width:auto}.wy-nav-content-wrap{margin-left:0}.wy-nav-content-wrap .wy-nav-content{padding:1.618em}.wy-nav-content-wrap.shift{position:fixed;min-width:100%;left:85%;top:0;height:100%;overflow:hidden}}@media screen and (min-width: 1400px){.wy-nav-content-wrap{background:rgba(0,0,0,0.05)}.wy-nav-content{margin:0;background:#fcfcfc}}@media print{.rst-versions,footer,.wy-nav-side{display:none}.wy-nav-content-wrap{margin-left:0}}.rst-versions{position:fixed;bottom:0;left:0;width:300px;color:#fcfcfc;background:#1f1d1d;border-top:solid 10px #343131;font-family:"Lato","proxima-nova","Helvetica Neue",Arial,sans-serif;z-index:400}.rst-versions a{color:#2980B9;text-decoration:none}.rst-versions .rst-badge-small{display:none}.rst-versions .rst-current-version{padding:12px;background-color:#272525;display:block;text-align:right;font-size:90%;cursor:pointer;color:#27AE60;*zoom:1}.rst-versions .rst-current-version:before,.rst-versions .rst-current-version:after{display:table;content:""}.rst-versions .rst-current-version:after{clear:both}.rst-versions .rst-current-version .fa,.rst-versions .rst-current-version .wy-menu-vertical li span.toctree-expand,.wy-menu-vertical li .rst-versions .rst-current-version span.toctree-expand,.rst-versions .rst-current-version .rst-content .admonition-title,.rst-content .rst-versions .rst-current-version .admonition-title,.rst-versions .rst-current-version .rst-content h1 .headerlink,.rst-content h1 .rst-versions .rst-current-version .headerlink,.rst-versions .rst-current-version .rst-content h2 .headerlink,.rst-content h2 .rst-versions .rst-current-version .headerlink,.rst-versions .rst-current-version .rst-content h3 .headerlink,.rst-content h3 .rst-versions .rst-current-version .headerlink,.rst-versions .rst-current-version .rst-content h4 .headerlink,.rst-content h4 .rst-versions .rst-current-version .headerlink,.rst-versions .rst-current-version .rst-content h5 .headerlink,.rst-content h5 .rst-versions .rst-current-version .headerlink,.rst-versions .rst-current-version .rst-content h6 .headerlink,.rst-content h6 .rst-versions .rst-current-version .headerlink,.rst-versions .rst-current-version .rst-content dl dt .headerlink,.rst-content dl dt .rst-versions .rst-current-version .headerlink,.rst-versions .rst-current-version .rst-content p.caption .headerlink,.rst-content p.caption .rst-versions .rst-current-version .headerlink,.rst-versions .rst-current-version .rst-content tt.download span:first-child,.rst-content tt.download .rst-versions .rst-current-version span:first-child,.rst-versions .rst-current-version .rst-content code.download span:first-child,.rst-content code.download .rst-versions .rst-current-version span:first-child,.rst-versions .rst-current-version .icon{color:#fcfcfc}.rst-versions .rst-current-version .fa-book,.rst-versions .rst-current-version .icon-book{float:left}.rst-versions .rst-current-version .icon-book{float:left}.rst-versions .rst-current-version.rst-out-of-date{background-color:#E74C3C;color:#fff}.rst-versions .rst-current-version.rst-active-old-version{background-color:#F1C40F;color:#000}.rst-versions.shift-up .rst-other-versions{display:block}.rst-versions .rst-other-versions{font-size:90%;padding:12px;color:gray;display:none}.rst-versions .rst-other-versions hr{display:block;height:1px;border:0;margin:20px 0;padding:0;border-top:solid 1px #413d3d}.rst-versions .rst-other-versions dd{display:inline-block;margin:0}.rst-versions .rst-other-versions dd a{display:inline-block;padding:6px;color:#fcfcfc}.rst-versions.rst-badge{width:auto;bottom:20px;right:20px;left:auto;border:none;max-width:300px}.rst-versions.rst-badge .icon-book{float:none}.rst-versions.rst-badge .fa-book,.rst-versions.rst-badge .icon-book{float:none}.rst-versions.rst-badge.shift-up .rst-current-version{text-align:right}.rst-versions.rst-badge.shift-up .rst-current-version .fa-book,.rst-versions.rst-badge.shift-up .rst-current-version .icon-book{float:left}.rst-versions.rst-badge.shift-up .rst-current-version .icon-book{float:left}.rst-versions.rst-badge .rst-current-version{width:auto;height:30px;line-height:30px;padding:0 6px;display:block;text-align:center}@media screen and (max-width: 768px){.rst-versions{width:85%;display:none}.rst-versions.shift{display:block}}.rst-content img{max-width:100%;height:auto !important}.rst-content .highlight>pre,.rst-content .linenodiv>pre{line-height:normal}.rst-content div.figure{margin-bottom:24px}.rst-content div.figure p.caption{font-style:italic}.rst-content div.figure.align-center{text-align:center}.rst-content .section>img,.rst-content .section>a>img{margin-bottom:24px}.rst-content blockquote{margin-left:24px;line-height:24px;margin-bottom:24px}.rst-content .note .last,.rst-content .attention .last,.rst-content .caution .last,.rst-content .danger .last,.rst-content .error .last,.rst-content .hint .last,.rst-content .important .last,.rst-content .tip .last,.rst-content .warning .last,.rst-content .seealso .last,.rst-content .admonition-todo .last{margin-bottom:0}.rst-content .admonition-title:before{margin-right:4px}.rst-content .admonition table{border-color:rgba(0,0,0,0.1)}.rst-content .admonition table td,.rst-content .admonition table th{background:transparent !important;border-color:rgba(0,0,0,0.1) !important}.rst-content .section ol.loweralpha,.rst-content .section ol.loweralpha li{list-style:lower-alpha}.rst-content .section ol.upperalpha,.rst-content .section ol.upperalpha li{list-style:upper-alpha}.rst-content .section ol p,.rst-content .section ul p{margin-bottom:12px}.rst-content .line-block{margin-left:24px}.rst-content .topic-title{font-weight:bold;margin-bottom:12px}.rst-content .toc-backref{color:#404040}.rst-content .align-right{float:right;margin:0px 0px 24px 24px}.rst-content .align-left{float:left;margin:0px 24px 24px 0px}.rst-content .align-center{margin:auto;display:block}.rst-content h1 .headerlink,.rst-content h2 .headerlink,.rst-content .toctree-wrapper p.caption .headerlink,.rst-content h3 .headerlink,.rst-content h4 .headerlink,.rst-content h5 .headerlink,.rst-content h6 .headerlink,.rst-content dl dt .headerlink,.rst-content p.caption .headerlink{display:none;visibility:hidden;font-size:14px}.rst-content h1 .headerlink:after,.rst-content h2 .headerlink:after,.rst-content .toctree-wrapper p.caption .headerlink:after,.rst-content h3 .headerlink:after,.rst-content h4 .headerlink:after,.rst-content h5 .headerlink:after,.rst-content h6 .headerlink:after,.rst-content dl dt .headerlink:after,.rst-content p.caption .headerlink:after{visibility:visible;content:"ï";font-family:FontAwesome;display:inline-block}.rst-content h1:hover .headerlink,.rst-content h2:hover .headerlink,.rst-content .toctree-wrapper p.caption:hover .headerlink,.rst-content h3:hover .headerlink,.rst-content h4:hover .headerlink,.rst-content h5:hover .headerlink,.rst-content h6:hover .headerlink,.rst-content dl dt:hover .headerlink,.rst-content p.caption:hover .headerlink{display:inline-block}.rst-content .centered{text-align:center}.rst-content .sidebar{float:right;width:40%;display:block;margin:0 0 24px 24px;padding:24px;background:#f3f6f6;border:solid 1px #e1e4e5}.rst-content .sidebar p,.rst-content .sidebar ul,.rst-content .sidebar dl{font-size:90%}.rst-content .sidebar .last{margin-bottom:0}.rst-content .sidebar .sidebar-title{display:block;font-family:"Roboto Slab","ff-tisa-web-pro","Georgia",Arial,sans-serif;font-weight:bold;background:#e1e4e5;padding:6px 12px;margin:-24px;margin-bottom:24px;font-size:100%}.rst-content .highlighted{background:#F1C40F;display:inline-block;font-weight:bold;padding:0 6px}.rst-content .footnote-reference,.rst-content .citation-reference{vertical-align:super;font-size:90%}.rst-content table.docutils.citation,.rst-content table.docutils.footnote{background:none;border:none;color:gray}.rst-content table.docutils.citation td,.rst-content table.docutils.citation tr,.rst-content table.docutils.footnote td,.rst-content table.docutils.footnote tr{border:none;background-color:transparent !important;white-space:normal}.rst-content table.docutils.citation td.label,.rst-content table.docutils.footnote td.label{padding-left:0;padding-right:0;vertical-align:top}.rst-content table.docutils.citation tt,.rst-content table.docutils.citation code,.rst-content table.docutils.footnote tt,.rst-content table.docutils.footnote code{color:#555}.rst-content table.field-list{border:none}.rst-content table.field-list td{border:none}.rst-content table.field-list td>strong{display:inline-block}.rst-content table.field-list .field-name{padding-right:10px;text-align:left;white-space:nowrap}.rst-content table.field-list .field-body{text-align:left}.rst-content tt,.rst-content tt,.rst-content code{color:#000;padding:2px 5px}.rst-content tt big,.rst-content tt em,.rst-content tt big,.rst-content code big,.rst-content tt em,.rst-content code em{font-size:100% !important;line-height:normal}.rst-content tt.literal,.rst-content tt.literal,.rst-content code.literal{color:#E74C3C}.rst-content tt.xref,a .rst-content tt,.rst-content tt.xref,.rst-content code.xref,a .rst-content tt,a .rst-content code{font-weight:bold;color:#404040}.rst-content a tt,.rst-content a tt,.rst-content a code{color:#2980B9}.rst-content dl{margin-bottom:24px}.rst-content dl dt{font-weight:bold}.rst-content dl p,.rst-content dl table,.rst-content dl ul,.rst-content dl ol{margin-bottom:12px !important}.rst-content dl dd{margin:0 0 12px 24px}.rst-content dl:not(.docutils){margin-bottom:24px}.rst-content dl:not(.docutils) dt{display:table;margin:6px 0;font-size:90%;line-height:normal;background:#e7f2fa;color:#2980B9;border-top:solid 3px #6ab0de;padding:6px;position:relative}.rst-content dl:not(.docutils) dt:before{color:#6ab0de}.rst-content dl:not(.docutils) dt .headerlink{color:#404040;font-size:100% !important}.rst-content dl:not(.docutils) dl dt{margin-bottom:6px;border:none;border-left:solid 3px #ccc;background:#f0f0f0;color:#555}.rst-content dl:not(.docutils) dl dt .headerlink{color:#404040;font-size:100% !important}.rst-content dl:not(.docutils) dt:first-child{margin-top:0}.rst-content dl:not(.docutils) tt,.rst-content dl:not(.docutils) tt,.rst-content dl:not(.docutils) code{font-weight:bold}.rst-content dl:not(.docutils) tt.descname,.rst-content dl:not(.docutils) tt.descclassname,.rst-content dl:not(.docutils) tt.descname,.rst-content dl:not(.docutils) code.descname,.rst-content dl:not(.docutils) tt.descclassname,.rst-content dl:not(.docutils) code.descclassname{background-color:transparent;border:none;padding:0;font-size:100% !important}.rst-content dl:not(.docutils) tt.descname,.rst-content dl:not(.docutils) tt.descname,.rst-content dl:not(.docutils) code.descname{font-weight:bold}.rst-content dl:not(.docutils) .optional{display:inline-block;padding:0 4px;color:#000;font-weight:bold}.rst-content dl:not(.docutils) .property{display:inline-block;padding-right:8px}.rst-content .viewcode-link,.rst-content .viewcode-back{display:inline-block;color:#27AE60;font-size:80%;padding-left:24px}.rst-content .viewcode-back{display:block;float:right}.rst-content p.rubric{margin-bottom:12px;font-weight:bold}.rst-content tt.download,.rst-content code.download{background:inherit;padding:inherit;font-weight:normal;font-family:inherit;font-size:inherit;color:inherit;border:inherit;white-space:inherit}.rst-content tt.download span:first-child,.rst-content code.download span:first-child{-webkit-font-smoothing:subpixel-antialiased}.rst-content tt.download span:first-child:before,.rst-content code.download span:first-child:before{margin-right:4px}.rst-content .guilabel{border:1px solid #7fbbe3;background:#e7f2fa;font-size:80%;font-weight:700;border-radius:4px;padding:2.4px 6px;margin:auto 2px}.rst-content .versionmodified{font-style:italic}@media screen and (max-width: 480px){.rst-content .sidebar{width:100%}}span[id*='MathJax-Span']{color:#404040}.math{text-align:center}@font-face{font-family:"Inconsolata";font-style:normal;font-weight:400;src:local("Inconsolata"),local("Inconsolata-Regular"),url(../fonts/Inconsolata-Regular.ttf) format("truetype")}@font-face{font-family:"Inconsolata";font-style:normal;font-weight:700;src:local("Inconsolata Bold"),local("Inconsolata-Bold"),url(../fonts/Inconsolata-Bold.ttf) format("truetype")}@font-face{font-family:"Lato";font-style:normal;font-weight:400;src:local("Lato Regular"),local("Lato-Regular"),url(../fonts/Lato-Regular.ttf) format("truetype")}@font-face{font-family:"Lato";font-style:normal;font-weight:700;src:local("Lato Bold"),local("Lato-Bold"),url(../fonts/Lato-Bold.ttf) format("truetype")}@font-face{font-family:"Lato";font-style:italic;font-weight:400;src:local("Lato Italic"),local("Lato-Italic"),url(../fonts/Lato-Italic.ttf) format("truetype")}@font-face{font-family:"Lato";font-style:italic;font-weight:700;src:local("Lato Bold Italic"),local("Lato-BoldItalic"),url(../fonts/Lato-BoldItalic.ttf) format("truetype")}@font-face{font-family:"Roboto Slab";font-style:normal;font-weight:400;src:local("Roboto Slab Regular"),local("RobotoSlab-Regular"),url(../fonts/RobotoSlab-Regular.ttf) format("truetype")}@font-face{font-family:"Roboto Slab";font-style:normal;font-weight:700;src:local("Roboto Slab Bold"),local("RobotoSlab-Bold"),url(../fonts/RobotoSlab-Bold.ttf) format("truetype")} +/*# sourceMappingURL=theme.css.map */ diff --git a/website/docs/_static/css/theme.css.map b/website/docs/_static/css/theme.css.map new file mode 100644 index 0000000..8f756d1 --- /dev/null +++ b/website/docs/_static/css/theme.css.map @@ -0,0 +1,7 @@ +{ +"version": 3, +"mappings": "CACE,AAAE,ECQI,iBAAoB,EDPJ,SAAU,ECY1B,cAAiB,EDZD,SAAU,EC2B1B,SAAY,ED3BI,SAAU,EEFlC,uEAAiF,EAC/E,MAAO,EAAE,IAAK,EAEhB,iBAAoB,EAClB,MAAO,EAAE,WAAY,EACrB,OAAQ,EAAE,KAAM,EAChB,IAAK,EAAE,AAAC,EAEV,oBAAqB,EACnB,MAAO,EAAE,GAAI,EAEf,OAAQ,EACN,MAAO,EAAE,GAAI,EAEf,AAAC,EDLO,iBAAoB,ECMd,SAAU,EDDhB,cAAiB,ECCX,SAAU,EDchB,SAAY,ECdN,SAAU,EAExB,GAAI,EACF,QAAS,EAAE,GAAI,EACf,uBAAwB,EAAE,GAAI,EAC9B,mBAAoB,EAAE,GAAI,EAE5B,GAAI,EACF,KAAM,EAAE,AAAC,EAEX,eAAiB,EACf,MAAO,EAAE,AAAC,EAEZ,UAAW,EACT,YAAa,EAAE,SAAU,EAE3B,OAAS,EACP,UAAW,EAAE,GAAI,EAEnB,SAAU,EACR,KAAM,EAAE,AAAC,EAEX,EAAG,EACD,SAAU,EAAE,KAAM,EAGpB,EAAG,EACD,SAAU,EAAE,GAAI,EAChB,IAAK,EAAE,GAAI,EACX,cAAe,EAAE,GAAI,EAEvB,GAAI,EACF,SAAU,EAAE,GAAI,EAChB,IAAK,EAAE,GAAI,EACX,SAAU,EAAE,KAAM,EAClB,UAAW,EAAE,GAAI,EAEnB,kDAAoB,EAClB,UAAW,EAAE,cAAgB,EAC7B,WAAY,EAAE,sBAAwB,EACtC,QAAS,EAAE,EAAG,EAEhB,EAAG,EACD,UAAW,EAAE,EAAG,EAElB,AAAC,EACC,KAAM,EAAE,GAAI,EAEd,eAAiB,EACf,MAAO,EAAE,CAAE,EACX,MAAO,EAAE,GAAI,EAEf,IAAK,EACH,QAAS,EAAE,EAAG,EAEhB,MAAQ,EACN,QAAS,EAAE,EAAG,EACd,UAAW,EAAE,AAAC,EACd,OAAQ,EAAE,OAAQ,EAClB,aAAc,EAAE,OAAQ,EAE1B,EAAG,EACD,EAAG,EAAE,KAAM,EAEb,EAAG,EACD,KAAM,EAAE,MAAO,EAEjB,OAAU,EACR,KAAM,EAAE,AAAC,EACT,MAAO,EAAE,AAAC,EACV,SAAU,EAAE,GAAI,EAChB,eAAgB,EAAE,GAAI,EAExB,CAAE,EACA,SAAU,EAAE,GAAI,EAElB,CAAE,EACA,KAAM,EAAE,AAAC,EAEX,EAAG,EACD,KAAM,EAAE,AAAC,EACT,qBAAsB,EAAE,MAAO,EAC/B,aAAc,EAAE,KAAM,EACtB,QAAS,EAAE,GAAI,EAEjB,aAAc,EACZ,OAAQ,EAAE,KAAM,EAElB,KAAM,EACJ,KAAM,EAAE,AAAC,EAEX,GAAI,EACF,KAAM,EAAE,AAAC,EAEX,OAAQ,EACN,KAAM,EAAE,AAAC,EACT,KAAM,EAAE,AAAC,EACT,MAAO,EAAE,AAAC,EAEZ,IAAK,EACH,KAAM,EAAE,MAAO,EAEjB,KAAM,EACJ,KAAM,EAAE,AAAC,EACT,WAAY,EAAE,GAAI,EAClB,MAAO,EAAE,AAAC,EACV,UAAW,EAAE,KAAM,EAErB,2BAA+B,EAC7B,QAAS,EAAE,GAAI,EACf,KAAM,EAAE,AAAC,EACT,aAAc,EAAE,OAAQ,EACxB,cAAe,EAAE,KAAM,EAEzB,WAAa,EACX,UAAW,EAAE,KAAM,EAErB,mEAAuE,EACrE,KAAM,EAAE,MAAO,EACf,iBAAkB,EAAE,KAAM,EAC1B,QAAS,EAAE,MAAO,EAEpB,+BAAiC,EAC/B,KAAM,EAAE,MAAO,EAEjB,yCAA2C,EACzC,SAAU,EAAE,SAAU,EACtB,MAAO,EAAE,AAAC,EACV,KAAM,EAAE,GAAI,EACZ,MAAO,EAAE,GAAI,EAEf,mBAAoB,EAClB,iBAAkB,EAAE,QAAS,EAC7B,cAAe,EAAE,UAAW,EAC5B,iBAAkB,EAAE,UAAW,EAC/B,SAAU,EAAE,UAAW,EAEzB,iGAAmG,EACjG,iBAAkB,EAAE,GAAI,EAE1B,+CAAiD,EAC/C,KAAM,EAAE,AAAC,EACT,MAAO,EAAE,AAAC,EAEZ,OAAQ,EACN,OAAQ,EAAE,GAAI,EACd,aAAc,EAAE,EAAG,EACnB,KAAM,EAAE,OAAQ,EAElB,IAAK,EACH,cAAe,EAAE,OAAQ,EACzB,aAAc,EAAE,AAAC,EAEnB,CAAE,EACA,aAAc,EAAE,EAAG,EAErB,WAAY,EACV,KAAM,EAAE,MAAO,EACf,SAAU,EAAE,GAAI,EAChB,IAAK,EAAE,GAAK,EACZ,MAAO,EAAE,MAAO,EAElB,EAAG,EACD,MAAO,EAAE,IAAK,EACd,KAAM,EAAE,AAAC,EACT,UAAW,EAAE,KAAM,EACnB,OAAQ,EAAE,KAAM,EAChB,eAAgB,EAAE,UAAW,EAC7B,gBAAiB,EAAE,QAAS,EAC5B,SAAU,EAAE,GAAI,EAChB,QAAS,EAAE,EAAG,EACd,WAAY,EAAE,AAAC,EAEjB,KAAM,EACJ,MAAO,EAAE,GAAI,EAEf,MAAO,EACL,MAAO,EAAE,cAAe,EACxB,SAAU,EAAE,KAAM,EAEpB,cAAe,EACb,KAAM,EAAE,AAAC,EACT,GAAI,EAAE,YAAa,EACnB,KAAM,EAAE,EAAG,EACX,KAAM,EAAE,GAAI,EACZ,OAAQ,EAAE,KAAM,EAChB,MAAO,EAAE,AAAC,EACV,OAAQ,EAAE,OAAQ,EAClB,IAAK,EAAE,EAAG,EAEZ,+DAAiE,EAC/D,GAAI,EAAE,GAAI,EACV,KAAM,EAAE,GAAI,EACZ,KAAM,EAAE,AAAC,EACT,OAAQ,EAAE,MAAO,EACjB,OAAQ,EAAE,KAAM,EAChB,IAAK,EAAE,GAAI,EAEb,SAAU,EACR,SAAU,EAAE,KAAM,EAEpB,QAAS,EACP,OAAQ,EAAE,OAAQ,EAEpB,QAAU,EACR,QAAS,EAAE,GAAI,EAEjB,WAAY,EACV,gBAAmB,EACjB,SAAU,EAAE,cAAe,EAC7B,AAAC,EACC,SAAU,EAAE,cAAe,EAC3B,UAAW,EAAE,cAAe,EAC5B,KAAM,EAAE,cAAe,EACvB,SAAU,EAAE,cAAe,EAC7B,UAAY,EACV,cAAe,EAAE,QAAS,EAC5B,0DAA6D,EAC3D,MAAO,EAAE,CAAE,EACb,aAAe,EACb,gBAAiB,EAAE,IAAK,EAC1B,IAAK,EACH,MAAO,EAAE,iBAAkB,EAC7B,KAAO,EACL,gBAAiB,EAAE,IAAK,EAC1B,EAAG,EACD,QAAS,EAAE,cAAe,QAE1B,KAAM,EAAE,IAAK,EAEf,8CAAS,EACP,MAAO,EAAE,AAAC,EACV,KAAM,EAAE,AAAC,EACX,4CAAM,EACJ,eAAgB,EAAE,IAAK,GChM3B,ykDAAY,EACV,qBAAsB,EAAE,UAAW,EAqDrC,QAAS,EARP,IAAK,EAAE,AAAC,EACR,+BAAS,EAEP,MAAO,EAAE,IAAK,EACd,MAAO,EAAE,CAAE,EACb,cAAO,EACL,IAAK,EAAE,GAAI,EC7Gf;;;IAGG,DCAH,UAWC,CAVC,WAAW,CAAE,aAAa,CAC1B,GAAG,CAAE,+CAAgE,CACrE,GAAG,CAAE,wWAI8F,CAEnG,WAAW,CAAE,MAAM,CACnB,UAAU,CAAE,MAAM,CCVpB,kfAAmB,CACjB,OAAO,CAAE,YAAY,CACrB,IAAI,CAAE,uCAA8E,CACpF,SAAS,CAAE,OAAO,CAClB,cAAc,CAAE,IAAI,CACpB,sBAAsB,CAAE,WAAW,CACnC,uBAAuB,CAAE,SAAS,CCLpC,MAAsB,CACpB,SAAS,CAAE,SAAS,CACpB,WAAW,CAAE,KAAS,CACtB,cAAc,CAAE,IAAI,CAEtB,MAAsB,CAAE,SAAS,CAAE,GAAG,CACtC,MAAsB,CAAE,SAAS,CAAE,GAAG,CACtC,MAAsB,CAAE,SAAS,CAAE,GAAG,CACtC,MAAsB,CAAE,SAAS,CAAE,GAAG,CCVtC,MAAsB,CACpB,KAAK,CAAE,SAAW,CAClB,UAAU,CAAE,MAAM,CCDpB,MAAsB,CACpB,YAAY,CAAE,CAAC,CACf,WAAW,CCMU,SAAS,CDL9B,eAAe,CAAE,IAAI,CACrB,SAAK,CAAE,QAAQ,CAAE,QAAQ,CAE3B,MAAsB,CACpB,QAAQ,CAAE,QAAQ,CAClB,IAAI,CAAE,UAAa,CACnB,KAAK,CCDgB,SAAS,CDE9B,GAAG,CAAE,QAAU,CACf,UAAU,CAAE,MAAM,CAClB,YAAuB,CACrB,IAAI,CAAE,UAA0B,CEbpC,UAA0B,CACxB,OAAO,CAAE,gBAAgB,CACzB,MAAM,CAAE,iBAA4B,CACpC,aAAa,CAAE,IAAI,CAGrB,aAA6B,CAAE,KAAK,CAAE,IAAI,CAC1C,cAA8B,CAAE,KAAK,CAAE,KAAK,CAG1C,ksBAA8B,CAAE,YAAY,CAAE,IAAI,CAClD,ktBAA+B,CAAE,WAAW,CAAE,IAAI,CAIpD,WAAY,CAAE,KAAK,CAAE,KAAK,CAC1B,UAAW,CAAE,KAAK,CAAE,IAAI,CAGtB,kpBAAY,CAAE,YAAY,CAAE,IAAI,CAChC,kqBAAa,CAAE,WAAW,CAAE,IAAI,CCpBlC,QAAwB,CACtB,iBAAiB,CAAE,0BAA0B,CACrC,SAAS,CAAE,0BAA0B,CAG/C,SAAyB,CACvB,iBAAiB,CAAE,4BAA4B,CACvC,SAAS,CAAE,4BAA4B,CAGjD,0BASC,CARC,EAAG,CACD,iBAAiB,CAAE,YAAY,CACvB,SAAS,CAAE,YAAY,CAEjC,IAAK,CACH,iBAAiB,CAAE,cAAc,CACzB,SAAS,CAAE,cAAc,EAIrC,kBASC,CARC,EAAG,CACD,iBAAiB,CAAE,YAAY,CACvB,SAAS,CAAE,YAAY,CAEjC,IAAK,CACH,iBAAiB,CAAE,cAAc,CACzB,SAAS,CAAE,cAAc,EC5BrC,aAA8B,CCW5B,UAAU,CAAE,0DAAqE,CACjF,iBAAiB,CAAE,aAAgB,CAC/B,aAAa,CAAE,aAAgB,CAC3B,SAAS,CAAE,aAAgB,CDbrC,cAA8B,CCU5B,UAAU,CAAE,0DAAqE,CACjF,iBAAiB,CAAE,cAAgB,CAC/B,aAAa,CAAE,cAAgB,CAC3B,SAAS,CAAE,cAAgB,CDZrC,cAA8B,CCS5B,UAAU,CAAE,0DAAqE,CACjF,iBAAiB,CAAE,cAAgB,CAC/B,aAAa,CAAE,cAAgB,CAC3B,SAAS,CAAE,cAAgB,CDVrC,mBAAmC,CCcjC,UAAU,CAAE,oEAA+E,CAC3F,iBAAiB,CAAE,YAAoB,CACnC,aAAa,CAAE,YAAoB,CAC/B,SAAS,CAAE,YAAoB,CDhBzC,iBAAmC,CCajC,UAAU,CAAE,oEAA+E,CAC3F,iBAAiB,CAAE,YAAoB,CACnC,aAAa,CAAE,YAAoB,CAC/B,SAAS,CAAE,YAAoB,CDXzC,+GAIuC,CACrC,MAAM,CAAE,IAAI,CEfd,SAAyB,CACvB,QAAQ,CAAE,QAAQ,CAClB,OAAO,CAAE,YAAY,CACrB,KAAK,CAAE,GAAG,CACV,MAAM,CAAE,GAAG,CACX,WAAW,CAAE,GAAG,CAChB,cAAc,CAAE,MAAM,CAExB,yBAAyD,CACvD,QAAQ,CAAE,QAAQ,CAClB,IAAI,CAAE,CAAC,CACP,KAAK,CAAE,IAAI,CACX,UAAU,CAAE,MAAM,CAEpB,YAA4B,CAAE,WAAW,CAAE,OAAO,CAClD,YAA4B,CAAE,SAAS,CAAE,GAAG,CAC5C,WAA2B,CAAE,KAAK,CLTZ,IAAI,CMP1B,gBAAgC,CAAE,OAAO,CNwU1B,GAAO,CMvUtB,gBAAgC,CAAE,OAAO,CN2d1B,GAAO,CM1dtB,qCAAiC,CAAE,OAAO,CN0jB1B,GAAO,CMzjBvB,qBAAqC,CAAE,OAAO,CNsO1B,GAAO,CMrO3B,gBAAgC,CAAE,OAAO,CNuW1B,GAAO,CMtWtB,eAA+B,CAAE,OAAO,CNknB1B,GAAO,CMjnBrB,iBAAiC,CAAE,OAAO,CNsnB1B,GAAO,CMrnBvB,eAA+B,CAAE,OAAO,CNytB1B,GAAO,CMxtBrB,eAA+B,CAAE,OAAO,CNmR1B,GAAO,CMlRrB,mBAAmC,CAAE,OAAO,CNupB1B,GAAO,CMtpBzB,aAA6B,CAAE,OAAO,CNqpB1B,GAAO,CMppBnB,kBAAkC,CAAE,OAAO,CNspB1B,GAAO,CMrpBxB,gBAAgC,CAAE,OAAO,CNyI1B,GAAO,CMxItB,mDAEgC,CAAE,OAAO,CNqqB1B,GAAO,CMpqBtB,sBAAsC,CAAE,OAAO,CN8iB1B,GAAO,CM7iB5B,uBAAuC,CAAE,OAAO,CN4iB1B,GAAO,CM3iB7B,oBAAoC,CAAE,OAAO,CN4f1B,GAAO,CM3f1B,iBAAiC,CAAE,OAAO,CNikB1B,GAAO,CMhkBvB,8BAC8B,CAAE,OAAO,CNgK1B,GAAO,CM/JpB,kBAAkC,CAAE,OAAO,CN+qB1B,GAAO,CM9qBxB,iCAA+B,CAAE,OAAO,CNwV1B,GAAO,CMvVrB,iBAAiC,CAAE,OAAO,CNuP1B,GAAO,CMtPvB,kBAAkC,CAAE,OAAO,CNgJ1B,GAAO,CM/IxB,eAA+B,CAAE,OAAO,CNmhB1B,GAAO,CMlhBrB,uHAAmC,CAAE,OAAO,CNgM1B,GAAO,CM/LzB,8BAA8C,CAAE,OAAO,CNY1B,GAAO,CMXpC,4BAA4C,CAAE,OAAO,CNc1B,GAAO,CMblC,gBAAgC,CAAE,OAAO,CNqW1B,GAAO,CMpWtB,wBAAwC,CAAE,OAAO,CNwe1B,GAAO,CMve9B,yCACiC,CAAE,OAAO,CNsgB1B,GAAO,CMrgBvB,kBAAkC,CAAE,OAAO,CNggB1B,GAAO,CM/fxB,mBAAmC,CAAE,OAAO,CNwY1B,GAAO,CMvYzB,eAA+B,CAAE,OAAO,CN2Y1B,GAAO,CM1YrB,eAA+B,CAAE,OAAO,CN4P1B,GAAO,CM3PrB,qBAAqC,CAAE,OAAO,CNoU1B,GAAO,CMnU3B,qBAAqC,CAAE,OAAO,CNitB1B,GAAO,CMhtB3B,sBAAsC,CAAE,OAAO,CN+sB1B,GAAO,CM9sB5B,oBAAoC,CAAE,OAAO,CNgtB1B,GAAO,CM/sB1B,iBAAiC,CAAE,OAAO,CNye1B,GAAO,CMxevB,kBAAkC,CAAE,OAAO,CNwB1B,GAAO,CMvBxB,cAA8B,CAAE,OAAO,CNymB1B,GAAO,CMxmBpB,eAA+B,CAAE,OAAO,CNymB1B,GAAO,CMxmBrB,iCAA+B,CAAE,OAAO,CNyD1B,GAAO,CMxDrB,mBAAmC,CAAE,OAAO,CNyD1B,GAAO,CMxDzB,gBAAgC,CAAE,OAAO,CN+d1B,GAAO,CM9dtB,iBAAiC,CAAE,OAAO,CN2E1B,GAAO,CM1EvB,eAA+B,CAAE,OAAO,CN0P1B,GAAO,CMzPrB,eAA+B,CAAE,OAAO,CNiD1B,GAAO,CMhDrB,iBAAiC,CAAE,OAAO,CN0V1B,GAAO,CMzVvB,sBAAsC,CAAE,OAAO,CNwmB1B,GAAO,CMvmB5B,qBAAqC,CAAE,OAAO,CNwmB1B,GAAO,CMvmB3B,qBAAqC,CAAE,OAAO,CNpC1B,GAAO,CMqC3B,uBAAuC,CAAE,OAAO,CNvC1B,GAAO,CMwC7B,sBAAsC,CAAE,OAAO,CNrC1B,GAAO,CMsC5B,wBAAwC,CAAE,OAAO,CNxC1B,GAAO,CMyC9B,eAA+B,CAAE,OAAO,CN+W1B,GAAO,CM9WrB,oCACkC,CAAE,OAAO,CN2a1B,GAAO,CM1axB,iBAAiC,CAAE,OAAO,CNsU1B,GAAO,CMrUvB,uBAAuC,CAAE,OAAO,CNkrB1B,GAAO,CMjrB7B,sDAEoC,CAAE,OAAO,CN0b1B,GAAO,CMzb1B,iBAAiC,CAAE,OAAO,CNkb1B,GAAO,CMjbvB,qBAAqC,CAAE,OAAO,CNwX1B,GAAO,CMvX3B,iBAAiC,CAAE,OAAO,CNtD1B,GAAO,CMuDvB,eAA+B,CAAE,OAAO,CNmnB1B,GAAO,CMlnBrB,0CAC0C,CAAE,OAAO,CN+a1B,GAAO,CM9ahC,yBAAyC,CAAE,OAAO,CN8f1B,GAAO,CM7f/B,yBAAyC,CAAE,OAAO,CN+E1B,GAAO,CM9E/B,iBAAiC,CAAE,OAAO,CNzB1B,GAAO,CM0BvB,wBAAwC,CAAE,OAAO,CNmjB1B,GAAO,CMljB9B,wBAAwC,CAAE,OAAO,CNqL1B,GAAO,CMpL9B,mBAAmC,CAAE,OAAO,CNlB1B,GAAO,CMmBzB,eAA+B,CAAE,OAAO,CNsb1B,GAAO,CMrbrB,gBAAgC,CAAE,OAAO,CNga1B,GAAO,CM/ZtB,eAA+B,CAAE,OAAO,CNmjB1B,GAAO,CMljBrB,kBAAkC,CAAE,OAAO,CN+N1B,GAAO,CM9NxB,uBAAuC,CAAE,OAAO,CNgL1B,GAAO,CM/K7B,uBAAuC,CAAE,OAAO,CN4iB1B,GAAO,CM3iB7B,gBAAgC,CAAE,OAAO,CN+I1B,GAAO,CM9ItB,uBAAuC,CAAE,OAAO,CNyE1B,GAAO,CMxE7B,wBAAwC,CAAE,OAAO,CNyE1B,GAAO,CMxE9B,sBAAsC,CAAE,OAAO,CNkb1B,GAAO,CMjb5B,uBAAuC,CAAE,OAAO,CNuX1B,GAAO,CMtX7B,8FAAuC,CAAE,OAAO,CN2lB1B,GAAO,CM1lB7B,+FAAuC,CAAE,OAAO,CN2D1B,GAAO,CM1D7B,0BAA0C,CAAE,OAAO,CNyb1B,GAAO,CMxbhC,sBAAsC,CAAE,OAAO,CN0S1B,GAAO,CMzS5B,qBAAqC,CAAE,OAAO,CN0G1B,GAAO,CMzG3B,yBAAyC,CAAE,OAAO,CNulB1B,GAAO,CMtlB/B,yBAAyC,CAAE,OAAO,CNuD1B,GAAO,CMtD/B,cAA8B,CAAE,OAAO,CNnC1B,GAAO,CMoCpB,qBAAqC,CAAE,OAAO,CNnD1B,GAAO,CMoD3B,sBAAsC,CAAE,OAAO,CNnD1B,GAAO,CMoD5B,mBAAmC,CAAE,OAAO,CNnD1B,GAAO,CMoDzB,qBAAqC,CAAE,OAAO,CNvD1B,GAAO,CMwD3B,wCACgC,CAAE,OAAO,CN4d1B,GAAO,CM3dtB,iBAAiC,CAAE,OAAO,CN8I1B,GAAO,CM7IvB,mBAAmC,CAAE,OAAO,CNsF1B,GAAO,CMrFzB,eAA+B,CAAE,OAAO,CN+Z1B,GAAO,CM9ZrB,gBAAgC,CAAE,OAAO,CNoW1B,GAAO,CMnWtB,mBAAmC,CAAE,OAAO,CNpD1B,GAAO,CMqDzB,gNAA6C,CAAE,OAAO,CNuI1B,GAAO,CMtInC,eAA+B,CAAE,OAAO,CNkN1B,GAAO,CMjNrB,eAA+B,CAAE,OAAO,CN0S1B,GAAO,CMzSrB,iCAA+B,CAAE,OAAO,CN6K1B,GAAO,CM5KrB,cAA8B,CAAE,OAAO,CNyI1B,GAAO,CMxIpB,oBAAoC,CAAE,OAAO,CNyI1B,GAAO,CMxI1B,kDAC+C,CAAE,OAAO,CNiI1B,GAAO,CMhIrC,gBAAgC,CAAE,OAAO,CN+Y1B,GAAO,CM9YtB,mBAAmC,CAAE,OAAO,CNA1B,GAAO,CMCzB,iBAAiC,CAAE,OAAO,CNoa1B,GAAO,CMnavB,kBAAkC,CAAE,OAAO,CNgE1B,GAAO,CM/DxB,iBAAiC,CAAE,OAAO,CN6T1B,GAAO,CM5TvB,qBAAqC,CAAE,OAAO,CNuC1B,GAAO,CMtC3B,uBAAuC,CAAE,OAAO,CNmC1B,GAAO,CMlC7B,kBAAkC,CAAE,OAAO,CN+a1B,GAAO,CM9axB,wBAAwC,CAAE,OAAO,CNkd1B,GAAO,CMjd9B,iBAAiC,CAAE,OAAO,CN0K1B,GAAO,CMzKvB,sBAAsC,CAAE,OAAO,CN2K1B,GAAO,CM1K5B,mBAAmC,CAAE,OAAO,CN3E1B,GAAO,CM4EzB,mBAAmC,CAAE,OAAO,CN7E1B,GAAO,CM8EzB,2CACoC,CAAE,OAAO,CNlE1B,GAAO,CMmE1B,yBAAyC,CAAE,OAAO,CN+kB1B,GAAO,CM9kB/B,0BAA0C,CAAE,OAAO,CN4H1B,GAAO,CM3HhC,uBAAuC,CAAE,OAAO,CNT1B,GAAO,CMU7B,cAA8B,CAAE,OAAO,CN2Q1B,GAAO,CM1QpB,gCAC+B,CAAE,OAAO,CN6C1B,GAAO,CM5CrB,mBAAmC,CAAE,OAAO,CNkD1B,GAAO,CMjDzB,sBAAsC,CAAE,OAAO,CNsiB1B,GAAO,CMriB5B,wBAAwC,CAAE,OAAO,CNoiB1B,GAAO,CMniB9B,oBAAoC,CAAE,OAAO,CN2e1B,GAAO,CM1e1B,kBAAkC,CAAE,OAAO,CN8N1B,GAAO,CM7NxB,mBAAmC,CAAE,OAAO,CNoc1B,GAAO,CMnczB,0BAA0C,CAAE,OAAO,CNuR1B,GAAO,CMtRhC,qBAAqC,CAAE,OAAO,CN6hB1B,GAAO,CM5hB3B,wBAAwC,CAAE,OAAO,CNsG1B,GAAO,CMrG9B,kBAAkC,CAAE,OAAO,CN8b1B,GAAO,CM7bxB,iBAAiC,CAAE,OAAO,CNqjB1B,GAAO,CMpjBvB,wBAAwC,CAAE,OAAO,CNgL1B,GAAO,CM/K9B,iBAAiC,CAAE,OAAO,CNukB1B,GAAO,CMtkBvB,kBAAkC,CAAE,OAAO,CNqQ1B,GAAO,CMpQxB,gBAAgC,CAAE,OAAO,CNiW1B,GAAO,CMhWtB,mBAAmC,CAAE,OAAO,CN2d1B,GAAO,CM1dzB,qBAAqC,CAAE,OAAO,CNjD1B,GAAO,CMkD3B,uBAAuC,CAAE,OAAO,CN+V1B,GAAO,CM9V7B,kBAAkC,CAAE,OAAO,CNsjB1B,GAAO,CMrjBxB,yCACmC,CAAE,OAAO,CNgG1B,GAAO,CM/FzB,qCAAiC,CAAE,OAAO,CNoK1B,GAAO,CMnKvB,iBAAiC,CAAE,OAAO,CN0jB1B,GAAO,CMzjBvB,sBAAsC,CAAE,OAAO,CNoC1B,GAAO,CMnC5B,8BAC8B,CAAE,OAAO,CN+Y1B,GAAO,CM9YpB,gBAAgC,CAAE,OAAO,CNoM1B,GAAO,CMnMtB,mBAAmC,CAAE,OAAO,CNrD1B,GAAO,CMsDzB,eAA+B,CAAE,OAAO,CNhF1B,GAAO,CMiFrB,sBAAsC,CAAE,OAAO,CNrB1B,GAAO,CMsB5B,uBAAuC,CAAE,OAAO,CNoL1B,GAAO,CMnL7B,sBAAsC,CAAE,OAAO,CNkL1B,GAAO,CMjL5B,oBAAoC,CAAE,OAAO,CNmL1B,GAAO,CMlL1B,sBAAsC,CAAE,OAAO,CN+K1B,GAAO,CM9K5B,2DAA4C,CAAE,OAAO,CNrI1B,GAAO,CMsIlC,6DAA6C,CAAE,OAAO,CNjI1B,GAAO,CMkInC,0BAA0C,CAAE,OAAO,CNjI1B,GAAO,CMkIhC,4BAA4C,CAAE,OAAO,CNzI1B,GAAO,CM0IlC,gBAAgC,CAAE,OAAO,CN2J1B,GAAO,CM1JtB,iBAAiC,CAAE,OAAO,CN6lB1B,GAAO,CM5lBvB,gBAAgC,CAAE,OAAO,CNqe1B,GAAO,CMpetB,iBAAiC,CAAE,OAAO,CNyG1B,GAAO,CMxGvB,oBAAoC,CAAE,OAAO,CNzE1B,GAAO,CM0E1B,qBAAqC,CAAE,OAAO,CNlI1B,GAAO,CMmI3B,iCACgC,CAAE,OAAO,CNijB1B,GAAO,CMhjBtB,kDAC+B,CAAE,OAAO,CN4O1B,GAAO,CM3OrB,gBAAgC,CAAE,OAAO,CNd1B,GAAO,CMetB,gBAAgC,CAAE,OAAO,CN0G1B,GAAO,CMzGtB,kCACmC,CAAE,OAAO,CN6X1B,GAAO,CM5XzB,kCACkC,CAAE,OAAO,CN2F1B,GAAO,CM1FxB,oBAAoC,CAAE,OAAO,CN6S1B,GAAO,CM5S1B,mCACmC,CAAE,OAAO,CNqG1B,GAAO,CMpGzB,iBAAiC,CAAE,OAAO,CNgb1B,GAAO,CM/avB,qDAE+B,CAAE,OAAO,CNlI1B,GAAO,CMmIrB,kBAAkC,CAAE,OAAO,CNsO1B,GAAO,CMrOxB,kBAAkC,CAAE,OAAO,CNoO1B,GAAO,CMnOxB,wBAAwC,CAAE,OAAO,CN+b1B,GAAO,CM9b9B,oBAAoC,CAAE,OAAO,CN2gB1B,GAAO,CM1gB1B,gBAAgC,CAAE,OAAO,CNuc1B,GAAO,CMtctB,gBAAgC,CAAE,OAAO,CNyO1B,GAAO,CMxOtB,gBAAgC,CAAE,OAAO,CN6f1B,GAAO,CM5ftB,oBAAoC,CAAE,OAAO,CNmT1B,GAAO,CMlT1B,2BAA2C,CAAE,OAAO,CNoT1B,GAAO,CMnTjC,6BAA6C,CAAE,OAAO,CNgI1B,GAAO,CM/HnC,sBAAsC,CAAE,OAAO,CN4H1B,GAAO,CM3H5B,gBAAgC,CAAE,OAAO,CNqQ1B,GAAO,CMpQtB,wEAAqC,CAAE,OAAO,CNpF1B,GAAO,CMqF3B,mBAAmC,CAAE,OAAO,CN9E1B,GAAO,CM+EzB,qBAAqC,CAAE,OAAO,CNrF1B,GAAO,CMsF3B,sBAAsC,CAAE,OAAO,CNrF1B,GAAO,CMsF5B,kBAAkC,CAAE,OAAO,CNhC1B,GAAO,CMiCxB,mCAC+B,CAAE,OAAO,CN0Y1B,GAAO,CMzYrB,yCACoC,CAAE,OAAO,CN8Y1B,GAAO,CM7Y1B,sCACmC,CAAE,OAAO,CN2Y1B,GAAO,CM1YzB,mBAAmC,CAAE,OAAO,CNU1B,GAAO,CMTzB,mBAAmC,CAAE,OAAO,CNuM1B,GAAO,CMtMzB,sCAC+B,CAAE,OAAO,CNqf1B,GAAO,CMpfrB,iCACgC,CAAE,OAAO,CNoF1B,GAAO,CMnFtB,0CACqC,CAAE,OAAO,CN+a1B,GAAO,CM9a3B,oBAAoC,CAAE,OAAO,CN7C1B,GAAO,CM8C1B,qBAAqC,CAAE,OAAO,CN1C1B,GAAO,CM2C3B,gCAC+B,CAAE,OAAO,CNpI1B,GAAO,CMqIrB,kBAAkC,CAAE,OAAO,CN6W1B,GAAO,CM5WxB,mBAAmC,CAAE,OAAO,CNye1B,GAAO,CMxezB,qCACoC,CAAE,OAAO,CNrE1B,GAAO,CMsE1B,sBAAsC,CAAE,OAAO,CNqL1B,GAAO,CMpL5B,mBAAmC,CAAE,OAAO,CNG1B,GAAO,CMFzB,yBAAyC,CAAE,OAAO,CNnE1B,GAAO,CMoE/B,uBAAuC,CAAE,OAAO,CNnE1B,GAAO,CMoE7B,kBAAkC,CAAE,OAAO,CNif1B,GAAO,CMhfxB,sBAAsC,CAAE,OAAO,CN8Y1B,GAAO,CM7Y5B,mBAAmC,CAAE,OAAO,CNyZ1B,GAAO,CMxZzB,iBAAiC,CAAE,OAAO,CN9J1B,GAAO,CM+JvB,iBAAiC,CAAE,OAAO,CNlE1B,GAAO,CMmEvB,kBAAkC,CAAE,OAAO,CN1C1B,GAAO,CM2CxB,sBAAsC,CAAE,OAAO,CN8B1B,GAAO,CM7B5B,qBAAqC,CAAE,OAAO,CN1I1B,GAAO,CM2I3B,qBAAqC,CAAE,OAAO,CNsH1B,GAAO,CMrH3B,oBAAoC,CAAE,OAAO,CNrO1B,GAAO,CMsO1B,iBAAiC,CAAE,OAAO,CN4M1B,GAAO,CM3MvB,sBAAsC,CAAE,OAAO,CNU1B,GAAO,CMT5B,eAA+B,CAAE,OAAO,CN3K1B,GAAO,CM4KrB,mBAAmC,CAAE,OAAO,CNuF1B,GAAO,CMtFzB,sBAAsC,CAAE,OAAO,CN2Q1B,GAAO,CM1Q5B,4BAA4C,CAAE,OAAO,CNrO1B,GAAO,CMsOlC,6BAA6C,CAAE,OAAO,CNrO1B,GAAO,CMsOnC,0BAA0C,CAAE,OAAO,CNrO1B,GAAO,CMsOhC,4BAA4C,CAAE,OAAO,CNzO1B,GAAO,CM0OlC,qBAAqC,CAAE,OAAO,CNrO1B,GAAO,CMsO3B,sBAAsC,CAAE,OAAO,CNrO1B,GAAO,CMsO5B,mBAAmC,CAAE,OAAO,CNrO1B,GAAO,CMsOzB,qBAAqC,CAAE,OAAO,CNzO1B,GAAO,CM0O3B,kBAAkC,CAAE,OAAO,CNpD1B,GAAO,CMqDxB,iBAAiC,CAAE,OAAO,CN4I1B,GAAO,CM3IvB,iBAAiC,CAAE,OAAO,CNwY1B,GAAO,CMvYvB,yCACiC,CAAE,OAAO,CNuM1B,GAAO,CMtMvB,mBAAmC,CAAE,OAAO,CNzG1B,GAAO,CM0GzB,qBAAqC,CAAE,OAAO,CNyQ1B,GAAO,CMxQ3B,sBAAsC,CAAE,OAAO,CNyQ1B,GAAO,CMxQ5B,kBAAkC,CAAE,OAAO,CN+V1B,GAAO,CM9VxB,iBAAiC,CAAE,OAAO,CN9G1B,GAAO,CM+GvB,sCACgC,CAAE,OAAO,CNoR1B,GAAO,CMnRtB,qBAAqC,CAAE,OAAO,CN+C1B,GAAO,CM9C3B,mBAAmC,CAAE,OAAO,CNmB1B,GAAO,CMlBzB,wBAAwC,CAAE,OAAO,CNoB1B,GAAO,CMnB9B,kBAAkC,CAAE,OAAO,CNqU1B,GAAO,CMpUxB,kBAAkC,CAAE,OAAO,CN2B1B,GAAO,CM1BxB,gBAAgC,CAAE,OAAO,CNgL1B,GAAO,CM/KtB,kBAAkC,CAAE,OAAO,CN2B1B,GAAO,CM1BxB,qBAAqC,CAAE,OAAO,CNuH1B,GAAO,CMtH3B,iBAAiC,CAAE,OAAO,CNM1B,GAAO,CMLvB,yBAAyC,CAAE,OAAO,CNI1B,GAAO,CMH/B,mBAAmC,CAAE,OAAO,CN6X1B,GAAO,CM5XzB,eAA+B,CAAE,OAAO,CNhH1B,GAAO,CMiHrB,8CACoC,CAAE,OAAO,CNuQ1B,GAAO,CMtQ1B,2EAEsC,CAAE,OAAO,CNsV1B,GAAO,CMrV5B,yBAAyC,CAAE,OAAO,CNwI1B,GAAO,CMvI/B,eAA+B,CAAE,OAAO,CNhG1B,GAAO,CMiGrB,oBAAoC,CAAE,OAAO,CNvH1B,GAAO,CMwH1B,yCACuC,CAAE,OAAO,CNtJ1B,GAAO,CMuJ7B,mBAAmC,CAAE,OAAO,CNyO1B,GAAO,CMxOzB,eAA+B,CAAE,OAAO,CN0F1B,GAAO,CMzFrB,sBAAsC,CAAE,OAAO,CN1D1B,GAAO,CM2D5B,sBAAsC,CAAE,OAAO,CNkW1B,GAAO,CMjW5B,oBAAoC,CAAE,OAAO,CN4V1B,GAAO,CM3V1B,iBAAiC,CAAE,OAAO,CNlE1B,GAAO,CMmEvB,uBAAuC,CAAE,OAAO,CNgO1B,GAAO,CM/N7B,qBAAqC,CAAE,OAAO,CN2J1B,GAAO,CM1J3B,2BAA2C,CAAE,OAAO,CN2J1B,GAAO,CM1JjC,iBAAiC,CAAE,OAAO,CNsR1B,GAAO,CMrRvB,qBAAqC,CAAE,OAAO,CN5L1B,GAAO,CM6L3B,4BAA4C,CAAE,OAAO,CNxB1B,GAAO,CMyBlC,iBAAiC,CAAE,OAAO,CNuP1B,GAAO,CMtPvB,iBAAiC,CAAE,OAAO,CN6I1B,GAAO,CM5IvB,8BAA8C,CAAE,OAAO,CN9J1B,GAAO,CM+JpC,+BAA+C,CAAE,OAAO,CN9J1B,GAAO,CM+JrC,4BAA4C,CAAE,OAAO,CN9J1B,GAAO,CM+JlC,8BAA8C,CAAE,OAAO,CNlK1B,GAAO,CMmKpC,gBAAgC,CAAE,OAAO,CN8D1B,GAAO,CM7DtB,eAA+B,CAAE,OAAO,CNrH1B,GAAO,CMsHrB,iBAAiC,CAAE,OAAO,CNvS1B,GAAO,CMwSvB,qBAAqC,CAAE,OAAO,CN2Z1B,GAAO,CM1Z3B,mBAAmC,CAAE,OAAO,CNhN1B,GAAO,CMiNzB,qBAAqC,CAAE,OAAO,CN7F1B,GAAO,CM8F3B,qBAAqC,CAAE,OAAO,CN7F1B,GAAO,CM8F3B,qBAAqC,CAAE,OAAO,CN+O1B,GAAO,CM9O3B,sBAAsC,CAAE,OAAO,CNiM1B,GAAO,CMhM5B,iBAAiC,CAAE,OAAO,CN6W1B,GAAO,CM5WvB,uBAAuC,CAAE,OAAO,CN0I1B,GAAO,CMzI7B,wIAAyC,CAAE,OAAO,CN0I1B,GAAO,CMzI/B,mBAAmC,CAAE,OAAO,CNqF1B,GAAO,CMpFzB,qBAAqC,CAAE,OAAO,CNmF1B,GAAO,CMlF3B,uBAAuC,CAAE,OAAO,CNnL1B,GAAO,CMoL7B,wBAAwC,CAAE,OAAO,CN0K1B,GAAO,CMzK9B,+BAA+C,CAAE,OAAO,CNpF1B,GAAO,CMqFrC,uBAAuC,CAAE,OAAO,CNwP1B,GAAO,CMvP7B,kBAAkC,CAAE,OAAO,CNjJ1B,GAAO,CMkJxB,qDAC8C,CAAE,OAAO,CN/M1B,GAAO,CMgNpC,iDAC4C,CAAE,OAAO,CN9M1B,GAAO,CM+MlC,uDAC+C,CAAE,OAAO,CNjN1B,GAAO,CMkNrC,8BAC8B,CAAE,OAAO,CNvG1B,GAAO,CMwGpB,cAA8B,CAAE,OAAO,CNhC1B,GAAO,CMiCpB,gCAC8B,CAAE,OAAO,CNqY1B,GAAO,CMpYpB,+BAC8B,CAAE,OAAO,CN4C1B,GAAO,CM3CpB,2DAG8B,CAAE,OAAO,CNgD1B,GAAO,CM/CpB,iDAE8B,CAAE,OAAO,CNiN1B,GAAO,CMhNpB,6BAC8B,CAAE,OAAO,CN+C1B,GAAO,CM9CpB,iCAC8B,CAAE,OAAO,CN3P1B,GAAO,CM4PpB,eAA+B,CAAE,OAAO,CNhG1B,GAAO,CMiGrB,oBAAoC,CAAE,OAAO,CNpF1B,GAAO,CMqF1B,yBAAyC,CAAE,OAAO,CN0P1B,GAAO,CMzP/B,0BAA0C,CAAE,OAAO,CN0P1B,GAAO,CMzPhC,0BAA0C,CAAE,OAAO,CN0P1B,GAAO,CMzPhC,2BAA2C,CAAE,OAAO,CN0P1B,GAAO,CMzPjC,2BAA2C,CAAE,OAAO,CN6P1B,GAAO,CM5PjC,4BAA4C,CAAE,OAAO,CN6P1B,GAAO,CM5PlC,oBAAoC,CAAE,OAAO,CNkU1B,GAAO,CMjU1B,sBAAsC,CAAE,OAAO,CN8T1B,GAAO,CM7T5B,yBAAyC,CAAE,OAAO,CNya1B,GAAO,CMxa/B,kBAAkC,CAAE,OAAO,CNsa1B,GAAO,CMraxB,eAA+B,CAAE,OAAO,CN2Z1B,GAAO,CM1ZrB,sBAAsC,CAAE,OAAO,CN2Z1B,GAAO,CM1Z5B,uBAAuC,CAAE,OAAO,CNoa1B,GAAO,CMna7B,kBAAkC,CAAE,OAAO,CNxJ1B,GAAO,CMyJxB,yBAAyC,CAAE,OAAO,CN8P1B,GAAO,CM7P/B,oBAAoC,CAAE,OAAO,CNgB1B,GAAO,CMf1B,iBAAiC,CAAE,OAAO,CNpF1B,GAAO,CMqFvB,cAA8B,CAAE,OAAO,CN3W1B,GAAO,CM4WpB,2CAAoC,CAAE,OAAO,CN/R1B,GAAO,CMgS1B,2BAA2C,CAAE,OAAO,CN/R1B,GAAO,CMgSjC,iBAAiC,CAAE,OAAO,CN+U1B,GAAO,CM9UvB,wBAAwC,CAAE,OAAO,CN+U1B,GAAO,CM9U9B,0BAA0C,CAAE,OAAO,CNgD1B,GAAO,CM/ChC,wBAAwC,CAAE,OAAO,CNkD1B,GAAO,CMjD9B,0BAA0C,CAAE,OAAO,CN+C1B,GAAO,CM9ChC,2BAA2C,CAAE,OAAO,CN+C1B,GAAO,CM9CjC,gBAAgC,CAAE,OAAO,CNjW1B,GAAO,CMkWtB,kBAAkC,CAAE,OAAO,CNmY1B,GAAO,CMlYxB,kBAAkC,CAAE,OAAO,CN7W1B,GAAO,CM8WxB,gBAAgC,CAAE,OAAO,CNkC1B,GAAO,CMjCtB,mBAAmC,CAAE,OAAO,CN5K1B,GAAO,CM6KzB,gBAAgC,CAAE,OAAO,CNgN1B,GAAO,CM/MtB,qBAAqC,CAAE,OAAO,CNxF1B,GAAO,CMyF3B,iBAAiC,CAAE,OAAO,CN4T1B,GAAO,CM3TvB,iBAAiC,CAAE,OAAO,CNtI1B,GAAO,CMuIvB,eAA+B,CAAE,OAAO,CN6C1B,GAAO,CM5CrB,qCACmC,CAAE,OAAO,CN5D1B,GAAO,CM6DzB,gBAAgC,CAAE,OAAO,CN8P1B,GAAO,CM7PtB,iBAAiC,CAAE,OAAO,CNuE1B,GAAO,CMtEvB,kBAAkC,CAAE,OAAO,CN9W1B,GAAO,CM+WxB,cAA8B,CAAE,OAAO,CNtS1B,GAAO,CMuSpB,aAA6B,CAAE,OAAO,CNiW1B,GAAO,CMhWnB,gBAAgC,CAAE,OAAO,CNuW1B,GAAO,CMtWtB,iBAAiC,CAAE,OAAO,CN+I1B,GAAO,CM9IvB,oBAAoC,CAAE,OAAO,CNkF1B,GAAO,CMjF1B,yBAAyC,CAAE,OAAO,CN6N1B,GAAO,CM5N/B,+BAA+C,CAAE,OAAO,CN/W1B,GAAO,CMgXrC,8BAA8C,CAAE,OAAO,CNjX1B,GAAO,CMkXpC,qDAC8C,CAAE,OAAO,CNzR1B,GAAO,CM0RpC,uBAAuC,CAAE,OAAO,CNnM1B,GAAO,CMoM7B,qBAAqC,CAAE,OAAO,CNiW1B,GAAO,CMhW3B,uBAAuC,CAAE,OAAO,CNoV1B,GAAO,CMnV7B,sCAC8B,CAAE,OAAO,CN0S1B,GAAO,CMzSpB,wEAAwC,CAAE,OAAO,CN0G1B,GAAO,CMzG9B,wBAAwC,CAAE,OAAO,CN4M1B,GAAO,CM3M9B,gBAAgC,CAAE,OAAO,CNsL1B,GAAO,CMrLtB,0BAA0C,CAAE,OAAO,CNzL1B,GAAO,CM0LhC,oBAAoC,CAAE,OAAO,CNoW1B,GAAO,CMnW1B,iBAAiC,CAAE,OAAO,CN8D1B,GAAO,CM7DvB,4DAEqC,CAAE,OAAO,CN8S1B,GAAO,CM7S3B,iDACyC,CAAE,OAAO,CN1F1B,GAAO,CM2F/B,gBAAgC,CAAE,OAAO,CNsW1B,GAAO,CMrWtB,iBAAiC,CAAE,OAAO,CNlG1B,GAAO,CMmGvB,iBAAiC,CAAE,OAAO,CNgH1B,GAAO,CM/GvB,wBAAwC,CAAE,OAAO,CNiH1B,GAAO,CMhH9B,6BAA6C,CAAE,OAAO,CNyN1B,GAAO,CMxNnC,sBAAsC,CAAE,OAAO,CNuN1B,GAAO,CMtN5B,oBAAoC,CAAE,OAAO,CN/N1B,GAAO,CMgO1B,eAA+B,CAAE,OAAO,CN5N1B,GAAO,CM6NrB,wBAAwC,CAAE,OAAO,CN2E1B,GAAO,CM1E9B,yBAAyC,CAAE,OAAO,CNyE1B,GAAO,CMxE/B,iBAAiC,CAAE,OAAO,CNvN1B,GAAO,CMwNvB,iBAAiC,CAAE,OAAO,CNzC1B,GAAO,CM0CvB,mBAAmC,CAAE,OAAO,CNpC1B,GAAO,CMqCzB,cAA8B,CAAE,OAAO,CNtL1B,GAAO,CMuLpB,mBAAmC,CAAE,OAAO,CN7U1B,GAAO,CM8UzB,gBAAgC,CAAE,OAAO,CN1R1B,GAAO,CM2RtB,cAA8B,CAAE,OAAO,CNsD1B,GAAO,CMrDpB,gBAAgC,CAAE,OAAO,CNmL1B,GAAO,CMlLtB,eAA+B,CAAE,OAAO,CNrP1B,GAAO,CMsPrB,gBAAgC,CAAE,OAAO,CNrP1B,GAAO,CMsPtB,kBAAkC,CAAE,OAAO,CN7W1B,GAAO,CM8WxB,yBAAyC,CAAE,OAAO,CN7W1B,GAAO,CM8W/B,gBAAgC,CAAE,OAAO,CN0L1B,GAAO,CMzLtB,uBAAuC,CAAE,OAAO,CN0L1B,GAAO,CMzL7B,kBAAkC,CAAE,OAAO,CNyF1B,GAAO,CMxFxB,oCAC8B,CAAE,OAAO,CNzU1B,GAAO,CM0UpB,8BAC+B,CAAE,OAAO,CN+M1B,GAAO,CM9MrB,eAA+B,CAAE,OAAO,CN4P1B,GAAO,CM3PrB,kBAAkC,CAAE,OAAO,CNuK1B,GAAO,CMtKxB,qBAAqC,CAAE,OAAO,CNtP1B,GAAO,CMuP3B,qBAAqC,CAAE,OAAO,CNiK1B,GAAO,CMhK3B,mBAAmC,CAAE,OAAO,CN9P1B,GAAO,CM+PzB,qBAAqC,CAAE,OAAO,CN/L1B,GAAO,CMgM3B,sBAAsC,CAAE,OAAO,CNxL1B,GAAO,CMyL5B,uBAAuC,CAAE,OAAO,CNrM1B,GAAO,CMsM7B,4BAA4C,CAAE,OAAO,CN/L1B,GAAO,CMgMlC,yEAEuC,CAAE,OAAO,CNxM1B,GAAO,CMyM7B,+CACyC,CAAE,OAAO,CN9M1B,GAAO,CM+M/B,+CACuC,CAAE,OAAO,CN/M1B,GAAO,CMgN7B,+CACuC,CAAE,OAAO,CNpM1B,GAAO,CMqM7B,sBAAsC,CAAE,OAAO,CNjN1B,GAAO,CMkN5B,eAA+B,CAAE,OAAO,CNuR1B,GAAO,CMtRrB,kBAAkC,CAAE,OAAO,CN5S1B,GAAO,CM6SxB,mBAAmC,CAAE,OAAO,CN9E1B,GAAO,CM+EzB,uGAIoC,CAAE,OAAO,CNnE1B,GAAO,CMoE1B,yBAAyC,CAAE,OAAO,CN/T1B,GAAO,CMgU/B,oDAEgC,CAAE,OAAO,CNqD1B,GAAO,CMpDtB,+BACiC,CAAE,OAAO,CNnQ1B,GAAO,CMoQvB,qBAAqC,CAAE,OAAO,CNzK1B,GAAO,CM0K3B,cAA8B,CAAE,OAAO,CN3K1B,GAAO,CM4KpB,0EAEsC,CAAE,OAAO,CNxJ1B,GAAO,CMyJ5B,wBAAwC,CAAE,OAAO,CN2K1B,GAAO,CM1K9B,aAA6B,CAAE,OAAO,CNiC1B,GAAO,CMhCnB,mCACiC,CAAE,OAAO,CN0Q1B,GAAO,CMzQvB,sCACsC,CAAE,OAAO,CNV1B,GAAO,CMW5B,0CACwC,CAAE,OAAO,CNX1B,GAAO,CMY9B,kBAAkC,CAAE,OAAO,CN1I1B,GAAO,CM2IxB,sBAAsC,CAAE,OAAO,CNlV1B,GAAO,CMmV5B,iBAAiC,CAAE,OAAO,CNjJ1B,GAAO,CMkJvB,oBAAoC,CAAE,OAAO,CNb1B,GAAO,CMc1B,kBAAkC,CAAE,OAAO,CN+F1B,GAAO,CM9FxB,oBAAoC,CAAE,OAAO,CNuE1B,GAAO,CMtE1B,2BAA2C,CAAE,OAAO,CNuE1B,GAAO,CMtEjC,eAA+B,CAAE,OAAO,CNzZ1B,GAAO,CM0ZrB,4CACmC,CAAE,OAAO,CN5M1B,GAAO,CM6MzB,cAA8B,CAAE,OAAO,CN0M1B,GAAO,CMzMpB,qBAAqC,CAAE,OAAO,CNxa1B,GAAO,CMya3B,eAA+B,CAAE,OAAO,CNI1B,GAAO,CMHrB,qBAAqC,CAAE,OAAO,CNuF1B,GAAO,CMtF3B,iBAAiC,CAAE,OAAO,CN2M1B,GAAO,CM1MvB,eAA+B,CAAE,OAAO,CN+Q1B,GAAO,CM9QrB,sBAAsC,CAAE,OAAO,CNzC1B,GAAO,CM0C5B,eAA+B,CAAE,OAAO,CNwP1B,GAAO,CMvPrB,qBAAqC,CAAE,OAAO,CNrZ1B,GAAO,CMsZ3B,iBAAiC,CAAE,OAAO,CNvB1B,GAAO,CMwBvB,wBAAwC,CAAE,OAAO,CN3L1B,GAAO,CM4L9B,kBAAkC,CAAE,OAAO,CN5X1B,GAAO,CM6XxB,wBAAwC,CAAE,OAAO,CNhY1B,GAAO,CMiY9B,sBAAsC,CAAE,OAAO,CNnY1B,GAAO,CMoY5B,kBAAkC,CAAE,OAAO,CNtY1B,GAAO,CMuYxB,oBAAoC,CAAE,OAAO,CNlY1B,GAAO,CMmY1B,oBAAoC,CAAE,OAAO,CNlY1B,GAAO,CMmY1B,qBAAqC,CAAE,OAAO,CN3b1B,GAAO,CM4b3B,uBAAuC,CAAE,OAAO,CN3b1B,GAAO,CM4b7B,gBAAgC,CAAE,OAAO,CN+K1B,GAAO,CM9KtB,oBAAoC,CAAE,OAAO,CNnV1B,GAAO,CMoV1B,aAA6B,CAAE,OAAO,CN9d1B,GAAO,CM+dnB,qBAAqC,CAAE,OAAO,CN5R1B,GAAO,CM6R3B,sBAAsC,CAAE,OAAO,CN/C1B,GAAO,CMgD5B,wBAAwC,CAAE,OAAO,CN9b1B,GAAO,CM+b9B,qBAAqC,CAAE,OAAO,CNtf1B,GAAO,CMuf3B,oBAAoC,CAAE,OAAO,CN/B1B,GAAO,CMgC1B,qBAAqC,CAAE,OAAO,CNzH1B,GAAO,CM0H3B,iBAAiC,CAAE,OAAO,CNvI1B,GAAO,CMwIvB,wBAAwC,CAAE,OAAO,CNvI1B,GAAO,CMwI9B,qBAAqC,CAAE,OAAO,CN4J1B,GAAO,CM3J3B,oBAAoC,CAAE,OAAO,CN4J1B,GAAO,CM3J1B,kBAAkC,CAAE,OAAO,CNxc1B,GAAO,CMycxB,cAA8B,CAAE,OAAO,CNjb1B,GAAO,CMkbpB,kBAAkC,CAAE,OAAO,CNvJ1B,GAAO,CMwJxB,oBAAoC,CAAE,OAAO,CN3gB1B,GAAO,CM4gB1B,aAA6B,CAAE,OAAO,CN7Z1B,GAAO,CM8ZnB,kDAE8B,CAAE,OAAO,CNzK1B,GAAO,CM0KpB,mBAAmC,CAAE,OAAO,CNpG1B,GAAO,CMqGzB,qBAAqC,CAAE,OAAO,CNxb1B,GAAO,CMyb3B,yBAAyC,CAAE,OAAO,CN5W1B,GAAO,CM6W/B,mBAAmC,CAAE,OAAO,CN9V1B,GAAO,CM+VzB,mBAAmC,CAAE,OAAO,CN9P1B,GAAO,CM+PzB,kBAAkC,CAAE,OAAO,CNrJ1B,GAAO,CMsJxB,iBAAiC,CAAE,OAAO,CNe1B,GAAO,CMdvB,uBAAuC,CAAE,OAAO,CN2B1B,GAAO,CM1B7B,sBAAsC,CAAE,OAAO,CNoC1B,GAAO,CMnC5B,mBAAmC,CAAE,OAAO,CNqC1B,GAAO,CMpCzB,oBAAoC,CAAE,OAAO,CN5a1B,GAAO,CM6a1B,0BAA0C,CAAE,OAAO,CN9a1B,GAAO,CM+ahC,kBAAkC,CAAE,OAAO,CN/V1B,GAAO,CMgWxB,eAA+B,CAAE,OAAO,CNoB1B,GAAO,CMnBrB,sBAAsC,CAAE,OAAO,CN8K1B,GAAO,CM7K5B,qBAAqC,CAAE,OAAO,CN/F1B,GAAO,CMgG3B,sBAAsC,CAAE,OAAO,CN6E1B,GAAO,CM5E5B,oBAAoC,CAAE,OAAO,CN9M1B,GAAO,CM+M1B,gBAAgC,CAAE,OAAO,CN+K1B,GAAO,CM9KtB,eAA+B,CAAE,OAAO,CN7H1B,GAAO,CM8HrB,kBAAkC,CAAE,OAAO,CNnH1B,GAAO,CMoHxB,0CACsC,CAAE,OAAO,CNkI1B,GAAO,CMjI5B,0BAA0C,CAAE,OAAO,CNkI1B,GAAO,CMjIhC,uBAAuC,CAAE,OAAO,CN0K1B,GAAO,CMzK7B,sBAAsC,CAAE,OAAO,CNlI1B,GAAO,CMmI5B,qBAAqC,CAAE,OAAO,CNyK1B,GAAO,CMxK3B,sBAAsC,CAAE,OAAO,CNnI1B,GAAO,CMoI5B,wBAAwC,CAAE,OAAO,CNlI1B,GAAO,CMmI9B,wBAAwC,CAAE,OAAO,CNpI1B,GAAO,CMqI9B,iBAAiC,CAAE,OAAO,CN1G1B,GAAO,CM2GvB,qBAAqC,CAAE,OAAO,CN7Q1B,GAAO,CM8Q3B,4BAA4C,CAAE,OAAO,CN1U1B,GAAO,CM2UlC,sBAAsC,CAAE,OAAO,CNzE1B,GAAO,CM0E5B,mBAAmC,CAAE,OAAO,CNkL1B,GAAO,CMjLzB,iBAAiC,CAAE,OAAO,CNX1B,GAAO,CMYvB,oBAAoC,CAAE,OAAO,CNuJ1B,GAAO,CMtJ1B,qBAAqC,CAAE,OAAO,CNwJ1B,GAAO,CMvJ3B,+BAC8B,CAAE,OAAO,CN/f1B,GAAO,CMggBpB,kBAAkC,CAAE,OAAO,CN4J1B,GAAO,CM3JxB,gBAAgC,CAAE,OAAO,CN8G1B,GAAO,CM7GtB,iBAAiC,CAAE,OAAO,CNwD1B,GAAO,CMvDvB,iBAAiC,CAAE,OAAO,CN9I1B,GAAO,CM+IvB,qCACuC,CAAE,OAAO,CN0L1B,GAAO,CMzL7B,wBAAwC,CAAE,OAAO,CNjH1B,GAAO,CMkH9B,mBAAmC,CAAE,OAAO,CNrH1B,GAAO,CMsHzB,uBAAuC,CAAE,OAAO,CNnW1B,GAAO,CMoW7B,+DAEuC,CAAE,OAAO,CN/gB1B,GAAO,CMghB7B,sDACiD,CAAE,OAAO,CN9gB1B,GAAO,CM+gBvC,4CACuC,CAAE,OAAO,CNlhB1B,GAAO,CMmhB7B,+CAC0C,CAAE,OAAO,CNnhB1B,GAAO,CMohBhC,6CACwC,CAAE,OAAO,CNxhB1B,GAAO,CMyhB9B,wBAAwC,CAAE,OAAO,CN3I1B,GAAO,CM4I9B,mBAAmC,CAAE,OAAO,CN3O1B,GAAO,CM4OzB,uBAAuC,CAAE,OAAO,CNxI1B,GAAO,CMyI7B,yBAAyC,CAAE,OAAO,CNxI1B,GAAO,CMyI/B,sBAAsC,CAAE,OAAO,CNwB1B,GAAO,CMvB5B,wBAAwC,CAAE,OAAO,CNwB1B,GAAO,CMvB9B,iBAAiC,CAAE,OAAO,CN/d1B,GAAO,CMgevB,yBAAyC,CAAE,OAAO,CNle1B,GAAO,CMme/B,gBAAgC,CAAE,OAAO,CNpc1B,GAAO,CMqctB,wBAAwC,CAAE,OAAO,CNljB1B,GAAO,CMmjB9B,sBAAsC,CAAE,OAAO,CNxP1B,GAAO,CMyP5B,iDAC0C,CAAE,OAAO,CNzP1B,GAAO,CM0PhC,gDACyC,CAAE,OAAO,CN7P1B,GAAO,CM8P/B,+CACwC,CAAE,OAAO,CNhQ1B,GAAO,CMiQ9B,oBAAoC,CAAE,OAAO,CNrQ1B,GAAO,CMsQ1B,6CACsC,CAAE,OAAO,CNxR1B,GAAO,CMyR5B,8CACuC,CAAE,OAAO,CN7R1B,GAAO,CM8R7B,0BAA0C,CAAE,OAAO,CN1R1B,GAAO,CM2RhC,wBAAwC,CAAE,OAAO,CNpS1B,GAAO,CMqS9B,uBAAuC,CAAE,OAAO,CN3R1B,GAAO,CM4R7B,yBAAyC,CAAE,OAAO,CN/R1B,GAAO,CMgS/B,uBAAuC,CAAE,OAAO,CNjS1B,GAAO,CMkS7B,oBAAoC,CAAE,OAAO,CN+D1B,GAAO,CM9D1B,qBAAqC,CAAE,OAAO,CN/F1B,GAAO,CMgG3B,2BAA2C,CAAE,OAAO,CN/b1B,GAAO,CMgcjC,aAA6B,CAAE,OAAO,CNtU1B,GAAO,CMuUnB,oBAAoC,CAAE,OAAO,CNtU1B,GAAO,CMuU1B,sBAAsC,CAAE,OAAO,CNkE1B,GAAO,CMjE5B,wBAAwC,CAAE,OAAO,CNrK1B,GAAO,CMsK9B,+BAA+C,CAAE,OAAO,CNrK1B,GAAO,CMsKrC,qBAAqC,CAAE,OAAO,CN5U1B,GAAO,CM6U3B,sBAAsC,CAAE,OAAO,CNwH1B,GAAO,CMvH5B,iBAAiC,CAAE,OAAO,CNnF1B,GAAO,CMoFvB,iBAAiC,CAAE,OAAO,CNze1B,GAAO,CM0evB,kBAAkC,CAAE,OAAO,CN9W1B,GAAO,CM+WxB,gBAAgC,CAAE,OAAO,CNxK1B,GAAO,CMyKtB,4BAA4C,CAAE,OAAO,CNpQ1B,GAAO,CMqQlC,mCACqC,CAAE,OAAO,CNS1B,GAAO,CMR3B,iBAAiC,CAAE,OAAO,CNjd1B,GAAO,CMkdvB,gBAAgC,CAAE,OAAO,CNzoB1B,GAAO,CM0oBtB,iBAAiC,CAAE,OAAO,CN/nB1B,GAAO,CMgoBvB,0BAA0C,CAAE,OAAO,CN3hB1B,GAAO,CM4hBhC,2BAA2C,CAAE,OAAO,CN9hB1B,GAAO,CM+hBjC,2BAA2C,CAAE,OAAO,CN5hB1B,GAAO,CM6hBjC,2BAA2C,CAAE,OAAO,CNjiB1B,GAAO,CMkiBjC,mBAAmC,CAAE,OAAO,CNpR1B,GAAO,CMqRzB,kBAAkC,CAAE,OAAO,CN5N1B,GAAO,CM6NxB,oBAAoC,CAAE,OAAO,CN5N1B,GAAO,CM6N1B,gBAAgC,CAAE,OAAO,CN/N1B,GAAO,CMgOtB,cAA8B,CAAE,OAAO,CNlO1B,GAAO,CMmOpB,qBAAqC,CAAE,OAAO,CNpe1B,GAAO,CMqe3B,uBAAuC,CAAE,OAAO,CNpe1B,GAAO,CMqe7B,gBAAgC,CAAE,OAAO,CNtS1B,GAAO,CMuStB,gBAAgC,CAAE,OAAO,CNiF1B,GAAO,CMhFtB,oBAAoC,CAAE,OAAO,CNlkB1B,GAAO,CMmkB1B,oBAAoC,CAAE,OAAO,CNrX1B,GAAO,CMsX1B,uBAAuC,CAAE,OAAO,CNpI1B,GAAO,CMqI7B,eAA+B,CAAE,OAAO,CNpc1B,GAAO,CMqcrB,0BAA0C,CAAE,OAAO,CNhe1B,GAAO,CMiehC,mBAAmC,CAAE,OAAO,CNpf1B,GAAO,CMqfzB,eAA+B,CAAE,OAAO,CNlN1B,GAAO,CMmNrB,uBAAuC,CAAE,OAAO,CN1X1B,GAAO,CM2X7B,cAA8B,CAAE,OAAO,CNoD1B,GAAO,CMnDpB,uBAAuC,CAAE,OAAO,CN3J1B,GAAO,CM4J7B,mBAAmC,CAAE,OAAO,CNzN1B,GAAO,CM0NzB,iBAAiC,CAAE,OAAO,CNlH1B,GAAO,CMmHvB,uBAAuC,CAAE,OAAO,CN7L1B,GAAO,CM8L7B,yBAAyC,CAAE,OAAO,CN7L1B,GAAO,CM8L/B,sBAAsC,CAAE,OAAO,CN3C1B,GAAO,CM4C5B,wBAAwC,CAAE,OAAO,CN3C1B,GAAO,CM4C9B,uBAAuC,CAAE,OAAO,CNrG1B,GAAO,CMsG7B,0BAA0C,CAAE,OAAO,CNrG1B,GAAO,CMsGhC,kBAAkC,CAAE,OAAO,CN7U1B,GAAO,CM8UxB,oBAAoC,CAAE,OAAO,CNnlB1B,GAAO,CMolB1B,sBAAsC,CAAE,OAAO,CNnlB1B,GAAO,CMolB5B,kBAAkC,CAAE,OAAO,CN/L1B,GAAO,CMgMxB,qCAAiC,CAAE,OAAO,CNlX1B,GAAO,CMmXvB,qBAAqC,CAAE,OAAO,CNkF1B,GAAO,CMjF3B,kBAAkC,CAAE,OAAO,CNmF1B,GAAO,CMlFxB,iBAAiC,CAAE,OAAO,CN9c1B,GAAO,CM+cvB,2BAA2C,CAAE,OAAO,CN2B1B,GAAO,CM1BjC,yBAAyC,CAAE,OAAO,CNmE1B,GAAO,CMlE/B,4BAA4C,CAAE,OAAO,CNxK1B,GAAO,CMyKlC,gBAAgC,CAAE,OAAO,CN9lB1B,GAAO,CM+lBtB,4BAA4C,CAAE,OAAO,CNtoB1B,GAAO,CMuoBlC,+BAA+C,CAAE,OAAO,CNqD1B,GAAO,CMpDrC,kBAAkC,CAAE,OAAO,CNxlB1B,GAAO,CMylBxB,sCAAsD,CAAE,OAAO,CN5oB1B,GAAO,CM6oB5C,0EAC8D,CAAE,OAAO,CN9qB1B,GAAO,CM+qBpD,8DAE+B,CAAE,OAAO,CNvf1B,GAAO,CMwfrB,gBAAgC,CAAE,OAAO,CNhY1B,GAAO,CMiYtB,kBAAkC,CAAE,OAAO,CNhY1B,GAAO,CMiYxB,2CACwC,CAAE,OAAO,CN1H1B,GAAO,CM2H9B,qBAAqC,CAAE,OAAO,CNzR1B,GAAO,CM0R3B,iBAAiC,CAAE,OAAO,CNiC1B,GAAO,CMhCvB,wBAAwC,CAAE,OAAO,CNiC1B,GAAO,CMhC9B,mBAAmC,CAAE,OAAO,CNlH1B,GAAO,CMmHzB,yBAAyC,CAAE,OAAO,CNlH1B,GAAO,CMmH/B,0BAA0C,CAAE,OAAO,CNlH1B,GAAO,CMmHhC,qBAAqC,CAAE,OAAO,CNrN1B,GAAO,CMsN3B,sBAAsC,CAAE,OAAO,CNpb1B,GAAO,CMqb5B,gBAAgC,CAAE,OAAO,CNmE1B,GAAO,CMlEtB,oBAAoC,CAAE,OAAO,CNpD1B,GAAO,CMqD1B,6DAC+C,CAAE,OAAO,CNzY1B,GAAO,CM0YrC,qCACuC,CAAE,OAAO,CN7a1B,GAAO,CM8a7B,sBAAsC,CAAE,OAAO,CNtX1B,GAAO,CMuX5B,wBAAwC,CAAE,OAAO,CNlf1B,GAAO,CMmf9B,0BAA0C,CAAE,OAAO,CNlf1B,GAAO,CMmfhC,iBAAiC,CAAE,OAAO,CNtT1B,GAAO,CMuTvB,uBAAuC,CAAE,OAAO,CNptB1B,GAAO,CMqtB7B,yBAAyC,CAAE,OAAO,CNptB1B,GAAO,CMqtB/B,wCACuC,CAAE,OAAO,CNrtB1B,GAAO,CMstB7B,4CACyC,CAAE,OAAO,CNttB1B,GAAO,CMutB/B,sBAAsC,CAAE,OAAO,CNJ1B,GAAO,CMK5B,wBAAwC,CAAE,OAAO,CNJ1B,GAAO,CMK9B,iBAAiC,CAAE,OAAO,CNH1B,GAAO,CMIvB,mBAAmC,CAAE,OAAO,CN3W1B,GAAO,CM4WzB,6CACkC,CAAE,OAAO,CN5W1B,GAAO,CM6WxB,iDACoC,CAAE,OAAO,CN7W1B,GAAO,CM8W1B,gBAAgC,CAAE,OAAO,CNtN1B,GAAO,CMuNtB,yBAAyC,CAAE,OAAO,CN3b1B,GAAO,CM4b/B,mBAAmC,CAAE,OAAO,CNtF1B,GAAO,CMuFzB,2EAE2C,CAAE,OAAO,CNxE1B,GAAO,CMyEjC,8DACqD,CAAE,OAAO,CNvE1B,GAAO,CMwE3C,oDAC2C,CAAE,OAAO,CN3E1B,GAAO,CM4EjC,uDAC8C,CAAE,OAAO,CN5E1B,GAAO,CM6EpC,qDAC4C,CAAE,OAAO,CNjF1B,GAAO,CMkFlC,iBAAiC,CAAE,OAAO,CN3K1B,GAAO,CM4KvB,iDAE+B,CAAE,OAAO,CNzrB1B,GAAO,CM0rBrB,kBAAkC,CAAE,OAAO,CNlP1B,GAAO,CMmPxB,0BAA0C,CAAE,OAAO,CNK1B,GAAO,CMJhC,0BAA0C,CAAE,OAAO,CNK1B,GAAO,CMJhC,yBAAyC,CAAE,OAAO,CNK1B,GAAO,CMJ/B,kDACuC,CAAE,OAAO,CND1B,GAAO,CME7B,sDACyC,CAAE,OAAO,CNF1B,GAAO,CMG/B,mBAAmC,CAAE,OAAO,CNxsB1B,GAAO,CMysBzB,eAA+B,CAAE,OAAO,CNpb1B,GAAO,CMqbrB,eAA+B,CAAE,OAAO,CN1hB1B,GAAO,CM2hBrB,eAA+B,CAAE,OAAO,CNxY1B,GAAO,CMyYrB,kBAAkC,CAAE,OAAO,CN/O1B,GAAO,CMgPxB,kBAAkC,CAAE,OAAO,CNziB1B,GAAO,CM0iBxB,oBAAoC,CAAE,OAAO,CNjU1B,GAAO,CMkU1B,sBAAsC,CAAE,OAAO,CN7K1B,GAAO,CM8K5B,sBAAsC,CAAE,OAAO,CNhI1B,GAAO,CMiI5B,qBAAqC,CAAE,OAAO,CNJ1B,GAAO,CMK3B,iBAAiC,CAAE,OAAO,CNxU1B,GAAO,COzcvB,QAAS,CH8BP,QAAQ,CAAE,QAAQ,CAClB,KAAK,CAAE,GAAG,CACV,MAAM,CAAE,GAAG,CACX,OAAO,CAAE,CAAC,CACV,MAAM,CAAE,IAAI,CACZ,QAAQ,CAAE,MAAM,CAChB,IAAI,CAAE,gBAAa,CACnB,MAAM,CAAE,CAAC,CAUT,kDACQ,CACN,QAAQ,CAAE,MAAM,CAChB,KAAK,CAAE,IAAI,CACX,MAAM,CAAE,IAAI,CACZ,MAAM,CAAE,CAAC,CACT,QAAQ,CAAE,OAAO,CACjB,IAAI,CAAE,IAAI,CIvDd,swBAAK,CACH,WAAW,CAAE,OAAO,CACpB,y5BAAQ,CACN,WAAW,CC+BuB,aAAa,CD9B/C,OAAO,CAAE,YAAY,CACrB,UAAU,CAAE,MAAM,CAClB,WAAW,CAAE,MAAM,CACnB,WAAW,CAAE,CAAC,CACd,eAAe,CAAE,OAAO,CAM5B,86BAAkB,CAChB,OAAO,CAAE,YAAY,CACrB,eAAe,CAAE,OAAO,CAGxB,muEAAgB,CACd,OAAO,CAAE,MAAM,CACf,2wEAAuB,CACrB,WAAW,CAAE,KAAI,CACnB,utEAAsB,CACpB,OAAO,CAAE,YAAY,CAE3B,2iBAA2B,CACzB,OAAO,CAAE,GAAE,CjBpBL,kBAAoB,CAAE,qBAAM,CAK5B,eAAiB,CAAE,qBAAM,CAezB,UAAY,CAAE,qBAAM,CiBE5B,+nBAAiC,CAC/B,OAAO,CAAE,CAAC,CAGV,mtCAAuB,CACrB,SAAS,CAAE,IAAI,CACf,cAAc,CAAE,IAAI,CEpBxB,0PAAS,CACP,OAAO,CAAE,IAAqB,CAC9B,WAAW,CDayB,IAAI,CCZxC,aAAa,CDYuB,IAAI,CCXxC,UAAU,CAAE,OAAmB,CAEjC,8CAAe,CACb,KAAK,CCe+B,IAAM,CDd1C,WAAW,CAAE,IAAI,CACjB,OAAO,CAAE,KAAK,CACd,KAAK,CCY+B,IAAM,CDX1C,UAAU,CAAE,OAAkB,CAC9B,MAAM,CAAE,KAAsB,CAC9B,OAAO,CAAE,QAA2C,CACpD,aAAa,CAAE,IAAqB,CAEtC,0ZAAyB,CACvB,UAAU,CAAE,OAAkB,CAC9B,mxCAAe,CACb,UAAU,CAAE,OAAiB,CACjC,kYAA0B,CACxB,UAAU,CAAE,OAAmB,CAC/B,ouCAAe,CACb,UAAU,CAAE,OAAoB,CAEpC,sYAAuB,CACrB,UAAU,CAAE,OAAmB,CAC/B,yuCAAe,CACb,UAAU,CAAE,OAAkB,CAElC,mZAA0B,CACxB,UAAU,CAAE,OAAuB,CACnC,swCAAe,CACb,UAAU,CAAE,OAAqB,CAErC,scAA0B,CACxB,UAAU,CCF0B,OAAmB,CDGvD,42CAAe,CACb,KAAK,CCpB6B,OAAW,CDqB7C,UAAU,CCHwB,OAAmB,CDIvD,8dAAC,CACC,KAAK,CCb6B,OAAK,CDe3C,sZAAsB,CACpB,aAAa,CAAE,CAAC,CAsBlB,kBAAkB,CAChB,QAAQ,CAAE,KAAK,CACf,MAAM,CAAE,GAAG,CACX,IAAI,CAAE,CAAC,CACP,OAAO,CDG6B,GAAG,CCFvC,qBAAE,CACA,OAAO,CAAE,KAAK,CACd,KAAK,CDT6B,KAAK,CCUvC,UAAU,CAAE,WAAW,CACvB,KAAK,CCrD6B,IAAM,CDsDxC,UAAU,CAAE,MAAM,CAClB,UAAU,CAAE,2BAA0B,CACtC,OAAO,CAAE,MAAmB,CAC5B,SAAS,CAAE,GAAG,CACd,OAAO,CAAE,CAAC,CACV,MAAM,CAAE,CAAC,CACT,WAAW,CAAE,IAAI,CACjB,QAAQ,CAAE,MAAM,CnB3FZ,kBAAoB,CAAE,gBAAM,CAK5B,eAAiB,CAAE,gBAAM,CAezB,UAAY,CAAE,gBAAM,CmByExB,0CAAsB,CACpB,UAAU,CC5FsB,OAAM,CD6FxC,uCAAmB,CACjB,UAAU,CC5DsB,OAAK,CD6DvC,0CAAsB,CACpB,UAAU,CDnFsB,OAAO,CCoFzC,yCAAqB,CACnB,UAAU,CDtEsB,OAAI,CCuEtC,wBAAI,CACF,OAAO,CAAE,CAAC,CACV,MAAM,CAAE,IAAI,CEhFd,oCAAsB,CFmFxB,kBAAkB,CAChB,MAAM,CAAE,IAAI,CACZ,GAAG,CAAE,CAAC,CACN,KAAK,CAAE,IAAI,CACX,qBAAE,CACA,KAAK,CAAE,IAAI,EG3FjB,MAAM,CACJ,SAAS,CAAE,IAAI,CACf,MAAM,CAAE,CAAC,CACT,cAAc,CAAE,QAAQ,CACxB,eAAe,CAAE,MAAM,CACvB,MAAM,CAAE,OAAO,CACf,WAAW,CAAE,MAAM,CACnB,kBAAkB,CAAE,MAAM,CAC1B,SAAS,CAAE,OAAO,CACpB,gDAAiD,CAC/C,MAAM,CAAE,CAAC,CACT,OAAO,CAAE,CAAC,CACZ,gBAAgB,CACd,MAAM,CAAE,OAAO,CAEjB,IAAI,CAEF,OAAO,CAAE,YAAY,CACrB,aAAa,CAAE,GAAG,CAClB,WAAW,CAAE,MAAM,CACnB,WAAW,CAAE,MAAM,CACnB,UAAU,CAAE,MAAM,CAClB,MAAM,CAAE,OAAO,CACf,SAAS,CAAE,IAAI,CACf,OAAO,CAAE,iBAA6F,CACtG,KAAK,CFf+B,IAAM,CEgB1C,MAAM,CAAE,yBAAyB,CACjC,gBAAgB,CF7CoB,OAAM,CE8C1C,eAAe,CAAE,IAAI,CACrB,WAAW,CAAE,MAAM,CACnB,WAAW,CFDyB,uDAA2D,CEE/F,UAAU,CAAE,mFAAqF,CACjG,YAAY,CAAE,KAAK,CACnB,cAAc,CAAE,MAAM,CACtB,QAAQ,CAAE,MAAM,CAChB,IAAI,CAAE,CAAC,CACP,iBAAiB,CAAE,IAAI,CtBxDjB,mBAAoB,CsByDb,IAAI,CtBpDX,gBAAiB,CsBoDV,IAAI,CtB/CX,eAAgB,CsB+CT,IAAI,CtBrCX,WAAY,CsBqCL,IAAI,CtBzDX,kBAAoB,CAAE,eAAM,CAK5B,eAAiB,CAAE,eAAM,CAezB,UAAY,CAAE,eAAM,CsByC5B,UAAU,CACR,UAAU,CAAE,OAAwB,CACpC,KAAK,CFjC+B,IAAM,CEoC1C,UAAO,CACL,UAAU,CAAE,OAAqC,CACjD,KAAK,CFtC6B,IAAM,CEuC1C,UAAO,CACL,UAAU,CAAE,OAAqC,CACjD,OAAO,CAAE,CAAC,CACZ,WAAQ,CACN,UAAU,CAAE,6EAA+E,CAC3F,OAAO,CAAE,iBAA6F,CACxG,YAAS,CACP,KAAK,CF9C6B,IAAM,CE+C1C,aAAU,CACR,gBAAgB,CAAE,IAAI,CACtB,MAAM,CAAE,2DAA2D,CACnE,MAAM,CAAE,iBAAmB,CAC3B,OAAO,CAAE,GAAG,CACZ,MAAM,CAAE,WAAW,CACnB,UAAU,CAAE,IAAI,CAEpB,aAAa,CACX,gBAAgB,CAAE,IAAI,CACtB,MAAM,CAAE,2DAA2D,CACnE,MAAM,CAAE,iBAAmB,CAC3B,OAAO,CAAE,GAAG,CACZ,MAAM,CAAE,WAAW,CACnB,UAAU,CAAE,IAAI,CAChB,4DAA0B,CACxB,gBAAgB,CAAE,IAAI,CACtB,MAAM,CAAE,2DAA2D,CACnE,MAAM,CAAE,iBAAmB,CAC3B,OAAO,CAAE,GAAI,CACb,MAAM,CAAE,WAAW,CACnB,UAAU,CAAE,IAAI,CAGpB,sBAAsB,CACpB,OAAO,CAAE,CAAC,CACV,MAAM,CAAE,CAAC,CAEX,UAAU,CACR,SAAS,CAAE,GAAG,CAEhB,SAAS,CACP,gBAAgB,CAAE,kBAAgB,CAClC,eAAO,CACL,gBAAgB,CAAE,kBAA6B,CAEnD,YAAY,CACV,gBAAgB,CAAE,kBAA2C,CAC7D,KAAK,CAAE,kBAAsB,CAC7B,kBAAO,CACL,gBAAgB,CAAE,kBAAuD,CACzE,KAAK,CF5F6B,OAAW,CE6F/C,oBAAS,CACP,KAAK,CAAE,kBAAsB,CAEjC,YAAY,CACV,gBAAgB,CAAE,kBAAiB,CACnC,kBAAO,CACL,gBAAgB,CAAE,eAA6B,CAEnD,WAAW,CACT,gBAAgB,CAAE,kBAAe,CACjC,iBAAO,CACL,gBAAgB,CAAE,kBAA4B,CAElD,YAAY,CACV,gBAAgB,CAAE,kBAAkB,CACpC,kBAAO,CACL,gBAAgB,CAAE,kBAA+B,CACrD,WAAW,CACT,gBAAgB,CJvIoB,IAAI,CIwIxC,iBAAO,CACL,gBAAgB,CAAE,kBAAoC,CAE1D,SAAS,CACP,gBAAgB,CAAE,sBAAsB,CACxC,KAAK,CF3G+B,OAAK,CE4GzC,UAAU,CAAE,IAAI,CAChB,YAAY,CAAE,sBAAsB,CACpC,eAAO,CACL,gBAAgB,CAAE,sBAAsB,CACxC,KAAK,CAAE,kBAAoC,CAC3C,UAAU,CAAE,IAAI,CAClB,gBAAQ,CACN,gBAAgB,CAAE,sBAAsB,CACxC,KAAK,CAAE,kBAAoC,CAC3C,UAAU,CAAE,IAAI,CAClB,iBAAS,CACP,KAAK,CFtH6B,OAAO,CEwH7C,mCAAoC,CAClC,cAAc,CAAE,MAAM,CAExB,aAAa,CACX,aAAa,CJ1IuB,IAAI,ChBuExC,KAAK,CAAE,CAAC,CACR,wCAAS,CAEP,OAAO,CAAE,KAAK,CACd,OAAO,CAAE,EAAE,CACb,mBAAO,CACL,KAAK,CAAE,IAAI,CqB3Ff,YAAY,CACV,QAAQ,CAAE,QAAQ,CAClB,OAAO,CAAE,YAAY,CAIvB,qCAAqC,CACnC,OAAO,CAAE,KAAK,CAChB,iBAAiB,CACf,QAAQ,CAAE,QAAQ,CAClB,IAAI,CAAE,CAAC,CACP,OAAO,CAAE,IAAI,CACb,KAAK,CAAE,IAAI,CACX,GAAG,CAAE,IAAI,CACT,SAAS,CAAE,IAAI,CACf,UAAU,CHW0B,OAAyB,CGV7D,OAAO,CLmD6B,GAAG,CKlDvC,MAAM,CAAE,iBAAgC,CACxC,UAAU,CAAE,2BAA0B,CACtC,OAAO,CAAE,IAAqB,CAC9B,sBAAQ,CACN,OAAO,CAAE,KAAK,CACd,KAAK,CAAE,IAAI,CACX,KAAK,CHN6B,OAAW,CGO7C,WAAW,CAAE,MAAM,CACnB,SAAS,CAAE,GAAG,CACd,OAAO,CAAE,MAAuB,CAChC,MAAM,CAAE,OAAO,CACf,4BAAO,CACL,UAAU,CHFsB,OAAK,CGGrC,KAAK,CHT2B,IAAM,CGU1C,4BAAY,CACV,UAAU,CAAE,iBAAgC,CAC5C,MAAM,CAAE,KAAuB,CACjC,2BAAW,CACT,cAAc,CAAE,IAAqB,CACrC,gDAAoB,CAClB,KAAK,CAAE,IAAI,CACf,mCAAmB,CACjB,UAAU,CAAE,OAA4B,CACxC,cAAc,CAAE,SAAS,CACzB,WAAW,CAAE,GAAG,CAChB,SAAS,CAAE,GAAG,CACd,yCAAO,CACL,UAAU,CAAE,OAA4B,CAC1C,wCAAI,CACF,KAAK,CHzB2B,IAAM,CG2B5C,6CAA6C,CAC3C,MAAM,CAAE,IAAI,CACZ,GAAG,CAAE,IAAI,CACT,IAAI,CAAE,IAAI,CACV,KAAK,CAAE,CAAC,CAGR,iDAAiB,CACf,UAAU,CH9BwB,OAAyB,CG+B3D,UAAU,CAAE,GAAG,CACjB,mDAAmB,CACjB,OAAO,CAAE,QAA2C,CACpD,yDAAO,CACL,UAAU,CHlCsB,OAAK,CGmCrC,KAAK,CHzC2B,IAAM,CG2C5C,+CAA+C,CAC7C,KAAK,CAAE,CAAC,CACR,IAAI,CAAE,IAAI,CACV,UAAU,CAAE,KAAK,CAGjB,yBAAQ,CACN,OAAO,CAAE,GAAG,CACZ,aAAa,CAAE,iBAA0B,CACzC,WAAW,CAAE,qBAAqB,CAClC,YAAY,CAAE,qBAAqB,CACnC,QAAQ,CAAE,QAAQ,CAClB,OAAO,CAAE,KAAK,CACd,GAAG,CAAE,IAAI,CACT,IAAI,CAAE,GAAG,CACT,WAAW,CAAE,IAAI,CACnB,gDAA+B,CAC7B,IAAI,CAAE,IAAI,CCtEZ,uBAAM,CACJ,OAAO,CAAE,KAAK,CAEhB,gIAA+C,CAC7C,OAAO,CAAE,YAAY,CACrB,QAAQ,CAAE,MAAM,CAChB,KAAK,CAAE,CAAC,CACR,cAAc,CAAE,MAAM,CAItB,wCAAO,CACL,OAAO,CAAE,YAAY,CACrB,cAAc,CAAE,MAAM,CACtB,KAAK,CAAE,IAAI,CACX,MAAM,CAAE,YAA+C,CACvD,KAAK,CAAE,IAAI,CACf,4BAAW,CACT,KAAK,CAAE,IAAI,CACX,kCAAK,CACH,OAAO,CAAE,KAAK,CAChB,mCAAM,CACJ,UAAU,CAAE,GAAqB,CAEvC,QAAQ,CACN,MAAM,CAAE,CAAC,CACT,MAAM,CAAE,CAAC,CACT,OAAO,CAAE,CAAC,CACZ,MAAM,CACJ,OAAO,CAAE,KAAK,CACd,KAAK,CAAE,IAAI,CACX,MAAM,CAAE,CAAC,CACT,OAAO,CAAE,CAAC,CACV,WAAW,CAAE,MAAM,CACnB,aAAa,CN/BuB,IAAI,CMgCxC,SAAS,CAAE,IAAI,CACf,YAAY,CAAE,IAAI,CACpB,KAAK,CACH,OAAO,CAAE,KAAK,CACd,MAAM,CAAE,aAAa,CACrB,KAAK,CNR+B,IAAU,CMS9C,SAAS,CAAE,GAAG,CAEhB,qBAAuB,CACrB,SAAS,CAAE,IAAI,CACf,MAAM,CAAE,CAAC,CACT,cAAc,CAAE,QAAQ,CACxB,eAAe,CAAE,MAAM,CAGzB,iBAAiB,CACf,aAAa,CNhDuB,IAAI,ChBuExC,KAAK,CAAE,CAAC,CuBrGR,SAAS,CCCC,IAAQ,CDChB,WAAI,CAAE,IAAI,CACV,YAAK,CAAE,IAAI,CvBkGb,KAAK,CAAE,CAAC,CACR,gDAAS,CAEP,OAAO,CAAE,KAAK,CACd,OAAO,CAAE,EAAE,CACb,uBAAO,CACL,KAAK,CAAE,IAAI,CALb,gDAAS,CAEP,OAAO,CAAE,KAAK,CACd,OAAO,CAAE,EAAE,CACb,uBAAO,CACL,KAAK,CAAE,IAAI,CsBzBf,uDAAyD,CACvD,OAAO,CAAE,IAAI,CACb,KAAK,CN/C+B,OAAI,CMoDxC,mGAA+C,CAC7C,cAAc,CAAE,IAAqB,CACrC,wHAAM,CACJ,KAAK,CAAE,IAAI,CAEX,0tEAAqP,CACnP,KAAK,CAAE,IAAI,CACnB,+BAA+B,CGlF3B,KAAK,CAAE,IAAsB,CAG3B,OAAO,CAAE,KAAK,CAed,YAAoB,CAAE,QAA+B,CACrD,KAAK,CAAE,IAAuC,CCnB5C,YAAoB,CAAE,CAAC,CDqBzB,0CAAa,CACX,YAAoB,CAAE,CAAC,CHgE/B,iCAAiC,CGtF7B,KAAK,CAAE,IAAsB,CAG3B,OAAO,CAAE,KAAK,CAed,YAAoB,CAAE,QAA+B,CACrD,KAAK,CAAE,SAAuC,CAE9C,4CAAa,CACX,YAAoB,CAAE,CAAC,CCA7B,iDAAwB,CACtB,YAAoB,CAAE,CAAC,CAEvB,mDAA0B,CACxB,KAAK,CALY,IAAkC,CJqEzD,iCAAiC,CG1F7B,KAAK,CAAE,IAAsB,CAG3B,OAAO,CAAE,KAAK,CAed,YAAoB,CAAE,QAA+B,CACrD,KAAK,CAAE,SAAuC,CAE9C,4CAAa,CACX,YAAoB,CAAE,CAAC,CCA7B,iDAAwB,CACtB,YAAoB,CAAE,CAAC,CAEvB,mDAA0B,CACxB,KAAK,CALY,IAAkC,CJ0EzD,uDAAuD,CACrD,MAAM,CAAE,SAA2B,CACnC,SAAS,CAAE,GAAG,CAEhB,oBAAoB,CAClB,OAAO,CAAE,YAAY,CACrB,MAAM,CAAE,SAA2B,CACnC,SAAS,CAAE,GAAG,CAOZ,osBAAqP,CACnP,KAAK,CAAE,IAAI,CAIjB,uBAAuB,CACrB,OAAO,CAAE,YAAY,CACrB,YAAY,CAAE,KAAK,CACnB,KAAK,CAAE,IAAI,CACX,cAAc,CAAE,MAAM,CACtB,SAAS,CAAE,GAAG,CAEhB,gBAAgB,CACd,OAAO,CAAE,KAAK,CACd,KAAK,CN7H+B,IAAI,CM8HxC,SAAS,CAAE,GAAG,CACd,UAAU,CAAE,OAAO,CACnB,UAAU,CAAE,MAAM,CAClB,kBAAC,CACC,SAAS,CAAE,OAAO,CAClB,UAAU,CAAE,MAAM,CAClB,aAAa,CAAE,GAAqB,CACtC,6BAAY,CACV,aAAa,CAAE,CAAC,CA4DpB,KAAK,CACH,WAAW,CAAE,MAAM,CAGnB,6DAAmD,CACjD,kBAAkB,CAAE,MAAM,CAC1B,MAAM,CAAE,OAAO,CACf,WAAW,CJ7JuB,uDAA2D,CI8J7F,SAAS,CAAE,OAAO,CACpB,gSAAqP,CACnP,kBAAkB,CAAE,IAAI,CACxB,OAAO,CAAE,GAAqB,CAC9B,OAAO,CAAE,YAAY,CACrB,MAAM,CAAE,cAA6B,CACrC,SAAS,CAAE,GAAG,CACd,WAAW,CJrKuB,uDAA2D,CIsK7F,UAAU,CAAE,oBAAmC,CAC/C,aAAa,CAAE,CAAC,CxBxNZ,kBAAoB,CAAE,kBAAM,CAK5B,eAAiB,CAAE,kBAAM,CAezB,UAAY,CAAE,kBAAM,CwBuM1B,4BAAwB,CACtB,OAAO,CAAE,eAAkB,CAC7B,eAAW,CACT,MAAM,CAAE,OAAO,CACjB,0CAAmC,CxB/N7B,kBAAoB,CwBgOZ,UAAU,CxB3NlB,eAAiB,CwB2NT,UAAU,CxB5MlB,UAAY,CwB4MJ,UAAU,CACtB,OAAO,CAAE,CAAC,CACV,YAAY,CAAE,OAAO,CACrB,OAAO,CAAE,IAAI,CACb,MAAM,CAAE,IAAI,CACd,oBAAgB,CxBrOV,kBAAoB,CwBsOZ,UAAU,CxBjOlB,eAAiB,CwBiOT,UAAU,CxBlNlB,UAAY,CwBkNJ,UAAU,CACtB,kGAA6D,CAC3D,kBAAkB,CAAE,IAAI,CAC5B,oXAAyU,CACvU,OAAO,CAAE,CAAC,CACV,OAAO,CAAE,cAAc,CACvB,YAAY,CNxLsB,IAAU,CMyL9C,oBAAgB,CACd,YAAY,CAAE,eAA8B,CAC9C,+EAAqE,CACnE,OAAO,CAAE,gBAAsB,CAC/B,OAAO,CAAE,gBAAgB,CAC3B,4aAAiY,CAC/X,MAAM,CAAE,WAAW,CACnB,gBAAgB,CAAE,OAAmC,CAEzD,+DAAiE,CAC/D,KAAK,CNzN+B,OAAI,CM0NxC,MAAM,CAAE,iBAAc,CACxB,iFAAmF,CACjF,YAAY,CN5NwB,OAAI,CM8NxC,yHAA+G,CAC7G,aAAa,CN/NqB,OAAI,CMiO1C,oBAAoB,CAClB,OAAO,CAAE,IAAqB,CAC9B,SAAS,CAAE,IAAI,CAKjB,QAAQ,CACN,QAAQ,CAAE,IAAI,CACd,cAAc,CAAE,GAAG,CACnB,KAAK,CAAE,IAAI,CACX,WAAW,CJzNyB,uDAA2D,CI0NjG,eAAgB,CACd,OAAO,CAAE,WAAgB,CACzB,OAAO,CAAE,YAAY,CACrB,MAAM,CAAE,cAA6B,CACrC,SAAS,CAAE,GAAG,CACd,UAAU,CAAE,oBAAmC,CxBhRzC,kBAAoB,CAAE,kBAAM,CAK5B,eAAiB,CAAE,kBAAM,CAezB,UAAY,CAAE,kBAAM,CwB+P5B,MAAM,CACJ,MAAM,CAAE,cAA6B,CACrC,gBAAgB,CJvPoB,IAAM,CIwP1C,gBAAW,CACT,MAAM,CAAE,IAAI,CAChB,2BAA4B,CAC1B,OAAO,CAAE,CAAC,CACZ,uFAA2F,CACzF,MAAM,CAAE,WAAW,CACnB,gBAAgB,CAAE,OAAmC,CAKrD,8DAAuD,CACrD,MAAM,CAAE,WAAW,CACvB,sBAAuB,CACrB,MAAM,CAAE,KAAuB,CAE/B,KAAK,CJ5Q+B,OAAW,CI6Q/C,OAAO,CAAE,KAAK,CACd,kCAAK,CACH,cAAc,CAAE,QAAQ,CAI5B,uBAAuB,CACrB,OAAO,CAAE,YAAY,CACrB,QAAQ,CAAE,MAAM,CAChB,KAAK,CAAE,CAAC,CACR,cAAc,CAAE,MAAM,CAuBxB,iCAAkC,CAChC,WAAW,CAAE,MAAM,CACnB,OAAO,CAAE,GAAqB,CAC9B,qEAAiB,CACf,WAAW,CAAE,IAAI,CACjB,OAAO,CAAE,KAAK,CACd,OAAO,CAAE,YAAY,CACrB,SAAS,CAAE,GAAG,CACd,gBAAgB,CJtSkB,OAAmB,CIuSrD,MAAM,CAAE,cAA6B,CACrC,KAAK,CN7U6B,IAAI,CM+U1C,kCAAkC,CAChC,WAAW,CAAE,CAAC,CAChB,kCAAkC,CAChC,YAAY,CAAE,CAAC,CAcjB,UAAU,CACR,QAAQ,CAAE,QAAQ,CAClB,OAAO,CAAE,KAAK,CACd,MAAM,CNjV8B,IAAI,CMkVxC,UAAU,CAAE,IAAqB,CACjC,MAAM,CAAE,OAAO,CACf,iBAAQ,CACN,QAAQ,CAAE,QAAQ,CAClB,OAAO,CAAE,EAAE,CACX,OAAO,CAAE,KAAK,CACd,IAAI,CAAE,CAAC,CACP,GAAG,CAAE,CAAC,CACN,KAAK,CAAE,IAAuB,CAC9B,MAAM,CAAE,IAAqB,CAC7B,aAAa,CAAE,GAAG,CAClB,UAAU,CN9WwB,IAAI,ClBNlC,kBAAoB,CAAE,oBAAM,CAK5B,eAAiB,CAAE,oBAAM,CAezB,UAAY,CAAE,oBAAM,CwBkW1B,gBAAO,CACL,QAAQ,CAAE,QAAQ,CAClB,OAAO,CAAE,EAAE,CACX,OAAO,CAAE,KAAK,CACd,KAAK,CAAE,IAAI,CACX,MAAM,CAAE,IAAI,CACZ,aAAa,CAAE,GAAG,CAClB,UAAU,CNxXwB,IAAI,CMyXtC,IAAI,CAAE,IAAI,CACV,GAAG,CAAE,IAAI,CxB/XL,kBAAoB,CAAE,oBAAM,CAK5B,eAAiB,CAAE,oBAAM,CAezB,UAAY,CAAE,oBAAM,CwB6W1B,eAAI,CACF,QAAQ,CAAE,QAAQ,CAClB,IAAI,CAAE,IAAqB,CAC3B,OAAO,CAAE,KAAK,CACd,SAAS,CAAE,IAAI,CACf,KAAK,CNhY6B,IAAI,CMiYtC,WAAW,CAAE,CAAC,CAEhB,wBAAQ,CACN,UAAU,CAAE,OAAmB,CACjC,uBAAO,CACL,IAAI,CNrX8B,IAAI,CMsXtC,UAAU,CJ3YwB,OAAM,CI6Y5C,mBAAmB,CACjB,MAAM,CAAE,WAAW,CACnB,OAAO,CAAE,GAAE,CAgDX,wGAAyB,CACvB,KAAK,CNpa6B,OAAI,CMsatC,81BAAqP,CACnP,MAAM,CAAE,iBAAc,CAC1B,iDAAQ,CACN,MAAM,CAAE,iBAAc,CAE1B,mBAAmB,CACjB,WAAW,CAAE,MAAM,CACnB,qCAAiB,CACf,OAAO,CAAE,WAAgB,CACzB,OAAO,CAAE,YAAY,CACrB,SAAS,CAAE,GAAG,CAClB,gEAAgE,CAC9D,KAAK,CJ9c+B,OAAM,CIid5C,+DAA+D,CAC7D,KAAK,CNtb+B,OAAI,CMyb1C,gEAAgE,CAC9D,KAAK,CNzc+B,OAAO,CM4c7C,6DAA6D,CAC3D,KAAK,CJxb+B,OAAK,CI8b3C,UAAU,CxBleF,iBAAoB,CAAE,aAAM,CAK5B,cAAiB,CAAE,aAAM,CAKzB,aAAgB,CAAE,aAAM,CAKxB,YAAe,CAAE,aAAM,CAKvB,SAAY,CAAE,aAAM,CwBgd5B,WAAW,CxBpeH,iBAAoB,CAAE,cAAM,CAK5B,cAAiB,CAAE,cAAM,CAKzB,aAAgB,CAAE,cAAM,CAKxB,YAAe,CAAE,cAAM,CAKvB,SAAY,CAAE,cAAM,CwBkd5B,WAAW,CxBteH,iBAAoB,CAAE,cAAM,CAK5B,cAAiB,CAAE,cAAM,CAKzB,aAAgB,CAAE,cAAM,CAKxB,YAAe,CAAE,cAAM,CAKvB,SAAY,CAAE,cAAM,CwBod5B,OAAO,CxBxeC,iBAAoB,CAAE,UAAM,CAK5B,cAAiB,CAAE,UAAM,CAKzB,aAAgB,CAAE,UAAM,CAKxB,YAAe,CAAE,UAAM,CAKvB,SAAY,CAAE,UAAM,CwBsd1B,iBAAW,CxB1eL,iBAAoB,CwB2eL,wBAAwB,CxBtevC,cAAiB,CwBseF,wBAAwB,CxBjevC,aAAgB,CwBieD,wBAAwB,CxB5dvC,YAAe,CwB4dA,wBAAwB,CxBvdvC,SAAY,CwBudG,wBAAwB,CAC7C,kBAAY,CxB5eN,iBAAoB,CwB6eL,yBAAyB,CxBxexC,cAAiB,CwBweF,yBAAyB,CxBnexC,aAAgB,CwBmeD,yBAAyB,CxB9dxC,YAAe,CwB8dA,yBAAyB,CxBzdxC,SAAY,CwBydG,yBAAyB,CAC9C,kBAAY,CxB9eN,iBAAoB,CwB+eL,yBAAyB,CxB1exC,cAAiB,CwB0eF,yBAAyB,CxBrexC,aAAgB,CwBqeD,yBAAyB,CxBhexC,YAAe,CwBgeA,yBAAyB,CxB3dxC,SAAY,CwB2dG,yBAAyB,CAEhD,yCAAyC,CAErC,8BAAqB,CACnB,MAAM,CAAE,SAAS,CAEjB,8ZAAqP,CACnP,aAAa,CAAE,KAAK,CACpB,OAAO,CAAE,KAAK,CAClB,cAAK,CACH,aAAa,CAAE,KAAK,CACpB,OAAO,CAAE,KAAK,CAEhB,kYAAqO,CACnO,aAAa,CAAE,CAAC,CAElB,wCAAuB,CACrB,aAAa,CAAE,KAAK,CACpB,UAAU,CAAE,IAAI,CAChB,OAAO,CAAE,KAAK,CACd,KAAK,CAAE,IAAI,CACb,4BAAW,CACT,MAAM,CAAE,WAAW,CACvB,iEAAmE,CACjE,OAAO,CAAE,KAAK,CACd,SAAS,CAAE,GAAG,CACd,OAAO,CAAE,KAAuB,EHnfhC,oCAAsB,CQhC1B,YAAY,CAER,OAAO,CAAE,IAAI,ER8Bb,oCAAsB,CQ5B1B,YAAY,CAER,OAAO,CAAE,IAAI,EAEjB,WAAW,CACT,KAAK,CAAE,IAAI,CAEb,YAAY,CACV,KAAK,CAAE,KAAK,CAEd,WAAW,CACT,KAAK,CAAE,IAAI,CC4Cb,mEAAS,CACP,eAAe,CAAE,QAAQ,CACzB,cAAc,CAAE,CAAC,CACjB,WAAW,CAAE,IAAI,CACjB,aAAa,CZ/BuB,IAAI,CYgCxC,2FAAO,CACL,KAAK,CAAE,IAAI,CACX,IAAI,CAAE,6BAA8B,CACpC,OAAO,CAAE,KAAK,CACd,UAAU,CAAE,MAAM,CACpB,yJAAM,CACJ,SAAS,CZjByB,GAAG,CYkBrC,MAAM,CAAE,CAAC,CACT,QAAQ,CAAE,OAAO,CACjB,OAAO,CZnB2B,QAAmC,CYoBvE,iOAA8B,CAC5B,iBAAiB,CAAE,CAAC,CACtB,qFAAK,CACH,KAAK,CAAE,IAAI,CACX,UAAU,CAAE,IAAI,CAChB,cAAc,CAAE,MAAM,CACtB,WAAW,CAAE,MAAM,CACnB,8FAAE,CACA,WAAW,CZnDqB,IAAI,CYoDpC,aAAa,CAAE,iBAA6B,CAChD,4EAAE,CACA,gBAAgB,CAAE,WAAW,CAC7B,cAAc,CAAE,MAAM,CAE1B,kFAAc,CACZ,WAAW,CAAE,IAAuB,CACpC,mHAAY,CACV,aAAa,CAAE,CAAC,CACpB,4HAA4B,CAC1B,KAAK,CAAE,EAAE,CACT,aAAa,CAAE,CAAC,CAChB,uXAA0C,CACxC,MAAM,CAAE,CAAC,CAEb,mBAAmB,CACjB,KAAK,CV9D+B,IAAY,CU+DhD,SAAS,CAAE,GAAG,CAChB,kBAAkB,CAChB,KAAK,CVjE+B,IAAY,CUkEhD,SAAS,CAAE,GAAG,CAIhB,2HAAyD,CACvD,gBAAgB,CVzDoB,OAAmB,CU2DzD,gBAAgB,CACd,gBAAgB,CV5DoB,OAAmB,CUiEzD,kDAAsB,CACpB,MAAM,CAAE,iBAA6B,CACrC,wDAAE,CACA,aAAa,CAAE,iBAA6B,CAC5C,WAAW,CAAE,iBAA6B,CAC5C,gGAAwB,CACtB,mBAAmB,CAAE,CAAC,CAE1B,kBAAkB,CAChB,MAAM,CAAE,iBAA6B,CAGrC,0BAAE,CACA,aAAa,CAAE,iBAA6B,CAC9C,8CAAwB,CACtB,mBAAmB,CAAE,CAAC,CAGxB,2CAAwB,CACtB,mBAAmB,CAAE,CAAC,CACxB,+CAAM,CACJ,YAAY,CAAE,SAAS,CACvB,aAAa,CAAE,iBAA6B,CAC9C,2CAAwB,CACtB,mBAAmB,CAAE,CAAC,CAG1B,oBAAoB,CAClB,aAAa,CZhHuB,IAAI,CYiHxC,SAAS,CAAE,IAAI,CACf,QAAQ,CAAE,IAAI,CACd,0BAAK,CACH,aAAa,CAAE,YAAY,CAC3B,2DAAM,CACJ,WAAW,CAAE,MAAM,CCzIzB,CAAC,CACC,KAAK,CX+B+B,OAAK,CW9BzC,eAAe,CAAE,IAAI,CACrB,MAAM,CAAE,OAAO,CACf,OAAO,CACL,KAAK,CbgD6B,OAAwB,Ca/C5D,SAAS,CACP,KAAK,CX0B6B,OAAO,CWA7C,IAAI,CACF,MAAM,CAAE,IAAI,CACZ,UAAU,CAAE,MAAM,CAEpB,IAAI,CACF,WAAW,CXOyB,uDAA2D,CWN/F,WAAW,CAAE,MAAM,CACnB,KAAK,CXlB+B,OAAW,CWmB/C,UAAU,CAAE,IAAI,CAChB,UAAU,CAAE,MAAM,CAClB,UAAU,CbnD0B,OAAO,CaqD7C,aAAa,CACX,UAAU,CAAE,IAAI,CAElB,eAAe,CACb,UAAU,CAAE,MAAM,CAEpB,cAAc,CACZ,UAAU,CAAE,KAAK,CAEnB,cAAc,CACZ,SAAS,CAAE,IAAI,CAEjB,eAAe,CACb,SAAS,CAAE,IAAI,CAEjB,oBAAqB,CACnB,SAAS,CAAE,GAAG,CAEhB,eAAe,CACb,eAAe,CAAE,YAAY,CAE/B,gBAAgB,CACd,KAAK,CAAE,kBAAkB,CAC3B,uBAAuB,CACrB,KAAK,CAAE,kBAAgC,CACzC,aAAa,CACX,KAAK,CAAE,kBAAgB,CACzB,oBAAoB,CAClB,KAAK,CAAE,kBAA8B,CACvC,gBAAgB,CACd,KAAK,CAAE,kBAAiB,CAC1B,uBAAuB,CACrB,KAAK,CAAE,kBAA+B,CACxC,eAAe,CACb,KAAK,CAAE,kBAAe,CACxB,sBAAsB,CACpB,KAAK,CAAE,kBAA6B,CACtC,gBAAgB,CACd,KAAK,CAAE,kBAAsB,CAC/B,uBAAuB,CACrB,KAAK,CAAE,kBAAoC,CAkB7C,gEAAyB,CACvB,UAAU,CAAE,CAAC,CACb,WAAW,CAAE,GAAG,CAChB,WAAW,CX5DyB,0DAA8D,CW8DpG,CAAC,CACC,WAAW,Cb1FyB,IAAI,Ca2FxC,MAAM,CAAE,CAAC,CACT,SAAS,Cb/F2B,IAAI,CagGxC,aAAa,Cb7FuB,IAAI,Ca+F1C,EAAE,CACA,SAAS,CAAE,IAAI,CAEjB,0CAAE,CACA,SAAS,CAAE,IAAI,CAEjB,EAAE,CACA,SAAS,CAAE,IAAI,CAEjB,EAAE,CACA,SAAS,CAAE,IAAI,CAEjB,EAAE,CACA,SAAS,CAAE,IAAI,CAEjB,EAAE,CACA,SAAS,CAAE,IAAI,CAEjB,EAAE,CACA,OAAO,CAAE,KAAK,CACd,MAAM,CAAE,GAAG,CACX,MAAM,CAAE,CAAC,CACT,UAAU,CAAE,iBAA6B,CACzC,MAAM,CAAE,MAAmB,CAC3B,OAAO,CAAE,CAAC,CAEZ,sCAAI,CACF,WAAW,CAAE,MAAM,CACnB,SAAS,CAAE,IAAI,CACf,UAAU,CXrH0B,IAAM,CWsH1C,MAAM,CAAE,iBAAiC,CACzC,SAAS,CAAE,GAAG,CACd,OAAO,CAAE,KAAK,CACd,WAAW,CXnGyB,wMAAoN,CWoGxP,KAAK,Cb1H+B,OAAI,Ca2HxC,UAAU,CAAE,IAAI,CAChB,0CAAY,CACV,SAAS,CAAE,GAAG,CAmClB,wFAAmB,CACjB,UAAU,CAAE,IAAI,CAChB,WAAW,CbzKyB,IAAI,Ca0KxC,aAAa,Cb1KuB,IAAI,Ca2KxC,oGAAE,CACA,UAAU,CAAE,IAAI,CAChB,WAAW,Cb7KuB,IAAI,Ca8KtC,wJAAY,CACV,aAAa,CAAE,CAAC,CAClB,gHAAE,CACA,aAAa,CAAE,CAAC,CAClB,gHAAE,CACA,UAAU,CAAE,MAAM,CAClB,4HAAE,CACA,UAAU,CAAE,MAAM,CACtB,4HAAK,CACH,UAAU,CAAE,OAAO,CAEzB,iFAAsB,CACpB,UAAU,CAAE,OAAO,CACnB,WAAW,Cb3LyB,IAAI,Ca4LxC,aAAa,Cb5LuB,IAAI,Ca6LxC,6FAAE,CACA,UAAU,CAAE,OAAO,CACnB,WAAW,Cb/LuB,IAAI,CagMtC,iJAAY,CACV,aAAa,CAAE,CAAC,CAClB,yGAAE,CACA,aAAa,CAAE,CAAC,CAChB,qHAAE,CACA,UAAU,CAAE,IAAI,CCrOxB,kBAAkB,CAChB,MAAM,CAAE,iBAA6B,CACrC,aAAa,CAAE,IAAI,CACnB,OAAO,Cd6B6B,IAAI,Cc5BxC,WAAW,CAAE,IAAqB,CAClC,WAAW,CAAE,GAAG,CAChB,UAAU,CZiC0B,IAAM,CYhC1C,QAAQ,CAAE,QAAQ,CAClB,wBAAO,CACL,OAAO,CAAE,SAAS,CAClB,QAAQ,CAAE,QAAQ,CAClB,GAAG,CAAE,GAAG,CACR,IAAI,CAAE,GAAG,CACT,UAAU,CZiCwB,OAAO,CYhCzC,KAAK,CAAE,IAAoB,CAC3B,OAAO,CAAE,QAA2C,CACtD,2CAA0B,CACxB,MAAM,CAAE,iBAA6B,CACrC,aAAa,CdcqB,IAAI,CcZ1C,+GAAmC,CACjC,MAAM,CAAE,iBAA6B,CACrC,OAAO,CAAE,GAAG,CACZ,UAAU,CAAE,IAAI,CAChB,UAAU,CZe0B,IAAM,CYb1C,MAAM,CAAE,YAAyB,CACjC,gLAAuB,CACrB,MAAM,CAAE,IAAI,CACZ,UAAU,CAAE,IAAI,CAChB,MAAM,CAAE,CAAC,CAEb,+BAA+B,CAC7B,KAAK,CAAE,IAAI,CACb,cAAc,CACZ,YAAY,CAAE,iBAA0C,CACxD,MAAM,CAAE,CAAC,CACT,OAAO,CAAE,SAA2C,CACpD,WAAW,CZuByB,wMAAoN,CYtBxP,SAAS,CAAE,IAAI,CACf,WAAW,CAAE,GAAG,CAChB,KAAK,CdI+B,OAAwB,CcH9D,2BAA2B,CACzB,WAAW,CAAE,GAAG,CAChB,MAAM,CAAE,CAAC,CACT,OAAO,CAAE,SAA2C,CACpD,WAAW,CZeyB,wMAAoN,CYdxP,SAAS,CAAE,IAAI,CACf,WAAW,CAAE,GAAG,CAChB,OAAO,CAAE,KAAK,CACd,QAAQ,CAAE,IAAI,CACd,KAAK,CZhB+B,OAAW,CYoBjD,YAAY,CACV,2IAAgE,CAC9D,WAAW,CAAE,QAAQ,ECzDzB,IAAI,CACF,gBAAgB,CAAE,IAAO,CACzB,MAAM,CAAE,OAAO,CACf,OAAO,CAAE,MAAM,CACf,OAAO,CAAE,KAAK,CAChB,EAAE,CACA,KAAK,CAAE,IAAO,CACd,UAAU,CAAE,MAAM,CACpB,IAAI,CACF,KAAK,CAAE,OAAO,CACd,gBAAgB,CAAE,OAAO,CAC3B,EAAE,CACA,WAAW,CAAE,IAAI,CACnB,EAAE,CACA,WAAW,CAAE,IAAI,CACnB,GAAG,CACD,KAAK,CAAE,IAAO,CACd,UAAU,CAAE,MAAM,CACpB,GAAG,CACD,KAAK,CAAE,IAAO,CACd,WAAW,CAAE,IAAI,CACnB,GAAG,CACD,KAAK,CAAE,IAAO,CACd,UAAU,CAAE,MAAM,CACpB,GAAG,CACD,KAAK,CAAE,IAAO,CACd,WAAW,CAAE,IAAI,CACjB,UAAU,CAAE,MAAM,CACpB,GAAG,CACD,KAAK,CAAE,IAAO,CACd,gBAAgB,CAAE,IAAO,CAC3B,MAAM,CACJ,KAAK,CAAE,IAAO,CACd,gBAAgB,CAAE,IAAO,CAC3B,GAAG,CACD,UAAU,CAAE,MAAM,CACpB,GAAG,CACD,KAAK,CAAE,IAAO,CAChB,GAAG,CACD,KAAK,CAAE,IAAO,CAChB,GAAG,CACD,KAAK,CAAE,IAAO,CACd,gBAAgB,CAAE,IAAO,CAC3B,MAAM,CACJ,KAAK,CAAE,IAAO,CACd,gBAAgB,CAAE,IAAO,CAC3B,GAAG,CACD,KAAK,CAAE,IAAO,CAChB,GAAG,CACD,KAAK,CAAE,IAAO,CAChB,GAAG,CACD,WAAW,CAAE,IAAI,CACnB,GAAG,CACD,KAAK,CAAE,MAAO,CACd,WAAW,CAAE,IAAI,CACnB,GAAG,CACD,KAAK,CAAE,IAAO,CAChB,GAAG,CACD,WAAW,CAAE,IAAI,CACnB,GAAG,CACD,WAAW,CAAE,IAAI,CACnB,GAAG,CACD,WAAW,CAAE,IAAI,CACnB,GAAG,CACD,WAAW,CAAE,IAAI,CACnB,GAAG,CACD,WAAW,CAAE,IAAI,CACnB,GAAG,CACD,KAAK,CAAE,IAAO,CACd,WAAW,CAAE,IAAI,CACnB,EAAE,CACA,KAAK,CAAE,IAAO,CAChB,EAAE,CACA,KAAK,CAAE,IAAO,CAChB,EAAE,CACA,KAAK,CAAE,IAAO,CAChB,GAAG,CACD,KAAK,CAAE,IAAI,CACb,GAAG,CACD,KAAK,CAAE,OAAO,CAChB,GAAG,CACD,KAAK,CAAE,IAAO,CACd,WAAW,CAAE,IAAI,CACnB,GAAG,CACD,KAAK,CAAE,IAAI,CACb,GAAG,CACD,KAAK,CAAE,MAAM,CACf,GAAG,CACD,KAAK,CAAE,IAAO,CACd,WAAW,CAAE,IAAI,CACnB,GAAG,CACD,KAAK,CAAE,IAAO,CACd,WAAW,CAAE,IAAI,CACnB,GAAG,CACD,KAAK,CAAE,IAAO,CAChB,GAAG,CACD,KAAK,CAAE,IAAI,CACb,GAAG,CACD,KAAK,CAAE,IAAI,CACb,GAAG,CACD,WAAW,CAAE,IAAI,CACnB,EAAE,CACA,KAAK,CAAE,IAAO,CAChB,GAAG,CACD,KAAK,CAAE,IAAO,CAChB,GAAG,CACD,KAAK,CAAE,IAAO,CAChB,GAAG,CACD,KAAK,CAAE,IAAO,CAChB,GAAG,CACD,KAAK,CAAE,IAAO,CAChB,GAAG,CACD,KAAK,CAAE,IAAO,CAChB,GAAG,CACD,KAAK,CAAE,IAAO,CAChB,GAAG,CACD,KAAK,CAAE,IAAO,CAChB,GAAG,CACD,KAAK,CAAE,IAAO,CAChB,GAAG,CACD,KAAK,CAAE,IAAO,CAChB,GAAG,CACD,KAAK,CAAE,IAAO,CAChB,GAAG,CACD,KAAK,CAAE,IAAO,CAChB,GAAG,CACD,KAAK,CAAE,IAAO,CAChB,GAAG,CACD,KAAK,CAAE,OAAO,CAChB,GAAG,CACD,KAAK,CAAE,IAAO,CAChB,GAAG,CACD,KAAK,CAAE,OAAO,CAChB,GAAG,CACD,KAAK,CAAE,IAAO,CAChB,GAAG,CACD,KAAK,CAAE,IAAI,CACb,GAAG,CACD,KAAK,CAAE,IAAI,CACb,GAAG,CACD,KAAK,CAAE,IAAI,CACb,GAAG,CACD,KAAK,CAAE,IAAO,CAChB,GAAG,CACD,KAAK,CAAE,IAAI,CACX,gBAAgB,CAAE,OAAO,CCjJ3B,kBAAkB,CAChB,OAAO,CAAE,YAAY,CACrB,uCAAsB,CACpB,KAAK,CAAE,KAAK,CACd,oBAAC,CACC,OAAO,CAAE,YAAY,CACrB,OAAO,CAAE,GAAG,CACZ,gCAAa,CACX,YAAY,CAAE,CAAC,CACnB,6FAAI,CACF,OAAO,CAAE,GAAG,CACZ,MAAM,CAAE,IAAI,CACZ,UAAU,CAAE,IAAI,CAChB,qHAAS,CACP,KAAK,CdqB2B,OAAW,CcpBjD,qBAAqB,CACnB,aAAa,CAAE,CAAC,CAChB,KAAK,CdqB+B,OAAW,CcpB/C,SAAS,CAAE,GAAG,CACd,OAAO,CAAE,YAAY,CbanB,oCAAsB,CaTxB,qBAAqB,CACnB,OAAO,CAAE,IAAI,CACf,uCAAuC,CACrC,OAAO,CAAE,IAAI,EAEjB,YAAY,CACV,uCAAuC,CACrC,OAAO,CAAE,IAAI,EC9BjB,SAAS,CACP,QAAQ,CAAE,KAAK,CACf,GAAG,CCAO,OAAO,CDGjB,gBAAO,CACL,eAAe,CAAE,IAAI,CAEzB,cAAc,CjC+FZ,KAAK,CAAE,CAAC,CACR,0CAAS,CAEP,OAAO,CAAE,KAAK,CACd,OAAO,CAAE,EAAE,CACb,oBAAO,CACL,KAAK,CAAE,IAAI,CiCnGb,mCAAM,CACJ,OAAO,CAAE,YAAY,CACvB,uBAAQ,CACN,UAAU,CAAE,qBAAoB,CAEhC,6BAAa,CACX,WAAW,CAAE,iBAAyB,CACxC,8BAAc,CACZ,YAAY,CAAE,iBAAyB,CAC3C,gBAAC,CACC,MAAM,CAAE,IAAmB,CAC3B,OAAO,CAAE,YAAY,CACrB,WAAW,CAAE,IAAmB,CAChC,OAAO,CAAE,MAAiB,CAE9B,iBAAiB,CACf,KAAK,CjBuD+B,KAAK,CiBtDzC,oDAAiB,CACf,MAAM,CAAE,IAAmB,CAC3B,OAAO,CAAE,YAAY,CACrB,WAAW,CAAE,IAAmB,CAChC,OAAO,CAAE,SAAS,CAClB,aAAa,CAAE,CAAC,CAChB,OAAO,CAAE,KAAK,CACd,WAAW,CAAE,IAAI,CACjB,cAAc,CAAE,SAAS,CACzB,SAAS,CAAE,GAAG,CACd,KAAK,CfR6B,OAAwB,CeS1D,WAAW,CAAE,MAAM,CAErB,oBAAE,CACA,aAAa,CAAE,CAAC,CAEhB,+BAAY,CACV,UAAU,CAAE,iBAAyB,CACvC,kCAAe,CACb,aAAa,CAAE,iBAAyB,CAC1C,4BAAS,CACP,UAAU,CAAE,OAA4C,CACxD,8BAAC,CACC,KAAK,CfbyB,IAAY,Cec1C,YAAY,CAAE,iBAAsD,CACpE,OAAO,CAAE,eAAyB,CAClC,oCAAO,CACL,UAAU,CAAE,OAA4C,CAC9D,mGAAI,CACF,MAAM,CAAE,IAAI,CACZ,UAAU,CAAE,OAAO,CACnB,KAAK,CAAE,OAAO,CACd,YAAY,CAAE,CAAC,CACf,aAAa,CAAE,CAAC,CAElB,wCAAmB,CACjB,OAAO,CAAE,KAAK,CACd,KAAK,CAAE,IAAI,CACX,WAAW,CAAE,MAAM,CAGnB,SAAS,CAAE,IAAI,CACf,WAAW,CAAE,KAAK,CAClB,KAAK,CAAE,OAA8B,CAGzC,wDAAuB,CACrB,KAAK,CfvC6B,OAAW,CewC7C,OAAO,CAAE,eAAmB,CAC5B,WAAW,CAAE,IAAI,CACjB,QAAQ,CAAE,QAAQ,CAClB,UAAU,CflCwB,OAAyB,CemC3D,MAAM,CAAE,IAAI,CACZ,aAAa,CAAE,iBAAsD,CACrE,UAAU,CAAE,iBAAsD,CAClE,YAAY,CAAE,YAAY,CAE1B,oEAAO,CACL,UAAU,CfzCsB,OAAyB,Ce0CzD,4GAAmB,CACjB,KAAK,CflDyB,IAAY,CemD9C,gGAAmB,CAGjB,OAAO,CAAE,KAAK,CACd,SAAS,CAAE,IAAI,CACf,WAAW,CAAE,KAAK,CAClB,KAAK,CAAE,IAA8B,CAIvC,iHAAI,CACF,OAAO,CAAE,IAAI,CACf,iIAAc,CACZ,OAAO,CAAE,KAAK,CAGd,yCAAG,CACD,UAAU,CAAE,OAA4C,CACxD,OAAO,CAAE,eAAyB,CACpC,uDAAiB,CACf,OAAO,CAAE,KAAK,CACd,UAAU,CAAE,OAA4C,CACxD,OAAO,CAAE,eAAyB,CACtC,2DAA2B,CACzB,KAAK,Cf3E2B,IAAY,Ce4E9C,mDAAmB,CACjB,KAAK,CAAE,OAA4C,CACvD,+BAAa,CACX,SAAS,CAAE,IAAI,CAEb,yCAAG,CACD,UAAU,CAAE,OAA4C,CACxD,OAAO,CAAE,eAAyB,CACpC,uDAAiB,CACf,OAAO,CAAE,KAAK,CACd,UAAU,CAAE,OAA4C,CACxD,OAAO,CAAE,eAAyB,CAClC,UAAU,CAAE,IAAI,CAChB,aAAa,CAAE,IAAI,CACvB,2DAA2B,CACzB,KAAK,Cf3F2B,IAAY,Ce4F9C,mDAAmB,CACjB,KAAK,CAAE,OAA4C,CACvD,+BAAa,CACX,SAAS,CAAE,IAAI,CAEjB,+BAAa,CACX,OAAO,CAAE,KAAK,CAChB,uBAAK,CACH,aAAa,CAAE,CAAC,CAChB,OAAO,CAAE,IAAI,CAEb,kCAAK,CACH,OAAO,CAAE,KAAK,CAClB,4BAAU,CACR,aAAa,CAAE,CAAC,CAChB,KAAK,Cf1G6B,OAAW,Ce2G7C,WAAW,CAAE,MAAM,CACrB,mBAAC,CACC,OAAO,CAAE,YAAY,CACrB,WAAW,CAAE,IAAI,CACjB,OAAO,CAAE,eAAmB,CAC5B,OAAO,CAAE,KAAK,CACd,QAAQ,CAAE,QAAQ,CAClB,SAAS,CAAE,GAAG,CACd,KAAK,CfnH6B,OAAW,CeoH7C,yBAAO,CACL,gBAAgB,CAAE,OAAoC,CACtD,MAAM,CAAE,OAAO,CACf,6CAAmB,CACjB,KAAK,CfxHyB,OAAW,CeyH7C,0BAAQ,CACN,gBAAgB,CfnHgB,OAAK,CeoHrC,MAAM,CAAE,OAAO,CACf,KAAK,Cf3H2B,IAAM,Ce4HtC,8CAAmB,CACjB,KAAK,Cf7HyB,IAAM,Ce+H5C,mBAAmB,CACjB,OAAO,CAAE,KAAK,CACd,KAAK,CjBvF+B,KAAK,CiBwFzC,OAAO,CAAE,MAAW,CACpB,aAAa,CAAE,MAAW,CAC1B,OAAO,CjBrF6B,GAAG,CiBsFvC,gBAAgB,Cf/HoB,OAAK,CegIzC,UAAU,CAAE,MAAM,CAClB,OAAO,CAAE,MAAW,CACpB,OAAO,CAAE,KAAK,CACd,KAAK,CfpI+B,OAAyB,CeqI7D,aAAa,CAAE,MAAW,CAC1B,oCAAgB,CACd,KAAK,CAAE,IAAI,CACX,aAAa,CAAE,IAAI,CACnB,OAAO,CAAE,QAAQ,CACjB,YAAY,CAAE,OAAuB,CACvC,uBAAG,CACD,OAAO,CAAE,KAAK,CACd,MAAM,CAAE,qBAA0B,CAClC,MAAM,CAAE,IAAI,CACZ,KAAK,CAAE,IAAI,CACX,gBAAgB,Cf/IkB,OAAK,CegJvC,OAAO,CAAE,GAAG,CACZ,aAAa,CAAE,IAAI,CACrB,wDAAqB,CACnB,KAAK,CfpJ6B,OAAyB,CeqJ3D,SAAS,CAAE,IAAI,CACf,WAAW,CAAE,IAAI,CACjB,OAAO,CAAE,YAAY,CACrB,OAAO,CAAE,OAA2C,CACpD,aAAa,CAAE,MAAW,CAE1B,oEAAO,CACL,UAAU,CAAE,qBAAoB,CAClC,0EAAQ,CACN,OAAO,CAAE,KAAK,CACd,MAAM,CAAE,MAAM,CACd,MAAM,CAAE,IAAI,CACZ,KAAK,CAAE,IAAI,CACX,aAAa,CAAE,CAAC,CAChB,SAAS,CAAE,IAAI,CACf,UAAU,CAAE,WAAa,CAEzB,oFAAQ,CACN,UAAU,CAAE,KAAM,CACxB,+BAAa,CACX,UAAU,CAAE,QAAkB,CAC9B,aAAa,CAAE,MAAW,CAC1B,WAAW,CAAE,MAAM,CACnB,KAAK,CAAE,qBAAoB,CAI7B,gCAAM,CACJ,KAAK,CfhL6B,OAAK,CeiLzC,2BAAC,CACC,KAAK,CfzL6B,OAAW,Ce0L7C,iCAAO,CACL,gBAAgB,CfpLgB,OAAK,CeqLrC,KAAK,Cf3L2B,IAAM,Ce6L5C,gBAAgB,CnC3NR,kBAAoB,CAAE,eAAM,CAK5B,eAAiB,CAAE,eAAM,CAezB,UAAY,CAAE,eAAM,CmCyM1B,QAAQ,CAAE,QAAQ,CAClB,OAAO,CAAE,CAAC,CACV,KAAK,CAAE,IAAI,CACX,OAAO,CAAE,CAAC,CACV,4BAAa,CACX,IAAI,CAAE,CAAC,CACP,KAAK,CAAE,IAAI,CACX,OAAO,CAAE,CAAC,CACZ,0BAAW,CACT,KAAK,CAAE,IAAI,CACX,IAAI,CAAE,KAAK,CACX,OAAO,CAAE,CAAC,CACZ,2BAAY,CACV,KAAK,CAAE,KAAK,CACZ,IAAI,CAAE,IAAI,CACV,OAAO,CAAE,CAAC,CAGd,gBAAgB,CACd,UAAU,CAAE,qBAAuC,CACnD,gBAAgB,CAAE,2uCAA2uC,CAC7vC,eAAe,CAAE,SAAsB,CAEzC,gBAAgB,CACd,QAAQ,CAAE,QAAQ,CAClB,KAAK,CAAE,IAAI,CACX,MAAM,CAAE,IAAI,CAEd,YAAY,CACV,QAAQ,CAAE,KAAK,CACf,GAAG,CAAE,CAAC,CACN,MAAM,CAAE,CAAC,CACT,IAAI,CAAE,CAAC,CACP,cAAc,CAAE,GAAG,CACnB,KAAK,CjBvL+B,KAAK,CiBwLzC,UAAU,CAAE,MAAM,CAClB,UAAU,CAAE,MAAM,CAClB,UAAU,CAAE,IAAI,CAChB,UAAU,CflO0B,OAAsB,CemO1D,OAAO,CjBvL6B,GAAG,CiByLzC,eAAe,CACb,KAAK,CAAE,KAAyB,CAChC,QAAQ,CAAE,QAAQ,CAClB,UAAU,CAAE,MAAM,CAClB,UAAU,CAAE,MAAM,CAClB,MAAM,CAAE,IAAI,CAEd,WAAW,CACT,OAAO,CAAE,IAAI,CACb,UAAU,Cf3O0B,OAAK,Ce4OzC,KAAK,CflP+B,IAAM,CemP1C,OAAO,CAAE,cAAuB,CAChC,QAAQ,CAAE,QAAQ,CAClB,WAAW,CAAE,IAAI,CACjB,UAAU,CAAE,MAAM,CAClB,SAAS,CAAE,IAAI,CjCvLf,KAAK,CAAE,CAAC,CACR,oCAAS,CAEP,OAAO,CAAE,KAAK,CACd,OAAO,CAAE,EAAE,CACb,iBAAO,CACL,KAAK,CAAE,IAAI,CiCmLb,aAAC,CACC,KAAK,Cf1P6B,IAAM,Ce2PxC,WAAW,CAAE,IAAI,CAEnB,eAAG,CACD,YAAY,CAAE,IAAqB,CACnC,MAAM,CAAE,IAAI,CACZ,KAAK,CAAE,IAAI,CACX,gBAAgB,Cf3PkB,OAAK,Ce4PvC,OAAO,CAAE,GAAG,CACZ,aAAa,CAAE,IAAI,CACrB,aAAC,CACC,SAAS,CAAE,IAAI,CACf,KAAK,CAAE,IAAI,CACX,MAAM,CAAE,OAAO,CACf,WAAW,CAAE,OAAO,CAExB,oBAAoB,CAClB,WAAW,CjBjOyB,KAAK,CiBkOzC,UAAU,CfvQ0B,OAAyB,CewQ7D,UAAU,CAAE,IAAI,CAElB,eAAe,CACb,OAAO,CAAE,eAAmB,CAC5B,MAAM,CAAE,IAAI,CACZ,SAAS,CAAE,KAAK,CAChB,MAAM,CAAE,IAAI,CAEd,aAAa,CACX,QAAQ,CAAE,KAAK,CACf,KAAK,CAAE,IAAI,CACX,MAAM,CAAE,IAAI,CACZ,UAAU,CAAE,eAAc,CAC1B,OAAO,CAAE,IAAI,CACb,OAAO,CAAE,GAAkB,CAC3B,gBAAI,CACF,OAAO,CAAE,KAAK,CAClB,MAAM,CACJ,KAAK,CfjS+B,IAAY,CekShD,QAAC,CACC,aAAa,CAAE,IAAqB,CACtC,6FAAgB,CACd,OAAO,CAAE,GAAG,CACZ,WAAW,Cf9QuB,wMAAoN,Ce+QtP,SAAS,CAAE,GAAG,CACd,UAAU,CAAE,IAAI,CAChB,MAAM,CAAE,IAAI,CACZ,KAAK,Cf1S6B,IAAY,Ce4SlD,mBAAmB,CjC1OjB,KAAK,CAAE,CAAC,CiC2OR,oDAAiB,CACf,KAAK,CAAE,IAAI,CjC3Ob,oDAAS,CAEP,OAAO,CAAE,KAAK,CACd,OAAO,CAAE,EAAE,CACb,yBAAO,CACL,KAAK,CAAE,IAAI,CiCyOf,wBAAwB,CACtB,UAAU,CAAE,IAAI,CjChPhB,KAAK,CAAE,CAAC,CACR,8DAAS,CAEP,OAAO,CAAE,KAAK,CACd,OAAO,CAAE,EAAE,CACb,8BAAO,CACL,KAAK,CAAE,IAAI,CiC8Ob,0BAAU,CACR,aAAa,CjB5TqB,IAAI,CiB6TtC,aAAa,CAAE,iBAA6B,CAC5C,cAAc,CjB9ToB,IAAI,CiB+TxC,sCAAsB,CACpB,UAAU,CAAE,iBAA6B,CACzC,WAAW,CjBjUuB,IAAI,CiBkUxC,4BAAY,CACV,SAAS,CAAE,IAAI,CACf,aAAa,CAAE,IAAqB,CACpC,OAAO,CAAE,YAAY,CACvB,wBAAQ,CACN,KAAK,CflU6B,IAAY,CemU9C,SAAS,CAAE,GAAG,CdxUd,oCAAsB,Cc4UxB,gBAAgB,CACd,UAAU,CfjUwB,OAAyB,CekU7D,WAAW,CACT,OAAO,CAAE,KAAK,CAChB,YAAY,CAER,IAAI,CAAE,MAAmB,CAG3B,kBAAO,CACL,KAAK,CAAE,GAAG,CACV,IAAI,CAAE,CAAC,CACX,eAAe,CACb,KAAK,CAAE,IAAI,CACb,mBAAmB,CACjB,KAAK,CAAE,IAAI,CACb,yBAAyB,CACvB,KAAK,CAAE,IAAI,CACb,oBAAoB,CAClB,WAAW,CAAE,CAAC,CACd,oCAAe,CACb,OAAO,CC/XD,OAAO,CDgYf,0BAAO,CACL,QAAQ,CAAE,KAAK,CACf,SAAS,CAAE,IAAI,CACf,IAAI,CAAE,GAAG,CACT,GAAG,CAAE,CAAC,CACN,MAAM,CAAE,IAAI,CACZ,QAAQ,CAAE,MAAM,EdxWlB,qCAAsB,Cc2WxB,oBAAoB,CAClB,UAAU,CAAE,gBAAe,CAC7B,eAAe,CACb,MAAM,CAAE,CAAC,CACT,UAAU,CfnWwB,OAAyB,EeqW/D,YAAY,CACV,iCAAmC,CACjC,OAAO,CAAE,IAAI,CACf,oBAAoB,CAClB,WAAW,CAAE,CAAC,EErZlB,aAAa,CACX,QAAQ,CAAE,KAAK,CACf,MAAM,CAAE,CAAC,CACT,IAAI,CAAE,CAAC,CACP,KAAK,CnB6E+B,KAAK,CmB5EzC,KAAK,CjBuC+B,OAAyB,CiBtC7D,UAAU,CAAE,OAAkC,CAC9C,UAAU,CAAE,kBAAiC,CAC7C,WAAW,CjBkDyB,uDAA2D,CiBjD/F,OAAO,CnB+E6B,GAAG,CmB9EvC,eAAC,CACC,KAAK,CjBkC6B,OAAK,CiBjCvC,eAAe,CAAE,IAAI,CACvB,8BAAgB,CACd,OAAO,CAAE,IAAI,CACf,kCAAoB,CAClB,OAAO,CAAE,IAAqB,CAC9B,gBAAgB,CAAE,OAAkC,CACpD,OAAO,CAAE,KAAK,CACd,UAAU,CAAE,KAAK,CACjB,SAAS,CAAE,GAAG,CACd,MAAM,CAAE,OAAO,CACf,KAAK,CjBX6B,OAAM,ClB4F1C,KAAK,CAAE,CAAC,CACR,kFAAS,CAEP,OAAO,CAAE,KAAK,CACd,OAAO,CAAE,EAAE,CACb,wCAAO,CACL,KAAK,CAAE,IAAI,CmCrFX,uqDAAG,CACD,KAAK,CjBmB2B,OAAyB,CiBlB3D,yFAAQ,CACN,KAAK,CAAE,IAAI,CACb,6CAAU,CACR,KAAK,CAAE,IAAI,CACb,kDAAiB,CACf,gBAAgB,CnBQgB,OAAI,CmBPpC,KAAK,CjBO2B,IAAM,CiBNxC,yDAAwB,CACtB,gBAAgB,CjBsBgB,OAAO,CiBrBvC,KAAK,CnBzB2B,IAAI,CmB0BxC,0CAA8B,CAC5B,OAAO,CAAE,KAAK,CAChB,iCAAmB,CACjB,SAAS,CAAE,GAAG,CACd,OAAO,CAAE,IAAqB,CAC9B,KAAK,CjBJ6B,IAAY,CiBK9C,OAAO,CAAE,IAAI,CACb,oCAAE,CACA,OAAO,CAAE,KAAK,CACd,MAAM,CAAE,GAAG,CACX,MAAM,CAAE,CAAC,CACT,MAAM,CAAE,MAAM,CACd,OAAO,CAAE,CAAC,CACV,UAAU,CAAE,iBAA6C,CAC3D,oCAAE,CACA,OAAO,CAAE,YAAY,CACrB,MAAM,CAAE,CAAC,CACT,sCAAC,CACC,OAAO,CAAE,YAAY,CACrB,OAAO,CAAE,GAAqB,CAC9B,KAAK,CjBZyB,OAAyB,CiBa7D,uBAAW,CACT,KAAK,CAAE,IAAI,CACX,MAAM,CAAE,IAAI,CACZ,KAAK,CAAE,IAAI,CACX,IAAI,CAAE,IAAI,CACV,MAAM,CAAE,IAAI,CACZ,SAAS,CnBkByB,KAAK,CmBjBvC,kCAAU,CACR,KAAK,CAAE,IAAI,CACb,mEAAQ,CACN,KAAK,CAAE,IAAI,CACb,qDAA+B,CAC7B,UAAU,CAAE,KAAK,CACjB,+HAAQ,CACN,KAAK,CAAE,IAAI,CACb,gEAAU,CACR,KAAK,CAAE,IAAI,CACf,4CAAoB,CAClB,KAAK,CAAE,IAAI,CACX,MAAM,CAAE,IAAI,CACZ,WAAW,CAAE,IAAI,CACjB,OAAO,CAAE,KAAuB,CAChC,OAAO,CAAE,KAAK,CACd,UAAU,CAAE,MAAM,ChBhDpB,oCAAsB,CgBmDxB,aAAa,CACX,KAAK,CAAE,GAAG,CACV,OAAO,CAAE,IAAI,CACb,mBAAO,CACL,OAAO,CAAE,KAAK,ECtElB,gBAAG,CACD,SAAS,CAAE,IAAI,CACf,MAAM,CAAE,eAAe,CAEzB,uDAAkC,CAChC,WAAW,CAAE,MAAM,CAErB,uBAAU,CACR,aAAa,CpBOqB,IAAI,CoBNtC,iCAAS,CACP,UAAU,CAAE,MAAM,CAEtB,oCAAuB,CACrB,UAAU,CAAE,MAAM,CAGpB,qDAAoC,CAClC,aAAa,CpBFqB,IAAI,CoBaxC,uBAAU,CACR,WAAW,CpBduB,IAAI,CoBetC,WAAW,CpBfuB,IAAI,CoBgBtC,aAAa,CpBhBqB,IAAI,CoBsBtC,kTAAK,CACH,aAAa,CAAE,CAAC,CAKlB,qCAAQ,CACN,YAAY,CAAE,GAAG,CAUrB,8BAAiB,CACf,YAAY,CAAE,eAAc,CAC5B,mEAAM,CACJ,UAAU,CAAE,sBAAsB,CAClC,YAAY,CAAE,0BAAyB,CAG3C,0EAAiD,CAC/C,UAAU,CAAE,WAAW,CACzB,0EAAiD,CAC/C,UAAU,CAAE,WAAW,CAGzB,qDAA4B,CAC1B,aAAa,CAAE,IAAqB,CACtC,wBAAW,CACT,WAAW,CpBvDuB,IAAI,CoB0DxC,yBAAY,CACV,WAAW,CAAE,IAAI,CACjB,aAAa,CAAE,IAAqB,CACtC,yBAAY,CACV,KAAK,ClB3D6B,OAAW,CkB4D/C,yBAAY,CACV,KAAK,CAAE,KAAK,CACZ,MAAM,CAAE,iBAA2C,CACrD,wBAAW,CACT,KAAK,CAAE,IAAI,CACX,MAAM,CAAE,iBAA2C,CACrD,0BAAa,CACX,MAAM,CAAE,IAAI,CACZ,OAAO,CAAE,KAAK,CAMd,6RAAW,CACT,OAAO,CAAE,IAAI,CACb,UAAU,CAAE,MAAM,CAClB,SAAS,CAAE,IAAI,CAEf,mVAAO,CACL,UAAU,CAAE,OAAO,CACnB,OAAO,CAAE,GAAO,CAChB,WAAW,CAAE,WAAW,CACxB,OAAO,CAAE,YAAY,CACzB,mVAAmB,CACjB,OAAO,CAAE,YAAY,CAEzB,sBAAS,CACP,UAAU,CAAE,MAAM,CAGpB,qBAAQ,CACN,KAAK,CAAE,KAAK,CACZ,KAAK,CAAE,GAAG,CACV,OAAO,CAAE,KAAK,CACd,MAAM,CAAE,aAAuC,CAC/C,OAAO,CpBnG2B,IAAI,CoBoGtC,UAAU,ClBjFwB,OAAmB,CkBkFrD,MAAM,CAAE,iBAA+B,CAEvC,yEAAS,CACP,SAAS,CAAE,GAAG,CAChB,2BAAK,CACH,aAAa,CAAE,CAAC,CAClB,oCAAc,CACZ,OAAO,CAAE,KAAK,CACd,WAAW,ClBlFqB,0DAA8D,CkBmF9F,WAAW,CAAE,IAAI,CACjB,UAAU,ClB1FsB,OAAmB,CkB2FnD,OAAO,CAAE,QAA2C,CACpD,MAAM,CAAE,KAAkB,CAC1B,aAAa,CpBlHmB,IAAI,CoBmHpC,SAAS,CAAE,IAAI,CAEnB,yBAAY,CACV,UAAU,ClB9FwB,OAAO,CkB+FzC,OAAO,CAAE,YAAY,CACrB,WAAW,CAAE,IAAI,CACjB,OAAO,CAAE,KAAuB,CAGlC,iEAAwC,CACtC,cAAc,CAAE,KAAK,CACrB,SAAS,CAAE,GAAG,CAIhB,yEAAgD,CAC9C,UAAU,CAAE,IAAI,CAChB,MAAM,CAAE,IAAI,CACZ,KAAK,ClBhI6B,IAAY,CkBiI9C,+JAAM,CACJ,MAAM,CAAE,IAAI,CACZ,gBAAgB,CAAE,sBAAsB,CACxC,WAAW,CAAE,MAAM,CACrB,2FAAQ,CACN,YAAY,CAAE,CAAC,CACf,aAAa,CAAE,CAAC,CAChB,cAAc,CAAE,GAAG,CACrB,mKAAI,CACF,KAAK,ClBnJ2B,IAAK,CkB0JzC,6BAAgB,CAEd,MAAM,CAAE,IAAI,CACZ,gCAAE,CACA,MAAM,CAAE,IAAI,CACd,uCAAW,CACT,OAAO,CAAE,YAAY,CACvB,yCAAW,CACT,aAAa,CAAE,IAAI,CACnB,UAAU,CAAE,IAAI,CAChB,WAAW,CAAE,MAAM,CACrB,yCAAW,CACT,UAAU,CAAE,IAAI,CAGpB,iDAAQ,CAEN,KAAK,CpB7L6B,IAAI,CoB8LtC,OAAO,CAAE,OAAO,CAChB,wHAAO,CACL,SAAS,CAAE,eAAe,CAC1B,WAAW,CAAE,MAAM,CAErB,yEAAS,CACP,KAAK,CpBvK2B,OAAI,CoBwKtC,wHAAW,CACT,WAAW,CAAE,IAAI,CACjB,KAAK,ClB9K2B,OAAW,CkBgL/C,uDAAY,CACV,KAAK,ClBvK6B,OAAK,CkBwKzC,eAAE,CACA,aAAa,CpBtLqB,IAAI,CoBuLtC,kBAAE,CACA,WAAW,CAAE,IAAI,CAEnB,6EAAgB,CACd,aAAa,CAAE,eAAgC,CAEjD,kBAAE,CACA,MAAM,CAAE,aAA4C,CAMxD,8BAAiB,CACf,aAAa,CpBrMqB,IAAI,CoBuMtC,iCAAE,CACA,OAAO,CAAE,KAAK,CACd,MAAM,CAAE,KAAuB,CAC/B,SAAS,CAAE,GAAG,CACd,WAAW,CAAE,MAAM,CACnB,UAAU,CAAE,OAA0B,CACtC,KAAK,ClBhM2B,OAAK,CkBiMrC,UAAU,CAAE,iBAAoC,CAChD,OAAO,CAAE,GAAqB,CAC9B,QAAQ,CAAE,QAAQ,CAClB,wCAAQ,CACN,KAAK,CAAE,OAA0B,CACnC,6CAAW,CACT,KAAK,ClBjNyB,OAAW,CkBkNzC,SAAS,CAAE,eAAe,CAE9B,oCAAK,CACH,aAAa,CAAE,GAAqB,CACpC,MAAM,CAAE,IAAI,CACZ,WAAW,CAAE,cAAuB,CACpC,UAAU,CAAE,OAAa,CACzB,KAAK,ClBhO2B,IAAK,CkBiOrC,gDAAW,CACT,KAAK,ClB3NyB,OAAW,CkB4NzC,SAAS,CAAE,eAAe,CAC9B,6CAAc,CACZ,UAAU,CAAE,CAAC,CAEf,uGAAQ,CACN,WAAW,CAAE,IAAI,CACjB,oRAA2B,CACzB,gBAAgB,CAAE,WAAW,CAC7B,MAAM,CAAE,IAAI,CACZ,OAAO,CAAE,CAAC,CACV,SAAS,CAAE,eAAe,CAC5B,kIAAU,CACR,WAAW,CAAE,IAAI,CAErB,wCAAS,CACP,OAAO,CAAE,YAAY,CACrB,OAAO,CAAE,KAAK,CACd,KAAK,CpBtQ2B,IAAI,CoBuQpC,WAAW,CAAE,IAAI,CACnB,wCAAS,CACP,OAAO,CAAE,YAAY,CACrB,aAAa,CAAE,GAAG,CAEtB,uDAA8B,CAC5B,OAAO,CAAE,YAAY,CACrB,KAAK,ClB7Q6B,OAAM,CkB8QxC,SAAS,CAAE,GAAG,CACd,YAAY,CpB1PsB,IAAI,CoB2PxC,2BAAc,CACZ,OAAO,CAAE,KAAK,CACd,KAAK,CAAE,KAAK,CACd,qBAAQ,CACN,aAAa,CAAE,IAAI,CACnB,WAAW,CAAE,IAAI,CAEnB,mDAAa,CACX,UAAU,CAAE,OAAO,CACnB,OAAO,CAAE,OAAO,CAChB,WAAW,CAAE,MAAM,CACnB,WAAW,CAAE,OAAO,CACpB,SAAS,CAAE,OAAO,CAClB,KAAK,CAAE,OAAO,CACd,MAAM,CAAE,OAAO,CACf,WAAW,CAAE,OAAO,CACpB,qFAAgB,CACd,sBAAsB,CAAE,oBAAoB,CAG5C,mGAAQ,CACN,YAAY,CAAE,GAAG,CACvB,sBAAS,CACP,MAAM,CAAE,iBAAuC,CAC/C,UAAU,CAAE,OAA6B,CACzC,SAAS,CAAE,GAAG,CACd,WAAW,CAAE,GAAG,CAChB,aAAa,CAAE,GAAqB,CACpC,OAAO,CAAE,SAA4C,CACrD,MAAM,CAAE,QAA2B,CACrC,6BAAgB,CACd,UAAU,CAAE,MAAM,CjB1RlB,oCAAsB,CiBgStB,qBAAQ,CACN,KAAK,CAAE,IAAI,ECjUjB,wBAAwB,CACtB,KAAK,CnBkC+B,OAAW,CmBhCjD,KAAK,CACH,UAAU,CAAE,MAAM,YCHlB,WAAW,CAAE,aAAa,CAC1B,UAAU,CAAE,MAAM,CAClB,WAAW,CAAE,GAAG,CAChB,GAAG,CAAE,0GAA4G,YAGjH,WAAW,CAAE,aAAa,CAC1B,UAAU,CAAE,MAAM,CAClB,WAAW,CAAE,GAAG,CAChB,GAAG,CAAE,yGAA2G,YAGhH,WAAW,CAAE,MAAM,CACnB,UAAU,CAAE,MAAM,CAClB,WAAW,CAAE,GAAG,CAChB,GAAG,CAAE,6FAA+F,YAGpG,WAAW,CAAE,MAAM,CACnB,UAAU,CAAE,MAAM,CAClB,WAAW,CAAE,GAAG,CAChB,GAAG,CAAE,oFAAsF,YAG3F,WAAW,CAAE,MAAM,CACnB,UAAU,CAAE,MAAM,CAClB,WAAW,CAAE,GAAG,CAChB,GAAG,CAAE,0FAA4F,YAGjG,WAAW,CAAE,MAAM,CACnB,UAAU,CAAE,MAAM,CAClB,WAAW,CAAE,GAAG,CAChB,GAAG,CAAE,uGAAyG,YAG9G,WAAW,CAAE,aAAa,CAC1B,UAAU,CAAE,MAAM,CAClB,WAAW,CAAE,GAAG,CAChB,GAAG,CAAE,gHAAkH,YAGvH,WAAW,CAAE,aAAa,CAC1B,UAAU,CAAE,MAAM,CAClB,WAAW,CAAE,GAAG,CAChB,GAAG,CAAE,uGAAyG", +"sources": ["../../../bower_components/neat/app/assets/stylesheets/grid/_grid.scss","../../../bower_components/bourbon/dist/addons/_prefixer.scss","../../../bower_components/wyrm/sass/wyrm_core/_reset.sass","../../../bower_components/wyrm/sass/wyrm_core/_mixin.sass","../../../bower_components/font-awesome/scss/font-awesome.scss","../../../bower_components/font-awesome/scss/_path.scss","../../../bower_components/font-awesome/scss/_core.scss","../../../bower_components/font-awesome/scss/_larger.scss","../../../bower_components/font-awesome/scss/_fixed-width.scss","../../../bower_components/font-awesome/scss/_list.scss","../../../bower_components/font-awesome/scss/_variables.scss","../../../bower_components/font-awesome/scss/_bordered-pulled.scss","../../../bower_components/font-awesome/scss/_animated.scss","../../../bower_components/font-awesome/scss/_rotated-flipped.scss","../../../bower_components/font-awesome/scss/_mixins.scss","../../../bower_components/font-awesome/scss/_stacked.scss","../../../bower_components/font-awesome/scss/_icons.scss","../../../bower_components/font-awesome/scss/_screen-reader.scss","../../../bower_components/wyrm/sass/wyrm_core/_font_icon_defaults.sass","../../../bower_components/wyrm/sass/wyrm_core/_wy_variables.sass","../../../bower_components/wyrm/sass/wyrm_core/_alert.sass","../../../sass/_theme_variables.sass","../../../bower_components/neat/app/assets/stylesheets/grid/_media.scss","../../../bower_components/wyrm/sass/wyrm_core/_button.sass","../../../bower_components/wyrm/sass/wyrm_core/_dropdown.sass","../../../bower_components/wyrm/sass/wyrm_core/_form.sass","../../../bower_components/neat/app/assets/stylesheets/grid/_outer-container.scss","../../../bower_components/neat/app/assets/stylesheets/settings/_grid.scss","../../../bower_components/neat/app/assets/stylesheets/grid/_span-columns.scss","../../../bower_components/wyrm/sass/wyrm_core/_neat_extra.sass","../../../bower_components/wyrm/sass/wyrm_core/_generic.sass","../../../bower_components/wyrm/sass/wyrm_core/_table.sass","../../../bower_components/wyrm/sass/wyrm_core/_type.sass","../../../bower_components/wyrm/sass/wyrm_addons/pygments/_pygments.sass","../../../bower_components/wyrm/sass/wyrm_addons/pygments/_pygments_light.sass","../../../sass/_theme_breadcrumbs.sass","../../../sass/_theme_layout.sass","../../../bower_components/neat/app/assets/stylesheets/grid/_private.scss","../../../sass/_theme_badge.sass","../../../sass/_theme_rst.sass","../../../sass/_theme_mathjax.sass","../../../sass/_theme_font_local.sass"], +"names": [], +"file": "theme.css" +} diff --git a/website/docs/_static/doctools.js b/website/docs/_static/doctools.js new file mode 100644 index 0000000..8163495 --- /dev/null +++ b/website/docs/_static/doctools.js @@ -0,0 +1,287 @@ +/* + * doctools.js + * ~~~~~~~~~~~ + * + * Sphinx JavaScript utilities for all documentation. + * + * :copyright: Copyright 2007-2016 by the Sphinx team, see AUTHORS. + * :license: BSD, see LICENSE for details. + * + */ + +/** + * select a different prefix for underscore + */ +$u = _.noConflict(); + +/** + * make the code below compatible with browsers without + * an installed firebug like debugger +if (!window.console || !console.firebug) { + var names = ["log", "debug", "info", "warn", "error", "assert", "dir", + "dirxml", "group", "groupEnd", "time", "timeEnd", "count", "trace", + "profile", "profileEnd"]; + window.console = {}; + for (var i = 0; i < names.length; ++i) + window.console[names[i]] = function() {}; +} + */ + +/** + * small helper function to urldecode strings + */ +jQuery.urldecode = function(x) { + return decodeURIComponent(x).replace(/\+/g, ' '); +}; + +/** + * small helper function to urlencode strings + */ +jQuery.urlencode = encodeURIComponent; + +/** + * This function returns the parsed url parameters of the + * current request. Multiple values per key are supported, + * it will always return arrays of strings for the value parts. + */ +jQuery.getQueryParameters = function(s) { + if (typeof s == 'undefined') + s = document.location.search; + var parts = s.substr(s.indexOf('?') + 1).split('&'); + var result = {}; + for (var i = 0; i < parts.length; i++) { + var tmp = parts[i].split('=', 2); + var key = jQuery.urldecode(tmp[0]); + var value = jQuery.urldecode(tmp[1]); + if (key in result) + result[key].push(value); + else + result[key] = [value]; + } + return result; +}; + +/** + * highlight a given string on a jquery object by wrapping it in + * span elements with the given class name. + */ +jQuery.fn.highlightText = function(text, className) { + function highlight(node) { + if (node.nodeType == 3) { + var val = node.nodeValue; + var pos = val.toLowerCase().indexOf(text); + if (pos >= 0 && !jQuery(node.parentNode).hasClass(className)) { + var span = document.createElement("span"); + span.className = className; + span.appendChild(document.createTextNode(val.substr(pos, text.length))); + node.parentNode.insertBefore(span, node.parentNode.insertBefore( + document.createTextNode(val.substr(pos + text.length)), + node.nextSibling)); + node.nodeValue = val.substr(0, pos); + } + } + else if (!jQuery(node).is("button, select, textarea")) { + jQuery.each(node.childNodes, function() { + highlight(this); + }); + } + } + return this.each(function() { + highlight(this); + }); +}; + +/* + * backward compatibility for jQuery.browser + * This will be supported until firefox bug is fixed. + */ +if (!jQuery.browser) { + jQuery.uaMatch = function(ua) { + ua = ua.toLowerCase(); + + var match = /(chrome)[ \/]([\w.]+)/.exec(ua) || + /(webkit)[ \/]([\w.]+)/.exec(ua) || + /(opera)(?:.*version|)[ \/]([\w.]+)/.exec(ua) || + /(msie) ([\w.]+)/.exec(ua) || + ua.indexOf("compatible") < 0 && /(mozilla)(?:.*? rv:([\w.]+)|)/.exec(ua) || + []; + + return { + browser: match[ 1 ] || "", + version: match[ 2 ] || "0" + }; + }; + jQuery.browser = {}; + jQuery.browser[jQuery.uaMatch(navigator.userAgent).browser] = true; +} + +/** + * Small JavaScript module for the documentation. + */ +var Documentation = { + + init : function() { + this.fixFirefoxAnchorBug(); + this.highlightSearchWords(); + this.initIndexTable(); + + }, + + /** + * i18n support + */ + TRANSLATIONS : {}, + PLURAL_EXPR : function(n) { return n == 1 ? 0 : 1; }, + LOCALE : 'unknown', + + // gettext and ngettext don't access this so that the functions + // can safely bound to a different name (_ = Documentation.gettext) + gettext : function(string) { + var translated = Documentation.TRANSLATIONS[string]; + if (typeof translated == 'undefined') + return string; + return (typeof translated == 'string') ? translated : translated[0]; + }, + + ngettext : function(singular, plural, n) { + var translated = Documentation.TRANSLATIONS[singular]; + if (typeof translated == 'undefined') + return (n == 1) ? singular : plural; + return translated[Documentation.PLURALEXPR(n)]; + }, + + addTranslations : function(catalog) { + for (var key in catalog.messages) + this.TRANSLATIONS[key] = catalog.messages[key]; + this.PLURAL_EXPR = new Function('n', 'return +(' + catalog.plural_expr + ')'); + this.LOCALE = catalog.locale; + }, + + /** + * add context elements like header anchor links + */ + addContextElements : function() { + $('div[id] > :header:first').each(function() { + $('<a class="headerlink">\u00B6</a>'). + attr('href', '#' + this.id). + attr('title', _('Permalink to this headline')). + appendTo(this); + }); + $('dt[id]').each(function() { + $('<a class="headerlink">\u00B6</a>'). + attr('href', '#' + this.id). + attr('title', _('Permalink to this definition')). + appendTo(this); + }); + }, + + /** + * workaround a firefox stupidity + * see: https://bugzilla.mozilla.org/show_bug.cgi?id=645075 + */ + fixFirefoxAnchorBug : function() { + if (document.location.hash) + window.setTimeout(function() { + document.location.href += ''; + }, 10); + }, + + /** + * highlight the search words provided in the url in the text + */ + highlightSearchWords : function() { + var params = $.getQueryParameters(); + var terms = (params.highlight) ? params.highlight[0].split(/\s+/) : []; + if (terms.length) { + var body = $('div.body'); + if (!body.length) { + body = $('body'); + } + window.setTimeout(function() { + $.each(terms, function() { + body.highlightText(this.toLowerCase(), 'highlighted'); + }); + }, 10); + $('<p class="highlight-link"><a href="javascript:Documentation.' + + 'hideSearchWords()">' + _('Hide Search Matches') + '</a></p>') + .appendTo($('#searchbox')); + } + }, + + /** + * init the domain index toggle buttons + */ + initIndexTable : function() { + var togglers = $('img.toggler').click(function() { + var src = $(this).attr('src'); + var idnum = $(this).attr('id').substr(7); + $('tr.cg-' + idnum).toggle(); + if (src.substr(-9) == 'minus.png') + $(this).attr('src', src.substr(0, src.length-9) + 'plus.png'); + else + $(this).attr('src', src.substr(0, src.length-8) + 'minus.png'); + }).css('display', ''); + if (DOCUMENTATION_OPTIONS.COLLAPSE_INDEX) { + togglers.click(); + } + }, + + /** + * helper function to hide the search marks again + */ + hideSearchWords : function() { + $('#searchbox .highlight-link').fadeOut(300); + $('span.highlighted').removeClass('highlighted'); + }, + + /** + * make the url absolute + */ + makeURL : function(relativeURL) { + return DOCUMENTATION_OPTIONS.URL_ROOT + '/' + relativeURL; + }, + + /** + * get the current relative url + */ + getCurrentURL : function() { + var path = document.location.pathname; + var parts = path.split(/\//); + $.each(DOCUMENTATION_OPTIONS.URL_ROOT.split(/\//), function() { + if (this == '..') + parts.pop(); + }); + var url = parts.join('/'); + return path.substring(url.lastIndexOf('/') + 1, path.length - 1); + }, + + initOnKeyListeners: function() { + $(document).keyup(function(event) { + var activeElementType = document.activeElement.tagName; + // don't navigate when in search box or textarea + if (activeElementType !== 'TEXTAREA' && activeElementType !== 'INPUT' && activeElementType !== 'SELECT') { + switch (event.keyCode) { + case 37: // left + var prevHref = $('link[rel="prev"]').prop('href'); + if (prevHref) { + window.location.href = prevHref; + return false; + } + case 39: // right + var nextHref = $('link[rel="next"]').prop('href'); + if (nextHref) { + window.location.href = nextHref; + return false; + } + } + } + }); + } +}; + +// quick alias for translations +_ = Documentation.gettext; + +$(document).ready(function() { + Documentation.init(); +}); \ No newline at end of file diff --git a/website/docs/_static/down-pressed.png b/website/docs/_static/down-pressed.png new file mode 100644 index 0000000..5756c8c Binary files /dev/null and b/website/docs/_static/down-pressed.png differ diff --git a/website/docs/_static/down.png b/website/docs/_static/down.png new file mode 100644 index 0000000..1b3bdad Binary files /dev/null and b/website/docs/_static/down.png differ diff --git a/website/docs/_static/file.png b/website/docs/_static/file.png new file mode 100644 index 0000000..a858a41 Binary files /dev/null and b/website/docs/_static/file.png differ diff --git a/website/docs/_static/fonts/FontAwesome.otf b/website/docs/_static/fonts/FontAwesome.otf new file mode 100644 index 0000000..d4de13e Binary files /dev/null and b/website/docs/_static/fonts/FontAwesome.otf differ diff --git a/website/docs/_static/fonts/Inconsolata-Bold.ttf b/website/docs/_static/fonts/Inconsolata-Bold.ttf new file mode 100644 index 0000000..809c1f5 Binary files /dev/null and b/website/docs/_static/fonts/Inconsolata-Bold.ttf differ diff --git a/website/docs/_static/fonts/Inconsolata-Regular.ttf b/website/docs/_static/fonts/Inconsolata-Regular.ttf new file mode 100644 index 0000000..fc981ce Binary files /dev/null and b/website/docs/_static/fonts/Inconsolata-Regular.ttf differ diff --git a/website/docs/_static/fonts/Lato-Bold.ttf b/website/docs/_static/fonts/Lato-Bold.ttf new file mode 100644 index 0000000..1d23c70 Binary files /dev/null and b/website/docs/_static/fonts/Lato-Bold.ttf differ diff --git a/website/docs/_static/fonts/Lato-Regular.ttf b/website/docs/_static/fonts/Lato-Regular.ttf new file mode 100644 index 0000000..0f3d0f8 Binary files /dev/null and b/website/docs/_static/fonts/Lato-Regular.ttf differ diff --git a/website/docs/_static/fonts/RobotoSlab-Bold.ttf b/website/docs/_static/fonts/RobotoSlab-Bold.ttf new file mode 100644 index 0000000..df5d1df Binary files /dev/null and b/website/docs/_static/fonts/RobotoSlab-Bold.ttf differ diff --git a/website/docs/_static/fonts/RobotoSlab-Regular.ttf b/website/docs/_static/fonts/RobotoSlab-Regular.ttf new file mode 100644 index 0000000..eb52a79 Binary files /dev/null and b/website/docs/_static/fonts/RobotoSlab-Regular.ttf differ diff --git a/website/docs/_static/fonts/fontawesome-webfont.eot b/website/docs/_static/fonts/fontawesome-webfont.eot new file mode 100644 index 0000000..c7b00d2 Binary files /dev/null and b/website/docs/_static/fonts/fontawesome-webfont.eot differ diff --git a/website/docs/_static/fonts/fontawesome-webfont.svg b/website/docs/_static/fonts/fontawesome-webfont.svg new file mode 100644 index 0000000..8b66187 --- /dev/null +++ b/website/docs/_static/fonts/fontawesome-webfont.svg @@ -0,0 +1,685 @@ +<?xml version="1.0" standalone="no"?> +<!DOCTYPE svg PUBLIC "-//W3C//DTD SVG 1.1//EN" "http://www.w3.org/Graphics/SVG/1.1/DTD/svg11.dtd" > +<svg xmlns="http://www.w3.org/2000/svg"> +<metadata></metadata> +<defs> +<font id="fontawesomeregular" horiz-adv-x="1536" > +<font-face units-per-em="1792" ascent="1536" descent="-256" /> +<missing-glyph horiz-adv-x="448" /> +<glyph unicode=" " horiz-adv-x="448" /> +<glyph unicode="	" horiz-adv-x="448" /> +<glyph unicode=" " horiz-adv-x="448" /> +<glyph unicode="¨" horiz-adv-x="1792" /> +<glyph unicode="©" horiz-adv-x="1792" /> +<glyph unicode="®" horiz-adv-x="1792" /> +<glyph unicode="´" horiz-adv-x="1792" /> +<glyph unicode="Æ" horiz-adv-x="1792" /> +<glyph unicode="Ø" horiz-adv-x="1792" /> +<glyph unicode=" " horiz-adv-x="768" /> +<glyph unicode=" " horiz-adv-x="1537" /> +<glyph unicode=" " horiz-adv-x="768" /> +<glyph unicode=" " horiz-adv-x="1537" /> +<glyph unicode=" " horiz-adv-x="512" /> +<glyph unicode=" " horiz-adv-x="384" /> +<glyph unicode=" " horiz-adv-x="256" /> +<glyph unicode=" " horiz-adv-x="256" /> +<glyph unicode=" " horiz-adv-x="192" /> +<glyph unicode=" " horiz-adv-x="307" /> +<glyph unicode=" " horiz-adv-x="85" /> +<glyph unicode=" " horiz-adv-x="307" /> +<glyph unicode=" " horiz-adv-x="384" /> +<glyph unicode="™" horiz-adv-x="1792" /> +<glyph unicode="∞" horiz-adv-x="1792" /> +<glyph unicode="≠" horiz-adv-x="1792" /> +<glyph unicode="◼" horiz-adv-x="500" d="M0 0z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1699 1350q0 -35 -43 -78l-632 -632v-768h320q26 0 45 -19t19 -45t-19 -45t-45 -19h-896q-26 0 -45 19t-19 45t19 45t45 19h320v768l-632 632q-43 43 -43 78q0 23 18 36.5t38 17.5t43 4h1408q23 0 43 -4t38 -17.5t18 -36.5z" /> +<glyph unicode="" d="M1536 1312v-1120q0 -50 -34 -89t-86 -60.5t-103.5 -32t-96.5 -10.5t-96.5 10.5t-103.5 32t-86 60.5t-34 89t34 89t86 60.5t103.5 32t96.5 10.5q105 0 192 -39v537l-768 -237v-709q0 -50 -34 -89t-86 -60.5t-103.5 -32t-96.5 -10.5t-96.5 10.5t-103.5 32t-86 60.5t-34 89 t34 89t86 60.5t103.5 32t96.5 10.5q105 0 192 -39v967q0 31 19 56.5t49 35.5l832 256q12 4 28 4q40 0 68 -28t28 -68z" /> +<glyph unicode="" horiz-adv-x="1664" d="M1152 704q0 185 -131.5 316.5t-316.5 131.5t-316.5 -131.5t-131.5 -316.5t131.5 -316.5t316.5 -131.5t316.5 131.5t131.5 316.5zM1664 -128q0 -52 -38 -90t-90 -38q-54 0 -90 38l-343 342q-179 -124 -399 -124q-143 0 -273.5 55.5t-225 150t-150 225t-55.5 273.5 t55.5 273.5t150 225t225 150t273.5 55.5t273.5 -55.5t225 -150t150 -225t55.5 -273.5q0 -220 -124 -399l343 -343q37 -37 37 -90z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1664 32v768q-32 -36 -69 -66q-268 -206 -426 -338q-51 -43 -83 -67t-86.5 -48.5t-102.5 -24.5h-1h-1q-48 0 -102.5 24.5t-86.5 48.5t-83 67q-158 132 -426 338q-37 30 -69 66v-768q0 -13 9.5 -22.5t22.5 -9.5h1472q13 0 22.5 9.5t9.5 22.5zM1664 1083v11v13.5t-0.5 13 t-3 12.5t-5.5 9t-9 7.5t-14 2.5h-1472q-13 0 -22.5 -9.5t-9.5 -22.5q0 -168 147 -284q193 -152 401 -317q6 -5 35 -29.5t46 -37.5t44.5 -31.5t50.5 -27.5t43 -9h1h1q20 0 43 9t50.5 27.5t44.5 31.5t46 37.5t35 29.5q208 165 401 317q54 43 100.5 115.5t46.5 131.5z M1792 1120v-1088q0 -66 -47 -113t-113 -47h-1472q-66 0 -113 47t-47 113v1088q0 66 47 113t113 47h1472q66 0 113 -47t47 -113z" /> +<glyph unicode="" horiz-adv-x="1792" d="M896 -128q-26 0 -44 18l-624 602q-10 8 -27.5 26t-55.5 65.5t-68 97.5t-53.5 121t-23.5 138q0 220 127 344t351 124q62 0 126.5 -21.5t120 -58t95.5 -68.5t76 -68q36 36 76 68t95.5 68.5t120 58t126.5 21.5q224 0 351 -124t127 -344q0 -221 -229 -450l-623 -600 q-18 -18 -44 -18z" /> +<glyph unicode="" horiz-adv-x="1664" d="M1664 889q0 -22 -26 -48l-363 -354l86 -500q1 -7 1 -20q0 -21 -10.5 -35.5t-30.5 -14.5q-19 0 -40 12l-449 236l-449 -236q-22 -12 -40 -12q-21 0 -31.5 14.5t-10.5 35.5q0 6 2 20l86 500l-364 354q-25 27 -25 48q0 37 56 46l502 73l225 455q19 41 49 41t49 -41l225 -455 l502 -73q56 -9 56 -46z" /> +<glyph unicode="" horiz-adv-x="1664" d="M1137 532l306 297l-422 62l-189 382l-189 -382l-422 -62l306 -297l-73 -421l378 199l377 -199zM1664 889q0 -22 -26 -48l-363 -354l86 -500q1 -7 1 -20q0 -50 -41 -50q-19 0 -40 12l-449 236l-449 -236q-22 -12 -40 -12q-21 0 -31.5 14.5t-10.5 35.5q0 6 2 20l86 500 l-364 354q-25 27 -25 48q0 37 56 46l502 73l225 455q19 41 49 41t49 -41l225 -455l502 -73q56 -9 56 -46z" /> +<glyph unicode="" horiz-adv-x="1408" d="M1408 131q0 -120 -73 -189.5t-194 -69.5h-874q-121 0 -194 69.5t-73 189.5q0 53 3.5 103.5t14 109t26.5 108.5t43 97.5t62 81t85.5 53.5t111.5 20q9 0 42 -21.5t74.5 -48t108 -48t133.5 -21.5t133.5 21.5t108 48t74.5 48t42 21.5q61 0 111.5 -20t85.5 -53.5t62 -81 t43 -97.5t26.5 -108.5t14 -109t3.5 -103.5zM1088 1024q0 -159 -112.5 -271.5t-271.5 -112.5t-271.5 112.5t-112.5 271.5t112.5 271.5t271.5 112.5t271.5 -112.5t112.5 -271.5z" /> +<glyph unicode="" horiz-adv-x="1920" d="M384 -64v128q0 26 -19 45t-45 19h-128q-26 0 -45 -19t-19 -45v-128q0 -26 19 -45t45 -19h128q26 0 45 19t19 45zM384 320v128q0 26 -19 45t-45 19h-128q-26 0 -45 -19t-19 -45v-128q0 -26 19 -45t45 -19h128q26 0 45 19t19 45zM384 704v128q0 26 -19 45t-45 19h-128 q-26 0 -45 -19t-19 -45v-128q0 -26 19 -45t45 -19h128q26 0 45 19t19 45zM1408 -64v512q0 26 -19 45t-45 19h-768q-26 0 -45 -19t-19 -45v-512q0 -26 19 -45t45 -19h768q26 0 45 19t19 45zM384 1088v128q0 26 -19 45t-45 19h-128q-26 0 -45 -19t-19 -45v-128q0 -26 19 -45 t45 -19h128q26 0 45 19t19 45zM1792 -64v128q0 26 -19 45t-45 19h-128q-26 0 -45 -19t-19 -45v-128q0 -26 19 -45t45 -19h128q26 0 45 19t19 45zM1408 704v512q0 26 -19 45t-45 19h-768q-26 0 -45 -19t-19 -45v-512q0 -26 19 -45t45 -19h768q26 0 45 19t19 45zM1792 320v128 q0 26 -19 45t-45 19h-128q-26 0 -45 -19t-19 -45v-128q0 -26 19 -45t45 -19h128q26 0 45 19t19 45zM1792 704v128q0 26 -19 45t-45 19h-128q-26 0 -45 -19t-19 -45v-128q0 -26 19 -45t45 -19h128q26 0 45 19t19 45zM1792 1088v128q0 26 -19 45t-45 19h-128q-26 0 -45 -19 t-19 -45v-128q0 -26 19 -45t45 -19h128q26 0 45 19t19 45zM1920 1248v-1344q0 -66 -47 -113t-113 -47h-1600q-66 0 -113 47t-47 113v1344q0 66 47 113t113 47h1600q66 0 113 -47t47 -113z" /> +<glyph unicode="" horiz-adv-x="1664" d="M768 512v-384q0 -52 -38 -90t-90 -38h-512q-52 0 -90 38t-38 90v384q0 52 38 90t90 38h512q52 0 90 -38t38 -90zM768 1280v-384q0 -52 -38 -90t-90 -38h-512q-52 0 -90 38t-38 90v384q0 52 38 90t90 38h512q52 0 90 -38t38 -90zM1664 512v-384q0 -52 -38 -90t-90 -38 h-512q-52 0 -90 38t-38 90v384q0 52 38 90t90 38h512q52 0 90 -38t38 -90zM1664 1280v-384q0 -52 -38 -90t-90 -38h-512q-52 0 -90 38t-38 90v384q0 52 38 90t90 38h512q52 0 90 -38t38 -90z" /> +<glyph unicode="" horiz-adv-x="1792" d="M512 288v-192q0 -40 -28 -68t-68 -28h-320q-40 0 -68 28t-28 68v192q0 40 28 68t68 28h320q40 0 68 -28t28 -68zM512 800v-192q0 -40 -28 -68t-68 -28h-320q-40 0 -68 28t-28 68v192q0 40 28 68t68 28h320q40 0 68 -28t28 -68zM1152 288v-192q0 -40 -28 -68t-68 -28h-320 q-40 0 -68 28t-28 68v192q0 40 28 68t68 28h320q40 0 68 -28t28 -68zM512 1312v-192q0 -40 -28 -68t-68 -28h-320q-40 0 -68 28t-28 68v192q0 40 28 68t68 28h320q40 0 68 -28t28 -68zM1152 800v-192q0 -40 -28 -68t-68 -28h-320q-40 0 -68 28t-28 68v192q0 40 28 68t68 28 h320q40 0 68 -28t28 -68zM1792 288v-192q0 -40 -28 -68t-68 -28h-320q-40 0 -68 28t-28 68v192q0 40 28 68t68 28h320q40 0 68 -28t28 -68zM1152 1312v-192q0 -40 -28 -68t-68 -28h-320q-40 0 -68 28t-28 68v192q0 40 28 68t68 28h320q40 0 68 -28t28 -68zM1792 800v-192 q0 -40 -28 -68t-68 -28h-320q-40 0 -68 28t-28 68v192q0 40 28 68t68 28h320q40 0 68 -28t28 -68zM1792 1312v-192q0 -40 -28 -68t-68 -28h-320q-40 0 -68 28t-28 68v192q0 40 28 68t68 28h320q40 0 68 -28t28 -68z" /> +<glyph unicode="" horiz-adv-x="1792" d="M512 288v-192q0 -40 -28 -68t-68 -28h-320q-40 0 -68 28t-28 68v192q0 40 28 68t68 28h320q40 0 68 -28t28 -68zM512 800v-192q0 -40 -28 -68t-68 -28h-320q-40 0 -68 28t-28 68v192q0 40 28 68t68 28h320q40 0 68 -28t28 -68zM1792 288v-192q0 -40 -28 -68t-68 -28h-960 q-40 0 -68 28t-28 68v192q0 40 28 68t68 28h960q40 0 68 -28t28 -68zM512 1312v-192q0 -40 -28 -68t-68 -28h-320q-40 0 -68 28t-28 68v192q0 40 28 68t68 28h320q40 0 68 -28t28 -68zM1792 800v-192q0 -40 -28 -68t-68 -28h-960q-40 0 -68 28t-28 68v192q0 40 28 68t68 28 h960q40 0 68 -28t28 -68zM1792 1312v-192q0 -40 -28 -68t-68 -28h-960q-40 0 -68 28t-28 68v192q0 40 28 68t68 28h960q40 0 68 -28t28 -68z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1671 970q0 -40 -28 -68l-724 -724l-136 -136q-28 -28 -68 -28t-68 28l-136 136l-362 362q-28 28 -28 68t28 68l136 136q28 28 68 28t68 -28l294 -295l656 657q28 28 68 28t68 -28l136 -136q28 -28 28 -68z" /> +<glyph unicode="" horiz-adv-x="1408" d="M1298 214q0 -40 -28 -68l-136 -136q-28 -28 -68 -28t-68 28l-294 294l-294 -294q-28 -28 -68 -28t-68 28l-136 136q-28 28 -28 68t28 68l294 294l-294 294q-28 28 -28 68t28 68l136 136q28 28 68 28t68 -28l294 -294l294 294q28 28 68 28t68 -28l136 -136q28 -28 28 -68 t-28 -68l-294 -294l294 -294q28 -28 28 -68z" /> +<glyph unicode="" horiz-adv-x="1664" d="M1024 736v-64q0 -13 -9.5 -22.5t-22.5 -9.5h-224v-224q0 -13 -9.5 -22.5t-22.5 -9.5h-64q-13 0 -22.5 9.5t-9.5 22.5v224h-224q-13 0 -22.5 9.5t-9.5 22.5v64q0 13 9.5 22.5t22.5 9.5h224v224q0 13 9.5 22.5t22.5 9.5h64q13 0 22.5 -9.5t9.5 -22.5v-224h224 q13 0 22.5 -9.5t9.5 -22.5zM1152 704q0 185 -131.5 316.5t-316.5 131.5t-316.5 -131.5t-131.5 -316.5t131.5 -316.5t316.5 -131.5t316.5 131.5t131.5 316.5zM1664 -128q0 -53 -37.5 -90.5t-90.5 -37.5q-54 0 -90 38l-343 342q-179 -124 -399 -124q-143 0 -273.5 55.5 t-225 150t-150 225t-55.5 273.5t55.5 273.5t150 225t225 150t273.5 55.5t273.5 -55.5t225 -150t150 -225t55.5 -273.5q0 -220 -124 -399l343 -343q37 -37 37 -90z" /> +<glyph unicode="" horiz-adv-x="1664" d="M1024 736v-64q0 -13 -9.5 -22.5t-22.5 -9.5h-576q-13 0 -22.5 9.5t-9.5 22.5v64q0 13 9.5 22.5t22.5 9.5h576q13 0 22.5 -9.5t9.5 -22.5zM1152 704q0 185 -131.5 316.5t-316.5 131.5t-316.5 -131.5t-131.5 -316.5t131.5 -316.5t316.5 -131.5t316.5 131.5t131.5 316.5z M1664 -128q0 -53 -37.5 -90.5t-90.5 -37.5q-54 0 -90 38l-343 342q-179 -124 -399 -124q-143 0 -273.5 55.5t-225 150t-150 225t-55.5 273.5t55.5 273.5t150 225t225 150t273.5 55.5t273.5 -55.5t225 -150t150 -225t55.5 -273.5q0 -220 -124 -399l343 -343q37 -37 37 -90z " /> +<glyph unicode="" d="M1536 640q0 -156 -61 -298t-164 -245t-245 -164t-298 -61t-298 61t-245 164t-164 245t-61 298q0 182 80.5 343t226.5 270q43 32 95.5 25t83.5 -50q32 -42 24.5 -94.5t-49.5 -84.5q-98 -74 -151.5 -181t-53.5 -228q0 -104 40.5 -198.5t109.5 -163.5t163.5 -109.5 t198.5 -40.5t198.5 40.5t163.5 109.5t109.5 163.5t40.5 198.5q0 121 -53.5 228t-151.5 181q-42 32 -49.5 84.5t24.5 94.5q31 43 84 50t95 -25q146 -109 226.5 -270t80.5 -343zM896 1408v-640q0 -52 -38 -90t-90 -38t-90 38t-38 90v640q0 52 38 90t90 38t90 -38t38 -90z" /> +<glyph unicode="" horiz-adv-x="1792" d="M256 96v-192q0 -14 -9 -23t-23 -9h-192q-14 0 -23 9t-9 23v192q0 14 9 23t23 9h192q14 0 23 -9t9 -23zM640 224v-320q0 -14 -9 -23t-23 -9h-192q-14 0 -23 9t-9 23v320q0 14 9 23t23 9h192q14 0 23 -9t9 -23zM1024 480v-576q0 -14 -9 -23t-23 -9h-192q-14 0 -23 9t-9 23 v576q0 14 9 23t23 9h192q14 0 23 -9t9 -23zM1408 864v-960q0 -14 -9 -23t-23 -9h-192q-14 0 -23 9t-9 23v960q0 14 9 23t23 9h192q14 0 23 -9t9 -23zM1792 1376v-1472q0 -14 -9 -23t-23 -9h-192q-14 0 -23 9t-9 23v1472q0 14 9 23t23 9h192q14 0 23 -9t9 -23z" /> +<glyph unicode="" d="M1024 640q0 106 -75 181t-181 75t-181 -75t-75 -181t75 -181t181 -75t181 75t75 181zM1536 749v-222q0 -12 -8 -23t-20 -13l-185 -28q-19 -54 -39 -91q35 -50 107 -138q10 -12 10 -25t-9 -23q-27 -37 -99 -108t-94 -71q-12 0 -26 9l-138 108q-44 -23 -91 -38 q-16 -136 -29 -186q-7 -28 -36 -28h-222q-14 0 -24.5 8.5t-11.5 21.5l-28 184q-49 16 -90 37l-141 -107q-10 -9 -25 -9q-14 0 -25 11q-126 114 -165 168q-7 10 -7 23q0 12 8 23q15 21 51 66.5t54 70.5q-27 50 -41 99l-183 27q-13 2 -21 12.5t-8 23.5v222q0 12 8 23t19 13 l186 28q14 46 39 92q-40 57 -107 138q-10 12 -10 24q0 10 9 23q26 36 98.5 107.5t94.5 71.5q13 0 26 -10l138 -107q44 23 91 38q16 136 29 186q7 28 36 28h222q14 0 24.5 -8.5t11.5 -21.5l28 -184q49 -16 90 -37l142 107q9 9 24 9q13 0 25 -10q129 -119 165 -170q7 -8 7 -22 q0 -12 -8 -23q-15 -21 -51 -66.5t-54 -70.5q26 -50 41 -98l183 -28q13 -2 21 -12.5t8 -23.5z" /> +<glyph unicode="" horiz-adv-x="1408" d="M512 800v-576q0 -14 -9 -23t-23 -9h-64q-14 0 -23 9t-9 23v576q0 14 9 23t23 9h64q14 0 23 -9t9 -23zM768 800v-576q0 -14 -9 -23t-23 -9h-64q-14 0 -23 9t-9 23v576q0 14 9 23t23 9h64q14 0 23 -9t9 -23zM1024 800v-576q0 -14 -9 -23t-23 -9h-64q-14 0 -23 9t-9 23v576 q0 14 9 23t23 9h64q14 0 23 -9t9 -23zM1152 76v948h-896v-948q0 -22 7 -40.5t14.5 -27t10.5 -8.5h832q3 0 10.5 8.5t14.5 27t7 40.5zM480 1152h448l-48 117q-7 9 -17 11h-317q-10 -2 -17 -11zM1408 1120v-64q0 -14 -9 -23t-23 -9h-96v-948q0 -83 -47 -143.5t-113 -60.5h-832 q-66 0 -113 58.5t-47 141.5v952h-96q-14 0 -23 9t-9 23v64q0 14 9 23t23 9h309l70 167q15 37 54 63t79 26h320q40 0 79 -26t54 -63l70 -167h309q14 0 23 -9t9 -23z" /> +<glyph unicode="" horiz-adv-x="1664" d="M1408 544v-480q0 -26 -19 -45t-45 -19h-384v384h-256v-384h-384q-26 0 -45 19t-19 45v480q0 1 0.5 3t0.5 3l575 474l575 -474q1 -2 1 -6zM1631 613l-62 -74q-8 -9 -21 -11h-3q-13 0 -21 7l-692 577l-692 -577q-12 -8 -24 -7q-13 2 -21 11l-62 74q-8 10 -7 23.5t11 21.5 l719 599q32 26 76 26t76 -26l244 -204v195q0 14 9 23t23 9h192q14 0 23 -9t9 -23v-408l219 -182q10 -8 11 -21.5t-7 -23.5z" /> +<glyph unicode="" d="M1468 1156q28 -28 48 -76t20 -88v-1152q0 -40 -28 -68t-68 -28h-1344q-40 0 -68 28t-28 68v1600q0 40 28 68t68 28h896q40 0 88 -20t76 -48zM1024 1400v-376h376q-10 29 -22 41l-313 313q-12 12 -41 22zM1408 -128v1024h-416q-40 0 -68 28t-28 68v416h-768v-1536h1280z " /> +<glyph unicode="" d="M896 992v-448q0 -14 -9 -23t-23 -9h-320q-14 0 -23 9t-9 23v64q0 14 9 23t23 9h224v352q0 14 9 23t23 9h64q14 0 23 -9t9 -23zM1312 640q0 148 -73 273t-198 198t-273 73t-273 -73t-198 -198t-73 -273t73 -273t198 -198t273 -73t273 73t198 198t73 273zM1536 640 q0 -209 -103 -385.5t-279.5 -279.5t-385.5 -103t-385.5 103t-279.5 279.5t-103 385.5t103 385.5t279.5 279.5t385.5 103t385.5 -103t279.5 -279.5t103 -385.5z" /> +<glyph unicode="" horiz-adv-x="1920" d="M1111 540v4l-24 320q-1 13 -11 22.5t-23 9.5h-186q-13 0 -23 -9.5t-11 -22.5l-24 -320v-4q-1 -12 8 -20t21 -8h244q12 0 21 8t8 20zM1870 73q0 -73 -46 -73h-704q13 0 22 9.5t8 22.5l-20 256q-1 13 -11 22.5t-23 9.5h-272q-13 0 -23 -9.5t-11 -22.5l-20 -256 q-1 -13 8 -22.5t22 -9.5h-704q-46 0 -46 73q0 54 26 116l417 1044q8 19 26 33t38 14h339q-13 0 -23 -9.5t-11 -22.5l-15 -192q-1 -14 8 -23t22 -9h166q13 0 22 9t8 23l-15 192q-1 13 -11 22.5t-23 9.5h339q20 0 38 -14t26 -33l417 -1044q26 -62 26 -116z" /> +<glyph unicode="" horiz-adv-x="1664" d="M1280 192q0 26 -19 45t-45 19t-45 -19t-19 -45t19 -45t45 -19t45 19t19 45zM1536 192q0 26 -19 45t-45 19t-45 -19t-19 -45t19 -45t45 -19t45 19t19 45zM1664 416v-320q0 -40 -28 -68t-68 -28h-1472q-40 0 -68 28t-28 68v320q0 40 28 68t68 28h465l135 -136 q58 -56 136 -56t136 56l136 136h464q40 0 68 -28t28 -68zM1339 985q17 -41 -14 -70l-448 -448q-18 -19 -45 -19t-45 19l-448 448q-31 29 -14 70q17 39 59 39h256v448q0 26 19 45t45 19h256q26 0 45 -19t19 -45v-448h256q42 0 59 -39z" /> +<glyph unicode="" d="M1120 608q0 -12 -10 -24l-319 -319q-11 -9 -23 -9t-23 9l-320 320q-15 16 -7 35q8 20 30 20h192v352q0 14 9 23t23 9h192q14 0 23 -9t9 -23v-352h192q14 0 23 -9t9 -23zM768 1184q-148 0 -273 -73t-198 -198t-73 -273t73 -273t198 -198t273 -73t273 73t198 198t73 273 t-73 273t-198 198t-273 73zM1536 640q0 -209 -103 -385.5t-279.5 -279.5t-385.5 -103t-385.5 103t-279.5 279.5t-103 385.5t103 385.5t279.5 279.5t385.5 103t385.5 -103t279.5 -279.5t103 -385.5z" /> +<glyph unicode="" d="M1118 660q-8 -20 -30 -20h-192v-352q0 -14 -9 -23t-23 -9h-192q-14 0 -23 9t-9 23v352h-192q-14 0 -23 9t-9 23q0 12 10 24l319 319q11 9 23 9t23 -9l320 -320q15 -16 7 -35zM768 1184q-148 0 -273 -73t-198 -198t-73 -273t73 -273t198 -198t273 -73t273 73t198 198 t73 273t-73 273t-198 198t-273 73zM1536 640q0 -209 -103 -385.5t-279.5 -279.5t-385.5 -103t-385.5 103t-279.5 279.5t-103 385.5t103 385.5t279.5 279.5t385.5 103t385.5 -103t279.5 -279.5t103 -385.5z" /> +<glyph unicode="" d="M1023 576h316q-1 3 -2.5 8t-2.5 8l-212 496h-708l-212 -496q-1 -2 -2.5 -8t-2.5 -8h316l95 -192h320zM1536 546v-482q0 -26 -19 -45t-45 -19h-1408q-26 0 -45 19t-19 45v482q0 62 25 123l238 552q10 25 36.5 42t52.5 17h832q26 0 52.5 -17t36.5 -42l238 -552 q25 -61 25 -123z" /> +<glyph unicode="" d="M1184 640q0 -37 -32 -55l-544 -320q-15 -9 -32 -9q-16 0 -32 8q-32 19 -32 56v640q0 37 32 56q33 18 64 -1l544 -320q32 -18 32 -55zM1312 640q0 148 -73 273t-198 198t-273 73t-273 -73t-198 -198t-73 -273t73 -273t198 -198t273 -73t273 73t198 198t73 273zM1536 640 q0 -209 -103 -385.5t-279.5 -279.5t-385.5 -103t-385.5 103t-279.5 279.5t-103 385.5t103 385.5t279.5 279.5t385.5 103t385.5 -103t279.5 -279.5t103 -385.5z" /> +<glyph unicode="" d="M1536 1280v-448q0 -26 -19 -45t-45 -19h-448q-42 0 -59 40q-17 39 14 69l138 138q-148 137 -349 137q-104 0 -198.5 -40.5t-163.5 -109.5t-109.5 -163.5t-40.5 -198.5t40.5 -198.5t109.5 -163.5t163.5 -109.5t198.5 -40.5q119 0 225 52t179 147q7 10 23 12q14 0 25 -9 l137 -138q9 -8 9.5 -20.5t-7.5 -22.5q-109 -132 -264 -204.5t-327 -72.5q-156 0 -298 61t-245 164t-164 245t-61 298t61 298t164 245t245 164t298 61q147 0 284.5 -55.5t244.5 -156.5l130 129q29 31 70 14q39 -17 39 -59z" /> +<glyph unicode="" d="M1511 480q0 -5 -1 -7q-64 -268 -268 -434.5t-478 -166.5q-146 0 -282.5 55t-243.5 157l-129 -129q-19 -19 -45 -19t-45 19t-19 45v448q0 26 19 45t45 19h448q26 0 45 -19t19 -45t-19 -45l-137 -137q71 -66 161 -102t187 -36q134 0 250 65t186 179q11 17 53 117 q8 23 30 23h192q13 0 22.5 -9.5t9.5 -22.5zM1536 1280v-448q0 -26 -19 -45t-45 -19h-448q-26 0 -45 19t-19 45t19 45l138 138q-148 137 -349 137q-134 0 -250 -65t-186 -179q-11 -17 -53 -117q-8 -23 -30 -23h-199q-13 0 -22.5 9.5t-9.5 22.5v7q65 268 270 434.5t480 166.5 q146 0 284 -55.5t245 -156.5l130 129q19 19 45 19t45 -19t19 -45z" /> +<glyph unicode="" horiz-adv-x="1792" d="M384 352v-64q0 -13 -9.5 -22.5t-22.5 -9.5h-64q-13 0 -22.5 9.5t-9.5 22.5v64q0 13 9.5 22.5t22.5 9.5h64q13 0 22.5 -9.5t9.5 -22.5zM384 608v-64q0 -13 -9.5 -22.5t-22.5 -9.5h-64q-13 0 -22.5 9.5t-9.5 22.5v64q0 13 9.5 22.5t22.5 9.5h64q13 0 22.5 -9.5t9.5 -22.5z M384 864v-64q0 -13 -9.5 -22.5t-22.5 -9.5h-64q-13 0 -22.5 9.5t-9.5 22.5v64q0 13 9.5 22.5t22.5 9.5h64q13 0 22.5 -9.5t9.5 -22.5zM1536 352v-64q0 -13 -9.5 -22.5t-22.5 -9.5h-960q-13 0 -22.5 9.5t-9.5 22.5v64q0 13 9.5 22.5t22.5 9.5h960q13 0 22.5 -9.5t9.5 -22.5z M1536 608v-64q0 -13 -9.5 -22.5t-22.5 -9.5h-960q-13 0 -22.5 9.5t-9.5 22.5v64q0 13 9.5 22.5t22.5 9.5h960q13 0 22.5 -9.5t9.5 -22.5zM1536 864v-64q0 -13 -9.5 -22.5t-22.5 -9.5h-960q-13 0 -22.5 9.5t-9.5 22.5v64q0 13 9.5 22.5t22.5 9.5h960q13 0 22.5 -9.5 t9.5 -22.5zM1664 160v832q0 13 -9.5 22.5t-22.5 9.5h-1472q-13 0 -22.5 -9.5t-9.5 -22.5v-832q0 -13 9.5 -22.5t22.5 -9.5h1472q13 0 22.5 9.5t9.5 22.5zM1792 1248v-1088q0 -66 -47 -113t-113 -47h-1472q-66 0 -113 47t-47 113v1088q0 66 47 113t113 47h1472q66 0 113 -47 t47 -113z" /> +<glyph unicode="" horiz-adv-x="1152" d="M320 768h512v192q0 106 -75 181t-181 75t-181 -75t-75 -181v-192zM1152 672v-576q0 -40 -28 -68t-68 -28h-960q-40 0 -68 28t-28 68v576q0 40 28 68t68 28h32v192q0 184 132 316t316 132t316 -132t132 -316v-192h32q40 0 68 -28t28 -68z" /> +<glyph unicode="" horiz-adv-x="1792" d="M320 1280q0 -72 -64 -110v-1266q0 -13 -9.5 -22.5t-22.5 -9.5h-64q-13 0 -22.5 9.5t-9.5 22.5v1266q-64 38 -64 110q0 53 37.5 90.5t90.5 37.5t90.5 -37.5t37.5 -90.5zM1792 1216v-763q0 -25 -12.5 -38.5t-39.5 -27.5q-215 -116 -369 -116q-61 0 -123.5 22t-108.5 48 t-115.5 48t-142.5 22q-192 0 -464 -146q-17 -9 -33 -9q-26 0 -45 19t-19 45v742q0 32 31 55q21 14 79 43q236 120 421 120q107 0 200 -29t219 -88q38 -19 88 -19q54 0 117.5 21t110 47t88 47t54.5 21q26 0 45 -19t19 -45z" /> +<glyph unicode="" horiz-adv-x="1664" d="M1664 650q0 -166 -60 -314l-20 -49l-185 -33q-22 -83 -90.5 -136.5t-156.5 -53.5v-32q0 -14 -9 -23t-23 -9h-64q-14 0 -23 9t-9 23v576q0 14 9 23t23 9h64q14 0 23 -9t9 -23v-32q71 0 130 -35.5t93 -95.5l68 12q29 95 29 193q0 148 -88 279t-236.5 209t-315.5 78 t-315.5 -78t-236.5 -209t-88 -279q0 -98 29 -193l68 -12q34 60 93 95.5t130 35.5v32q0 14 9 23t23 9h64q14 0 23 -9t9 -23v-576q0 -14 -9 -23t-23 -9h-64q-14 0 -23 9t-9 23v32q-88 0 -156.5 53.5t-90.5 136.5l-185 33l-20 49q-60 148 -60 314q0 151 67 291t179 242.5 t266 163.5t320 61t320 -61t266 -163.5t179 -242.5t67 -291z" /> +<glyph unicode="" horiz-adv-x="768" d="M768 1184v-1088q0 -26 -19 -45t-45 -19t-45 19l-333 333h-262q-26 0 -45 19t-19 45v384q0 26 19 45t45 19h262l333 333q19 19 45 19t45 -19t19 -45z" /> +<glyph unicode="" horiz-adv-x="1152" d="M768 1184v-1088q0 -26 -19 -45t-45 -19t-45 19l-333 333h-262q-26 0 -45 19t-19 45v384q0 26 19 45t45 19h262l333 333q19 19 45 19t45 -19t19 -45zM1152 640q0 -76 -42.5 -141.5t-112.5 -93.5q-10 -5 -25 -5q-26 0 -45 18.5t-19 45.5q0 21 12 35.5t29 25t34 23t29 35.5 t12 57t-12 57t-29 35.5t-34 23t-29 25t-12 35.5q0 27 19 45.5t45 18.5q15 0 25 -5q70 -27 112.5 -93t42.5 -142z" /> +<glyph unicode="" horiz-adv-x="1664" d="M768 1184v-1088q0 -26 -19 -45t-45 -19t-45 19l-333 333h-262q-26 0 -45 19t-19 45v384q0 26 19 45t45 19h262l333 333q19 19 45 19t45 -19t19 -45zM1152 640q0 -76 -42.5 -141.5t-112.5 -93.5q-10 -5 -25 -5q-26 0 -45 18.5t-19 45.5q0 21 12 35.5t29 25t34 23t29 35.5 t12 57t-12 57t-29 35.5t-34 23t-29 25t-12 35.5q0 27 19 45.5t45 18.5q15 0 25 -5q70 -27 112.5 -93t42.5 -142zM1408 640q0 -153 -85 -282.5t-225 -188.5q-13 -5 -25 -5q-27 0 -46 19t-19 45q0 39 39 59q56 29 76 44q74 54 115.5 135.5t41.5 173.5t-41.5 173.5 t-115.5 135.5q-20 15 -76 44q-39 20 -39 59q0 26 19 45t45 19q13 0 26 -5q140 -59 225 -188.5t85 -282.5zM1664 640q0 -230 -127 -422.5t-338 -283.5q-13 -5 -26 -5q-26 0 -45 19t-19 45q0 36 39 59q7 4 22.5 10.5t22.5 10.5q46 25 82 51q123 91 192 227t69 289t-69 289 t-192 227q-36 26 -82 51q-7 4 -22.5 10.5t-22.5 10.5q-39 23 -39 59q0 26 19 45t45 19q13 0 26 -5q211 -91 338 -283.5t127 -422.5z" /> +<glyph unicode="" horiz-adv-x="1408" d="M384 384v-128h-128v128h128zM384 1152v-128h-128v128h128zM1152 1152v-128h-128v128h128zM128 129h384v383h-384v-383zM128 896h384v384h-384v-384zM896 896h384v384h-384v-384zM640 640v-640h-640v640h640zM1152 128v-128h-128v128h128zM1408 128v-128h-128v128h128z M1408 640v-384h-384v128h-128v-384h-128v640h384v-128h128v128h128zM640 1408v-640h-640v640h640zM1408 1408v-640h-640v640h640z" /> +<glyph unicode="" horiz-adv-x="1792" d="M63 0h-63v1408h63v-1408zM126 1h-32v1407h32v-1407zM220 1h-31v1407h31v-1407zM377 1h-31v1407h31v-1407zM534 1h-62v1407h62v-1407zM660 1h-31v1407h31v-1407zM723 1h-31v1407h31v-1407zM786 1h-31v1407h31v-1407zM943 1h-63v1407h63v-1407zM1100 1h-63v1407h63v-1407z M1226 1h-63v1407h63v-1407zM1352 1h-63v1407h63v-1407zM1446 1h-63v1407h63v-1407zM1635 1h-94v1407h94v-1407zM1698 1h-32v1407h32v-1407zM1792 0h-63v1408h63v-1408z" /> +<glyph unicode="" d="M448 1088q0 53 -37.5 90.5t-90.5 37.5t-90.5 -37.5t-37.5 -90.5t37.5 -90.5t90.5 -37.5t90.5 37.5t37.5 90.5zM1515 512q0 -53 -37 -90l-491 -492q-39 -37 -91 -37q-53 0 -90 37l-715 716q-38 37 -64.5 101t-26.5 117v416q0 52 38 90t90 38h416q53 0 117 -26.5t102 -64.5 l715 -714q37 -39 37 -91z" /> +<glyph unicode="" horiz-adv-x="1920" d="M448 1088q0 53 -37.5 90.5t-90.5 37.5t-90.5 -37.5t-37.5 -90.5t37.5 -90.5t90.5 -37.5t90.5 37.5t37.5 90.5zM1515 512q0 -53 -37 -90l-491 -492q-39 -37 -91 -37q-53 0 -90 37l-715 716q-38 37 -64.5 101t-26.5 117v416q0 52 38 90t90 38h416q53 0 117 -26.5t102 -64.5 l715 -714q37 -39 37 -91zM1899 512q0 -53 -37 -90l-491 -492q-39 -37 -91 -37q-36 0 -59 14t-53 45l470 470q37 37 37 90q0 52 -37 91l-715 714q-38 38 -102 64.5t-117 26.5h224q53 0 117 -26.5t102 -64.5l715 -714q37 -39 37 -91z" /> +<glyph unicode="" horiz-adv-x="1664" d="M1639 1058q40 -57 18 -129l-275 -906q-19 -64 -76.5 -107.5t-122.5 -43.5h-923q-77 0 -148.5 53.5t-99.5 131.5q-24 67 -2 127q0 4 3 27t4 37q1 8 -3 21.5t-3 19.5q2 11 8 21t16.5 23.5t16.5 23.5q23 38 45 91.5t30 91.5q3 10 0.5 30t-0.5 28q3 11 17 28t17 23 q21 36 42 92t25 90q1 9 -2.5 32t0.5 28q4 13 22 30.5t22 22.5q19 26 42.5 84.5t27.5 96.5q1 8 -3 25.5t-2 26.5q2 8 9 18t18 23t17 21q8 12 16.5 30.5t15 35t16 36t19.5 32t26.5 23.5t36 11.5t47.5 -5.5l-1 -3q38 9 51 9h761q74 0 114 -56t18 -130l-274 -906 q-36 -119 -71.5 -153.5t-128.5 -34.5h-869q-27 0 -38 -15q-11 -16 -1 -43q24 -70 144 -70h923q29 0 56 15.5t35 41.5l300 987q7 22 5 57q38 -15 59 -43zM575 1056q-4 -13 2 -22.5t20 -9.5h608q13 0 25.5 9.5t16.5 22.5l21 64q4 13 -2 22.5t-20 9.5h-608q-13 0 -25.5 -9.5 t-16.5 -22.5zM492 800q-4 -13 2 -22.5t20 -9.5h608q13 0 25.5 9.5t16.5 22.5l21 64q4 13 -2 22.5t-20 9.5h-608q-13 0 -25.5 -9.5t-16.5 -22.5z" /> +<glyph unicode="" horiz-adv-x="1280" d="M1164 1408q23 0 44 -9q33 -13 52.5 -41t19.5 -62v-1289q0 -34 -19.5 -62t-52.5 -41q-19 -8 -44 -8q-48 0 -83 32l-441 424l-441 -424q-36 -33 -83 -33q-23 0 -44 9q-33 13 -52.5 41t-19.5 62v1289q0 34 19.5 62t52.5 41q21 9 44 9h1048z" /> +<glyph unicode="" horiz-adv-x="1664" d="M384 0h896v256h-896v-256zM384 640h896v384h-160q-40 0 -68 28t-28 68v160h-640v-640zM1536 576q0 26 -19 45t-45 19t-45 -19t-19 -45t19 -45t45 -19t45 19t19 45zM1664 576v-416q0 -13 -9.5 -22.5t-22.5 -9.5h-224v-160q0 -40 -28 -68t-68 -28h-960q-40 0 -68 28t-28 68 v160h-224q-13 0 -22.5 9.5t-9.5 22.5v416q0 79 56.5 135.5t135.5 56.5h64v544q0 40 28 68t68 28h672q40 0 88 -20t76 -48l152 -152q28 -28 48 -76t20 -88v-256h64q79 0 135.5 -56.5t56.5 -135.5z" /> +<glyph unicode="" horiz-adv-x="1920" d="M960 864q119 0 203.5 -84.5t84.5 -203.5t-84.5 -203.5t-203.5 -84.5t-203.5 84.5t-84.5 203.5t84.5 203.5t203.5 84.5zM1664 1280q106 0 181 -75t75 -181v-896q0 -106 -75 -181t-181 -75h-1408q-106 0 -181 75t-75 181v896q0 106 75 181t181 75h224l51 136 q19 49 69.5 84.5t103.5 35.5h512q53 0 103.5 -35.5t69.5 -84.5l51 -136h224zM960 128q185 0 316.5 131.5t131.5 316.5t-131.5 316.5t-316.5 131.5t-316.5 -131.5t-131.5 -316.5t131.5 -316.5t316.5 -131.5z" /> +<glyph unicode="" horiz-adv-x="1664" d="M725 977l-170 -450q33 0 136.5 -2t160.5 -2q19 0 57 2q-87 253 -184 452zM0 -128l2 79q23 7 56 12.5t57 10.5t49.5 14.5t44.5 29t31 50.5l237 616l280 724h75h53q8 -14 11 -21l205 -480q33 -78 106 -257.5t114 -274.5q15 -34 58 -144.5t72 -168.5q20 -45 35 -57 q19 -15 88 -29.5t84 -20.5q6 -38 6 -57q0 -4 -0.5 -13t-0.5 -13q-63 0 -190 8t-191 8q-76 0 -215 -7t-178 -8q0 43 4 78l131 28q1 0 12.5 2.5t15.5 3.5t14.5 4.5t15 6.5t11 8t9 11t2.5 14q0 16 -31 96.5t-72 177.5t-42 100l-450 2q-26 -58 -76.5 -195.5t-50.5 -162.5 q0 -22 14 -37.5t43.5 -24.5t48.5 -13.5t57 -8.5t41 -4q1 -19 1 -58q0 -9 -2 -27q-58 0 -174.5 10t-174.5 10q-8 0 -26.5 -4t-21.5 -4q-80 -14 -188 -14z" /> +<glyph unicode="" horiz-adv-x="1408" d="M555 15q74 -32 140 -32q376 0 376 335q0 114 -41 180q-27 44 -61.5 74t-67.5 46.5t-80.5 25t-84 10.5t-94.5 2q-73 0 -101 -10q0 -53 -0.5 -159t-0.5 -158q0 -8 -1 -67.5t-0.5 -96.5t4.5 -83.5t12 -66.5zM541 761q42 -7 109 -7q82 0 143 13t110 44.5t74.5 89.5t25.5 142 q0 70 -29 122.5t-79 82t-108 43.5t-124 14q-50 0 -130 -13q0 -50 4 -151t4 -152q0 -27 -0.5 -80t-0.5 -79q0 -46 1 -69zM0 -128l2 94q15 4 85 16t106 27q7 12 12.5 27t8.5 33.5t5.5 32.5t3 37.5t0.5 34v35.5v30q0 982 -22 1025q-4 8 -22 14.5t-44.5 11t-49.5 7t-48.5 4.5 t-30.5 3l-4 83q98 2 340 11.5t373 9.5q23 0 68.5 -0.5t67.5 -0.5q70 0 136.5 -13t128.5 -42t108 -71t74 -104.5t28 -137.5q0 -52 -16.5 -95.5t-39 -72t-64.5 -57.5t-73 -45t-84 -40q154 -35 256.5 -134t102.5 -248q0 -100 -35 -179.5t-93.5 -130.5t-138 -85.5t-163.5 -48.5 t-176 -14q-44 0 -132 3t-132 3q-106 0 -307 -11t-231 -12z" /> +<glyph unicode="" horiz-adv-x="1024" d="M0 -126l17 85q6 2 81.5 21.5t111.5 37.5q28 35 41 101q1 7 62 289t114 543.5t52 296.5v25q-24 13 -54.5 18.5t-69.5 8t-58 5.5l19 103q33 -2 120 -6.5t149.5 -7t120.5 -2.5q48 0 98.5 2.5t121 7t98.5 6.5q-5 -39 -19 -89q-30 -10 -101.5 -28.5t-108.5 -33.5 q-8 -19 -14 -42.5t-9 -40t-7.5 -45.5t-6.5 -42q-27 -148 -87.5 -419.5t-77.5 -355.5q-2 -9 -13 -58t-20 -90t-16 -83.5t-6 -57.5l1 -18q17 -4 185 -31q-3 -44 -16 -99q-11 0 -32.5 -1.5t-32.5 -1.5q-29 0 -87 10t-86 10q-138 2 -206 2q-51 0 -143 -9t-121 -11z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1744 128q33 0 42 -18.5t-11 -44.5l-126 -162q-20 -26 -49 -26t-49 26l-126 162q-20 26 -11 44.5t42 18.5h80v1024h-80q-33 0 -42 18.5t11 44.5l126 162q20 26 49 26t49 -26l126 -162q20 -26 11 -44.5t-42 -18.5h-80v-1024h80zM81 1407l54 -27q12 -5 211 -5q44 0 132 2 t132 2q36 0 107.5 -0.5t107.5 -0.5h293q6 0 21 -0.5t20.5 0t16 3t17.5 9t15 17.5l42 1q4 0 14 -0.5t14 -0.5q2 -112 2 -336q0 -80 -5 -109q-39 -14 -68 -18q-25 44 -54 128q-3 9 -11 48t-14.5 73.5t-7.5 35.5q-6 8 -12 12.5t-15.5 6t-13 2.5t-18 0.5t-16.5 -0.5 q-17 0 -66.5 0.5t-74.5 0.5t-64 -2t-71 -6q-9 -81 -8 -136q0 -94 2 -388t2 -455q0 -16 -2.5 -71.5t0 -91.5t12.5 -69q40 -21 124 -42.5t120 -37.5q5 -40 5 -50q0 -14 -3 -29l-34 -1q-76 -2 -218 8t-207 10q-50 0 -151 -9t-152 -9q-3 51 -3 52v9q17 27 61.5 43t98.5 29t78 27 q19 42 19 383q0 101 -3 303t-3 303v117q0 2 0.5 15.5t0.5 25t-1 25.5t-3 24t-5 14q-11 12 -162 12q-33 0 -93 -12t-80 -26q-19 -13 -34 -72.5t-31.5 -111t-42.5 -53.5q-42 26 -56 44v383z" /> +<glyph unicode="" d="M81 1407l54 -27q12 -5 211 -5q44 0 132 2t132 2q70 0 246.5 1t304.5 0.5t247 -4.5q33 -1 56 31l42 1q4 0 14 -0.5t14 -0.5q2 -112 2 -336q0 -80 -5 -109q-39 -14 -68 -18q-25 44 -54 128q-3 9 -11 47.5t-15 73.5t-7 36q-10 13 -27 19q-5 2 -66 2q-30 0 -93 1t-103 1 t-94 -2t-96 -7q-9 -81 -8 -136l1 -152v52q0 -55 1 -154t1.5 -180t0.5 -153q0 -16 -2.5 -71.5t0 -91.5t12.5 -69q40 -21 124 -42.5t120 -37.5q5 -40 5 -50q0 -14 -3 -29l-34 -1q-76 -2 -218 8t-207 10q-50 0 -151 -9t-152 -9q-3 51 -3 52v9q17 27 61.5 43t98.5 29t78 27 q7 16 11.5 74t6 145.5t1.5 155t-0.5 153.5t-0.5 89q0 7 -2.5 21.5t-2.5 22.5q0 7 0.5 44t1 73t0 76.5t-3 67.5t-6.5 32q-11 12 -162 12q-41 0 -163 -13.5t-138 -24.5q-19 -12 -34 -71.5t-31.5 -111.5t-42.5 -54q-42 26 -56 44v383zM1310 125q12 0 42 -19.5t57.5 -41.5 t59.5 -49t36 -30q26 -21 26 -49t-26 -49q-4 -3 -36 -30t-59.5 -49t-57.5 -41.5t-42 -19.5q-13 0 -20.5 10.5t-10 28.5t-2.5 33.5t1.5 33t1.5 19.5h-1024q0 -2 1.5 -19.5t1.5 -33t-2.5 -33.5t-10 -28.5t-20.5 -10.5q-12 0 -42 19.5t-57.5 41.5t-59.5 49t-36 30q-26 21 -26 49 t26 49q4 3 36 30t59.5 49t57.5 41.5t42 19.5q13 0 20.5 -10.5t10 -28.5t2.5 -33.5t-1.5 -33t-1.5 -19.5h1024q0 2 -1.5 19.5t-1.5 33t2.5 33.5t10 28.5t20.5 10.5z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1792 192v-128q0 -26 -19 -45t-45 -19h-1664q-26 0 -45 19t-19 45v128q0 26 19 45t45 19h1664q26 0 45 -19t19 -45zM1408 576v-128q0 -26 -19 -45t-45 -19h-1280q-26 0 -45 19t-19 45v128q0 26 19 45t45 19h1280q26 0 45 -19t19 -45zM1664 960v-128q0 -26 -19 -45 t-45 -19h-1536q-26 0 -45 19t-19 45v128q0 26 19 45t45 19h1536q26 0 45 -19t19 -45zM1280 1344v-128q0 -26 -19 -45t-45 -19h-1152q-26 0 -45 19t-19 45v128q0 26 19 45t45 19h1152q26 0 45 -19t19 -45z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1792 192v-128q0 -26 -19 -45t-45 -19h-1664q-26 0 -45 19t-19 45v128q0 26 19 45t45 19h1664q26 0 45 -19t19 -45zM1408 576v-128q0 -26 -19 -45t-45 -19h-896q-26 0 -45 19t-19 45v128q0 26 19 45t45 19h896q26 0 45 -19t19 -45zM1664 960v-128q0 -26 -19 -45t-45 -19 h-1408q-26 0 -45 19t-19 45v128q0 26 19 45t45 19h1408q26 0 45 -19t19 -45zM1280 1344v-128q0 -26 -19 -45t-45 -19h-640q-26 0 -45 19t-19 45v128q0 26 19 45t45 19h640q26 0 45 -19t19 -45z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1792 192v-128q0 -26 -19 -45t-45 -19h-1664q-26 0 -45 19t-19 45v128q0 26 19 45t45 19h1664q26 0 45 -19t19 -45zM1792 576v-128q0 -26 -19 -45t-45 -19h-1280q-26 0 -45 19t-19 45v128q0 26 19 45t45 19h1280q26 0 45 -19t19 -45zM1792 960v-128q0 -26 -19 -45 t-45 -19h-1536q-26 0 -45 19t-19 45v128q0 26 19 45t45 19h1536q26 0 45 -19t19 -45zM1792 1344v-128q0 -26 -19 -45t-45 -19h-1152q-26 0 -45 19t-19 45v128q0 26 19 45t45 19h1152q26 0 45 -19t19 -45z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1792 192v-128q0 -26 -19 -45t-45 -19h-1664q-26 0 -45 19t-19 45v128q0 26 19 45t45 19h1664q26 0 45 -19t19 -45zM1792 576v-128q0 -26 -19 -45t-45 -19h-1664q-26 0 -45 19t-19 45v128q0 26 19 45t45 19h1664q26 0 45 -19t19 -45zM1792 960v-128q0 -26 -19 -45 t-45 -19h-1664q-26 0 -45 19t-19 45v128q0 26 19 45t45 19h1664q26 0 45 -19t19 -45zM1792 1344v-128q0 -26 -19 -45t-45 -19h-1664q-26 0 -45 19t-19 45v128q0 26 19 45t45 19h1664q26 0 45 -19t19 -45z" /> +<glyph unicode="" horiz-adv-x="1792" d="M256 224v-192q0 -13 -9.5 -22.5t-22.5 -9.5h-192q-13 0 -22.5 9.5t-9.5 22.5v192q0 13 9.5 22.5t22.5 9.5h192q13 0 22.5 -9.5t9.5 -22.5zM256 608v-192q0 -13 -9.5 -22.5t-22.5 -9.5h-192q-13 0 -22.5 9.5t-9.5 22.5v192q0 13 9.5 22.5t22.5 9.5h192q13 0 22.5 -9.5 t9.5 -22.5zM256 992v-192q0 -13 -9.5 -22.5t-22.5 -9.5h-192q-13 0 -22.5 9.5t-9.5 22.5v192q0 13 9.5 22.5t22.5 9.5h192q13 0 22.5 -9.5t9.5 -22.5zM1792 224v-192q0 -13 -9.5 -22.5t-22.5 -9.5h-1344q-13 0 -22.5 9.5t-9.5 22.5v192q0 13 9.5 22.5t22.5 9.5h1344 q13 0 22.5 -9.5t9.5 -22.5zM256 1376v-192q0 -13 -9.5 -22.5t-22.5 -9.5h-192q-13 0 -22.5 9.5t-9.5 22.5v192q0 13 9.5 22.5t22.5 9.5h192q13 0 22.5 -9.5t9.5 -22.5zM1792 608v-192q0 -13 -9.5 -22.5t-22.5 -9.5h-1344q-13 0 -22.5 9.5t-9.5 22.5v192q0 13 9.5 22.5 t22.5 9.5h1344q13 0 22.5 -9.5t9.5 -22.5zM1792 992v-192q0 -13 -9.5 -22.5t-22.5 -9.5h-1344q-13 0 -22.5 9.5t-9.5 22.5v192q0 13 9.5 22.5t22.5 9.5h1344q13 0 22.5 -9.5t9.5 -22.5zM1792 1376v-192q0 -13 -9.5 -22.5t-22.5 -9.5h-1344q-13 0 -22.5 9.5t-9.5 22.5v192 q0 13 9.5 22.5t22.5 9.5h1344q13 0 22.5 -9.5t9.5 -22.5z" /> +<glyph unicode="" horiz-adv-x="1792" d="M384 992v-576q0 -13 -9.5 -22.5t-22.5 -9.5q-14 0 -23 9l-288 288q-9 9 -9 23t9 23l288 288q9 9 23 9q13 0 22.5 -9.5t9.5 -22.5zM1792 224v-192q0 -13 -9.5 -22.5t-22.5 -9.5h-1728q-13 0 -22.5 9.5t-9.5 22.5v192q0 13 9.5 22.5t22.5 9.5h1728q13 0 22.5 -9.5 t9.5 -22.5zM1792 608v-192q0 -13 -9.5 -22.5t-22.5 -9.5h-1088q-13 0 -22.5 9.5t-9.5 22.5v192q0 13 9.5 22.5t22.5 9.5h1088q13 0 22.5 -9.5t9.5 -22.5zM1792 992v-192q0 -13 -9.5 -22.5t-22.5 -9.5h-1088q-13 0 -22.5 9.5t-9.5 22.5v192q0 13 9.5 22.5t22.5 9.5h1088 q13 0 22.5 -9.5t9.5 -22.5zM1792 1376v-192q0 -13 -9.5 -22.5t-22.5 -9.5h-1728q-13 0 -22.5 9.5t-9.5 22.5v192q0 13 9.5 22.5t22.5 9.5h1728q13 0 22.5 -9.5t9.5 -22.5z" /> +<glyph unicode="" horiz-adv-x="1792" d="M352 704q0 -14 -9 -23l-288 -288q-9 -9 -23 -9q-13 0 -22.5 9.5t-9.5 22.5v576q0 13 9.5 22.5t22.5 9.5q14 0 23 -9l288 -288q9 -9 9 -23zM1792 224v-192q0 -13 -9.5 -22.5t-22.5 -9.5h-1728q-13 0 -22.5 9.5t-9.5 22.5v192q0 13 9.5 22.5t22.5 9.5h1728q13 0 22.5 -9.5 t9.5 -22.5zM1792 608v-192q0 -13 -9.5 -22.5t-22.5 -9.5h-1088q-13 0 -22.5 9.5t-9.5 22.5v192q0 13 9.5 22.5t22.5 9.5h1088q13 0 22.5 -9.5t9.5 -22.5zM1792 992v-192q0 -13 -9.5 -22.5t-22.5 -9.5h-1088q-13 0 -22.5 9.5t-9.5 22.5v192q0 13 9.5 22.5t22.5 9.5h1088 q13 0 22.5 -9.5t9.5 -22.5zM1792 1376v-192q0 -13 -9.5 -22.5t-22.5 -9.5h-1728q-13 0 -22.5 9.5t-9.5 22.5v192q0 13 9.5 22.5t22.5 9.5h1728q13 0 22.5 -9.5t9.5 -22.5z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1792 1184v-1088q0 -42 -39 -59q-13 -5 -25 -5q-27 0 -45 19l-403 403v-166q0 -119 -84.5 -203.5t-203.5 -84.5h-704q-119 0 -203.5 84.5t-84.5 203.5v704q0 119 84.5 203.5t203.5 84.5h704q119 0 203.5 -84.5t84.5 -203.5v-165l403 402q18 19 45 19q12 0 25 -5 q39 -17 39 -59z" /> +<glyph unicode="" horiz-adv-x="1920" d="M640 960q0 -80 -56 -136t-136 -56t-136 56t-56 136t56 136t136 56t136 -56t56 -136zM1664 576v-448h-1408v192l320 320l160 -160l512 512zM1760 1280h-1600q-13 0 -22.5 -9.5t-9.5 -22.5v-1216q0 -13 9.5 -22.5t22.5 -9.5h1600q13 0 22.5 9.5t9.5 22.5v1216 q0 13 -9.5 22.5t-22.5 9.5zM1920 1248v-1216q0 -66 -47 -113t-113 -47h-1600q-66 0 -113 47t-47 113v1216q0 66 47 113t113 47h1600q66 0 113 -47t47 -113z" /> +<glyph unicode="" d="M363 0l91 91l-235 235l-91 -91v-107h128v-128h107zM886 928q0 22 -22 22q-10 0 -17 -7l-542 -542q-7 -7 -7 -17q0 -22 22 -22q10 0 17 7l542 542q7 7 7 17zM832 1120l416 -416l-832 -832h-416v416zM1515 1024q0 -53 -37 -90l-166 -166l-416 416l166 165q36 38 90 38 q53 0 91 -38l235 -234q37 -39 37 -91z" /> +<glyph unicode="" horiz-adv-x="1024" d="M768 896q0 106 -75 181t-181 75t-181 -75t-75 -181t75 -181t181 -75t181 75t75 181zM1024 896q0 -109 -33 -179l-364 -774q-16 -33 -47.5 -52t-67.5 -19t-67.5 19t-46.5 52l-365 774q-33 70 -33 179q0 212 150 362t362 150t362 -150t150 -362z" /> +<glyph unicode="" d="M768 96v1088q-148 0 -273 -73t-198 -198t-73 -273t73 -273t198 -198t273 -73zM1536 640q0 -209 -103 -385.5t-279.5 -279.5t-385.5 -103t-385.5 103t-279.5 279.5t-103 385.5t103 385.5t279.5 279.5t385.5 103t385.5 -103t279.5 -279.5t103 -385.5z" /> +<glyph unicode="" horiz-adv-x="1024" d="M512 384q0 36 -20 69q-1 1 -15.5 22.5t-25.5 38t-25 44t-21 50.5q-4 16 -21 16t-21 -16q-7 -23 -21 -50.5t-25 -44t-25.5 -38t-15.5 -22.5q-20 -33 -20 -69q0 -53 37.5 -90.5t90.5 -37.5t90.5 37.5t37.5 90.5zM1024 512q0 -212 -150 -362t-362 -150t-362 150t-150 362 q0 145 81 275q6 9 62.5 90.5t101 151t99.5 178t83 201.5q9 30 34 47t51 17t51.5 -17t33.5 -47q28 -93 83 -201.5t99.5 -178t101 -151t62.5 -90.5q81 -127 81 -275z" /> +<glyph unicode="" horiz-adv-x="1792" d="M888 352l116 116l-152 152l-116 -116v-56h96v-96h56zM1328 1072q-16 16 -33 -1l-350 -350q-17 -17 -1 -33t33 1l350 350q17 17 1 33zM1408 478v-190q0 -119 -84.5 -203.5t-203.5 -84.5h-832q-119 0 -203.5 84.5t-84.5 203.5v832q0 119 84.5 203.5t203.5 84.5h832 q63 0 117 -25q15 -7 18 -23q3 -17 -9 -29l-49 -49q-14 -14 -32 -8q-23 6 -45 6h-832q-66 0 -113 -47t-47 -113v-832q0 -66 47 -113t113 -47h832q66 0 113 47t47 113v126q0 13 9 22l64 64q15 15 35 7t20 -29zM1312 1216l288 -288l-672 -672h-288v288zM1756 1084l-92 -92 l-288 288l92 92q28 28 68 28t68 -28l152 -152q28 -28 28 -68t-28 -68z" /> +<glyph unicode="" horiz-adv-x="1664" d="M1408 547v-259q0 -119 -84.5 -203.5t-203.5 -84.5h-832q-119 0 -203.5 84.5t-84.5 203.5v832q0 119 84.5 203.5t203.5 84.5h255v0q13 0 22.5 -9.5t9.5 -22.5q0 -27 -26 -32q-77 -26 -133 -60q-10 -4 -16 -4h-112q-66 0 -113 -47t-47 -113v-832q0 -66 47 -113t113 -47h832 q66 0 113 47t47 113v214q0 19 18 29q28 13 54 37q16 16 35 8q21 -9 21 -29zM1645 1043l-384 -384q-18 -19 -45 -19q-12 0 -25 5q-39 17 -39 59v192h-160q-323 0 -438 -131q-119 -137 -74 -473q3 -23 -20 -34q-8 -2 -12 -2q-16 0 -26 13q-10 14 -21 31t-39.5 68.5t-49.5 99.5 t-38.5 114t-17.5 122q0 49 3.5 91t14 90t28 88t47 81.5t68.5 74t94.5 61.5t124.5 48.5t159.5 30.5t196.5 11h160v192q0 42 39 59q13 5 25 5q26 0 45 -19l384 -384q19 -19 19 -45t-19 -45z" /> +<glyph unicode="" horiz-adv-x="1664" d="M1408 606v-318q0 -119 -84.5 -203.5t-203.5 -84.5h-832q-119 0 -203.5 84.5t-84.5 203.5v832q0 119 84.5 203.5t203.5 84.5h832q63 0 117 -25q15 -7 18 -23q3 -17 -9 -29l-49 -49q-10 -10 -23 -10q-3 0 -9 2q-23 6 -45 6h-832q-66 0 -113 -47t-47 -113v-832 q0 -66 47 -113t113 -47h832q66 0 113 47t47 113v254q0 13 9 22l64 64q10 10 23 10q6 0 12 -3q20 -8 20 -29zM1639 1095l-814 -814q-24 -24 -57 -24t-57 24l-430 430q-24 24 -24 57t24 57l110 110q24 24 57 24t57 -24l263 -263l647 647q24 24 57 24t57 -24l110 -110 q24 -24 24 -57t-24 -57z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1792 640q0 -26 -19 -45l-256 -256q-19 -19 -45 -19t-45 19t-19 45v128h-384v-384h128q26 0 45 -19t19 -45t-19 -45l-256 -256q-19 -19 -45 -19t-45 19l-256 256q-19 19 -19 45t19 45t45 19h128v384h-384v-128q0 -26 -19 -45t-45 -19t-45 19l-256 256q-19 19 -19 45 t19 45l256 256q19 19 45 19t45 -19t19 -45v-128h384v384h-128q-26 0 -45 19t-19 45t19 45l256 256q19 19 45 19t45 -19l256 -256q19 -19 19 -45t-19 -45t-45 -19h-128v-384h384v128q0 26 19 45t45 19t45 -19l256 -256q19 -19 19 -45z" /> +<glyph unicode="" horiz-adv-x="1024" d="M979 1395q19 19 32 13t13 -32v-1472q0 -26 -13 -32t-32 13l-710 710q-9 9 -13 19v-678q0 -26 -19 -45t-45 -19h-128q-26 0 -45 19t-19 45v1408q0 26 19 45t45 19h128q26 0 45 -19t19 -45v-678q4 11 13 19z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1747 1395q19 19 32 13t13 -32v-1472q0 -26 -13 -32t-32 13l-710 710q-9 9 -13 19v-710q0 -26 -13 -32t-32 13l-710 710q-9 9 -13 19v-678q0 -26 -19 -45t-45 -19h-128q-26 0 -45 19t-19 45v1408q0 26 19 45t45 19h128q26 0 45 -19t19 -45v-678q4 11 13 19l710 710 q19 19 32 13t13 -32v-710q4 11 13 19z" /> +<glyph unicode="" horiz-adv-x="1664" d="M1619 1395q19 19 32 13t13 -32v-1472q0 -26 -13 -32t-32 13l-710 710q-8 9 -13 19v-710q0 -26 -13 -32t-32 13l-710 710q-19 19 -19 45t19 45l710 710q19 19 32 13t13 -32v-710q5 11 13 19z" /> +<glyph unicode="" horiz-adv-x="1408" d="M1384 609l-1328 -738q-23 -13 -39.5 -3t-16.5 36v1472q0 26 16.5 36t39.5 -3l1328 -738q23 -13 23 -31t-23 -31z" /> +<glyph unicode="" d="M1536 1344v-1408q0 -26 -19 -45t-45 -19h-512q-26 0 -45 19t-19 45v1408q0 26 19 45t45 19h512q26 0 45 -19t19 -45zM640 1344v-1408q0 -26 -19 -45t-45 -19h-512q-26 0 -45 19t-19 45v1408q0 26 19 45t45 19h512q26 0 45 -19t19 -45z" /> +<glyph unicode="" d="M1536 1344v-1408q0 -26 -19 -45t-45 -19h-1408q-26 0 -45 19t-19 45v1408q0 26 19 45t45 19h1408q26 0 45 -19t19 -45z" /> +<glyph unicode="" horiz-adv-x="1664" d="M45 -115q-19 -19 -32 -13t-13 32v1472q0 26 13 32t32 -13l710 -710q8 -8 13 -19v710q0 26 13 32t32 -13l710 -710q19 -19 19 -45t-19 -45l-710 -710q-19 -19 -32 -13t-13 32v710q-5 -10 -13 -19z" /> +<glyph unicode="" horiz-adv-x="1792" d="M45 -115q-19 -19 -32 -13t-13 32v1472q0 26 13 32t32 -13l710 -710q8 -8 13 -19v710q0 26 13 32t32 -13l710 -710q8 -8 13 -19v678q0 26 19 45t45 19h128q26 0 45 -19t19 -45v-1408q0 -26 -19 -45t-45 -19h-128q-26 0 -45 19t-19 45v678q-5 -10 -13 -19l-710 -710 q-19 -19 -32 -13t-13 32v710q-5 -10 -13 -19z" /> +<glyph unicode="" horiz-adv-x="1024" d="M45 -115q-19 -19 -32 -13t-13 32v1472q0 26 13 32t32 -13l710 -710q8 -8 13 -19v678q0 26 19 45t45 19h128q26 0 45 -19t19 -45v-1408q0 -26 -19 -45t-45 -19h-128q-26 0 -45 19t-19 45v678q-5 -10 -13 -19z" /> +<glyph unicode="" horiz-adv-x="1538" d="M14 557l710 710q19 19 45 19t45 -19l710 -710q19 -19 13 -32t-32 -13h-1472q-26 0 -32 13t13 32zM1473 0h-1408q-26 0 -45 19t-19 45v256q0 26 19 45t45 19h1408q26 0 45 -19t19 -45v-256q0 -26 -19 -45t-45 -19z" /> +<glyph unicode="" horiz-adv-x="1280" d="M1171 1235l-531 -531l531 -531q19 -19 19 -45t-19 -45l-166 -166q-19 -19 -45 -19t-45 19l-742 742q-19 19 -19 45t19 45l742 742q19 19 45 19t45 -19l166 -166q19 -19 19 -45t-19 -45z" /> +<glyph unicode="" horiz-adv-x="1280" d="M1107 659l-742 -742q-19 -19 -45 -19t-45 19l-166 166q-19 19 -19 45t19 45l531 531l-531 531q-19 19 -19 45t19 45l166 166q19 19 45 19t45 -19l742 -742q19 -19 19 -45t-19 -45z" /> +<glyph unicode="" d="M1216 576v128q0 26 -19 45t-45 19h-256v256q0 26 -19 45t-45 19h-128q-26 0 -45 -19t-19 -45v-256h-256q-26 0 -45 -19t-19 -45v-128q0 -26 19 -45t45 -19h256v-256q0 -26 19 -45t45 -19h128q26 0 45 19t19 45v256h256q26 0 45 19t19 45zM1536 640q0 -209 -103 -385.5 t-279.5 -279.5t-385.5 -103t-385.5 103t-279.5 279.5t-103 385.5t103 385.5t279.5 279.5t385.5 103t385.5 -103t279.5 -279.5t103 -385.5z" /> +<glyph unicode="" d="M1216 576v128q0 26 -19 45t-45 19h-768q-26 0 -45 -19t-19 -45v-128q0 -26 19 -45t45 -19h768q26 0 45 19t19 45zM1536 640q0 -209 -103 -385.5t-279.5 -279.5t-385.5 -103t-385.5 103t-279.5 279.5t-103 385.5t103 385.5t279.5 279.5t385.5 103t385.5 -103t279.5 -279.5 t103 -385.5z" /> +<glyph unicode="" d="M1149 414q0 26 -19 45l-181 181l181 181q19 19 19 45q0 27 -19 46l-90 90q-19 19 -46 19q-26 0 -45 -19l-181 -181l-181 181q-19 19 -45 19q-27 0 -46 -19l-90 -90q-19 -19 -19 -46q0 -26 19 -45l181 -181l-181 -181q-19 -19 -19 -45q0 -27 19 -46l90 -90q19 -19 46 -19 q26 0 45 19l181 181l181 -181q19 -19 45 -19q27 0 46 19l90 90q19 19 19 46zM1536 640q0 -209 -103 -385.5t-279.5 -279.5t-385.5 -103t-385.5 103t-279.5 279.5t-103 385.5t103 385.5t279.5 279.5t385.5 103t385.5 -103t279.5 -279.5t103 -385.5z" /> +<glyph unicode="" d="M1284 802q0 28 -18 46l-91 90q-19 19 -45 19t-45 -19l-408 -407l-226 226q-19 19 -45 19t-45 -19l-91 -90q-18 -18 -18 -46q0 -27 18 -45l362 -362q19 -19 45 -19q27 0 46 19l543 543q18 18 18 45zM1536 640q0 -209 -103 -385.5t-279.5 -279.5t-385.5 -103t-385.5 103 t-279.5 279.5t-103 385.5t103 385.5t279.5 279.5t385.5 103t385.5 -103t279.5 -279.5t103 -385.5z" /> +<glyph unicode="" d="M896 160v192q0 14 -9 23t-23 9h-192q-14 0 -23 -9t-9 -23v-192q0 -14 9 -23t23 -9h192q14 0 23 9t9 23zM1152 832q0 88 -55.5 163t-138.5 116t-170 41q-243 0 -371 -213q-15 -24 8 -42l132 -100q7 -6 19 -6q16 0 25 12q53 68 86 92q34 24 86 24q48 0 85.5 -26t37.5 -59 q0 -38 -20 -61t-68 -45q-63 -28 -115.5 -86.5t-52.5 -125.5v-36q0 -14 9 -23t23 -9h192q14 0 23 9t9 23q0 19 21.5 49.5t54.5 49.5q32 18 49 28.5t46 35t44.5 48t28 60.5t12.5 81zM1536 640q0 -209 -103 -385.5t-279.5 -279.5t-385.5 -103t-385.5 103t-279.5 279.5 t-103 385.5t103 385.5t279.5 279.5t385.5 103t385.5 -103t279.5 -279.5t103 -385.5z" /> +<glyph unicode="" d="M1024 160v160q0 14 -9 23t-23 9h-96v512q0 14 -9 23t-23 9h-320q-14 0 -23 -9t-9 -23v-160q0 -14 9 -23t23 -9h96v-320h-96q-14 0 -23 -9t-9 -23v-160q0 -14 9 -23t23 -9h448q14 0 23 9t9 23zM896 1056v160q0 14 -9 23t-23 9h-192q-14 0 -23 -9t-9 -23v-160q0 -14 9 -23 t23 -9h192q14 0 23 9t9 23zM1536 640q0 -209 -103 -385.5t-279.5 -279.5t-385.5 -103t-385.5 103t-279.5 279.5t-103 385.5t103 385.5t279.5 279.5t385.5 103t385.5 -103t279.5 -279.5t103 -385.5z" /> +<glyph unicode="" d="M1197 512h-109q-26 0 -45 19t-19 45v128q0 26 19 45t45 19h109q-32 108 -112.5 188.5t-188.5 112.5v-109q0 -26 -19 -45t-45 -19h-128q-26 0 -45 19t-19 45v109q-108 -32 -188.5 -112.5t-112.5 -188.5h109q26 0 45 -19t19 -45v-128q0 -26 -19 -45t-45 -19h-109 q32 -108 112.5 -188.5t188.5 -112.5v109q0 26 19 45t45 19h128q26 0 45 -19t19 -45v-109q108 32 188.5 112.5t112.5 188.5zM1536 704v-128q0 -26 -19 -45t-45 -19h-143q-37 -161 -154.5 -278.5t-278.5 -154.5v-143q0 -26 -19 -45t-45 -19h-128q-26 0 -45 19t-19 45v143 q-161 37 -278.5 154.5t-154.5 278.5h-143q-26 0 -45 19t-19 45v128q0 26 19 45t45 19h143q37 161 154.5 278.5t278.5 154.5v143q0 26 19 45t45 19h128q26 0 45 -19t19 -45v-143q161 -37 278.5 -154.5t154.5 -278.5h143q26 0 45 -19t19 -45z" /> +<glyph unicode="" d="M1097 457l-146 -146q-10 -10 -23 -10t-23 10l-137 137l-137 -137q-10 -10 -23 -10t-23 10l-146 146q-10 10 -10 23t10 23l137 137l-137 137q-10 10 -10 23t10 23l146 146q10 10 23 10t23 -10l137 -137l137 137q10 10 23 10t23 -10l146 -146q10 -10 10 -23t-10 -23 l-137 -137l137 -137q10 -10 10 -23t-10 -23zM1312 640q0 148 -73 273t-198 198t-273 73t-273 -73t-198 -198t-73 -273t73 -273t198 -198t273 -73t273 73t198 198t73 273zM1536 640q0 -209 -103 -385.5t-279.5 -279.5t-385.5 -103t-385.5 103t-279.5 279.5t-103 385.5 t103 385.5t279.5 279.5t385.5 103t385.5 -103t279.5 -279.5t103 -385.5z" /> +<glyph unicode="" d="M1171 723l-422 -422q-19 -19 -45 -19t-45 19l-294 294q-19 19 -19 45t19 45l102 102q19 19 45 19t45 -19l147 -147l275 275q19 19 45 19t45 -19l102 -102q19 -19 19 -45t-19 -45zM1312 640q0 148 -73 273t-198 198t-273 73t-273 -73t-198 -198t-73 -273t73 -273t198 -198 t273 -73t273 73t198 198t73 273zM1536 640q0 -209 -103 -385.5t-279.5 -279.5t-385.5 -103t-385.5 103t-279.5 279.5t-103 385.5t103 385.5t279.5 279.5t385.5 103t385.5 -103t279.5 -279.5t103 -385.5z" /> +<glyph unicode="" d="M1312 643q0 161 -87 295l-754 -753q137 -89 297 -89q111 0 211.5 43.5t173.5 116.5t116 174.5t43 212.5zM313 344l755 754q-135 91 -300 91q-148 0 -273 -73t-198 -199t-73 -274q0 -162 89 -299zM1536 643q0 -157 -61 -300t-163.5 -246t-245 -164t-298.5 -61t-298.5 61 t-245 164t-163.5 246t-61 300t61 299.5t163.5 245.5t245 164t298.5 61t298.5 -61t245 -164t163.5 -245.5t61 -299.5z" /> +<glyph unicode="" d="M1536 640v-128q0 -53 -32.5 -90.5t-84.5 -37.5h-704l293 -294q38 -36 38 -90t-38 -90l-75 -76q-37 -37 -90 -37q-52 0 -91 37l-651 652q-37 37 -37 90q0 52 37 91l651 650q38 38 91 38q52 0 90 -38l75 -74q38 -38 38 -91t-38 -91l-293 -293h704q52 0 84.5 -37.5 t32.5 -90.5z" /> +<glyph unicode="" d="M1472 576q0 -54 -37 -91l-651 -651q-39 -37 -91 -37q-51 0 -90 37l-75 75q-38 38 -38 91t38 91l293 293h-704q-52 0 -84.5 37.5t-32.5 90.5v128q0 53 32.5 90.5t84.5 37.5h704l-293 294q-38 36 -38 90t38 90l75 75q38 38 90 38q53 0 91 -38l651 -651q37 -35 37 -90z" /> +<glyph unicode="" horiz-adv-x="1664" d="M1611 565q0 -51 -37 -90l-75 -75q-38 -38 -91 -38q-54 0 -90 38l-294 293v-704q0 -52 -37.5 -84.5t-90.5 -32.5h-128q-53 0 -90.5 32.5t-37.5 84.5v704l-294 -293q-36 -38 -90 -38t-90 38l-75 75q-38 38 -38 90q0 53 38 91l651 651q35 37 90 37q54 0 91 -37l651 -651 q37 -39 37 -91z" /> +<glyph unicode="" horiz-adv-x="1664" d="M1611 704q0 -53 -37 -90l-651 -652q-39 -37 -91 -37q-53 0 -90 37l-651 652q-38 36 -38 90q0 53 38 91l74 75q39 37 91 37q53 0 90 -37l294 -294v704q0 52 38 90t90 38h128q52 0 90 -38t38 -90v-704l294 294q37 37 90 37q52 0 91 -37l75 -75q37 -39 37 -91z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1792 896q0 -26 -19 -45l-512 -512q-19 -19 -45 -19t-45 19t-19 45v256h-224q-98 0 -175.5 -6t-154 -21.5t-133 -42.5t-105.5 -69.5t-80 -101t-48.5 -138.5t-17.5 -181q0 -55 5 -123q0 -6 2.5 -23.5t2.5 -26.5q0 -15 -8.5 -25t-23.5 -10q-16 0 -28 17q-7 9 -13 22 t-13.5 30t-10.5 24q-127 285 -127 451q0 199 53 333q162 403 875 403h224v256q0 26 19 45t45 19t45 -19l512 -512q19 -19 19 -45z" /> +<glyph unicode="" d="M755 480q0 -13 -10 -23l-332 -332l144 -144q19 -19 19 -45t-19 -45t-45 -19h-448q-26 0 -45 19t-19 45v448q0 26 19 45t45 19t45 -19l144 -144l332 332q10 10 23 10t23 -10l114 -114q10 -10 10 -23zM1536 1344v-448q0 -26 -19 -45t-45 -19t-45 19l-144 144l-332 -332 q-10 -10 -23 -10t-23 10l-114 114q-10 10 -10 23t10 23l332 332l-144 144q-19 19 -19 45t19 45t45 19h448q26 0 45 -19t19 -45z" /> +<glyph unicode="" d="M768 576v-448q0 -26 -19 -45t-45 -19t-45 19l-144 144l-332 -332q-10 -10 -23 -10t-23 10l-114 114q-10 10 -10 23t10 23l332 332l-144 144q-19 19 -19 45t19 45t45 19h448q26 0 45 -19t19 -45zM1523 1248q0 -13 -10 -23l-332 -332l144 -144q19 -19 19 -45t-19 -45 t-45 -19h-448q-26 0 -45 19t-19 45v448q0 26 19 45t45 19t45 -19l144 -144l332 332q10 10 23 10t23 -10l114 -114q10 -10 10 -23z" /> +<glyph unicode="" horiz-adv-x="1408" d="M1408 800v-192q0 -40 -28 -68t-68 -28h-416v-416q0 -40 -28 -68t-68 -28h-192q-40 0 -68 28t-28 68v416h-416q-40 0 -68 28t-28 68v192q0 40 28 68t68 28h416v416q0 40 28 68t68 28h192q40 0 68 -28t28 -68v-416h416q40 0 68 -28t28 -68z" /> +<glyph unicode="" horiz-adv-x="1408" d="M1408 800v-192q0 -40 -28 -68t-68 -28h-1216q-40 0 -68 28t-28 68v192q0 40 28 68t68 28h1216q40 0 68 -28t28 -68z" /> +<glyph unicode="" horiz-adv-x="1664" d="M1482 486q46 -26 59.5 -77.5t-12.5 -97.5l-64 -110q-26 -46 -77.5 -59.5t-97.5 12.5l-266 153v-307q0 -52 -38 -90t-90 -38h-128q-52 0 -90 38t-38 90v307l-266 -153q-46 -26 -97.5 -12.5t-77.5 59.5l-64 110q-26 46 -12.5 97.5t59.5 77.5l266 154l-266 154 q-46 26 -59.5 77.5t12.5 97.5l64 110q26 46 77.5 59.5t97.5 -12.5l266 -153v307q0 52 38 90t90 38h128q52 0 90 -38t38 -90v-307l266 153q46 26 97.5 12.5t77.5 -59.5l64 -110q26 -46 12.5 -97.5t-59.5 -77.5l-266 -154z" /> +<glyph unicode="" d="M768 1408q209 0 385.5 -103t279.5 -279.5t103 -385.5t-103 -385.5t-279.5 -279.5t-385.5 -103t-385.5 103t-279.5 279.5t-103 385.5t103 385.5t279.5 279.5t385.5 103zM896 161v190q0 14 -9 23.5t-22 9.5h-192q-13 0 -23 -10t-10 -23v-190q0 -13 10 -23t23 -10h192 q13 0 22 9.5t9 23.5zM894 505l18 621q0 12 -10 18q-10 8 -24 8h-220q-14 0 -24 -8q-10 -6 -10 -18l17 -621q0 -10 10 -17.5t24 -7.5h185q14 0 23.5 7.5t10.5 17.5z" /> +<glyph unicode="" d="M928 180v56v468v192h-320v-192v-468v-56q0 -25 18 -38.5t46 -13.5h192q28 0 46 13.5t18 38.5zM472 1024h195l-126 161q-26 31 -69 31q-40 0 -68 -28t-28 -68t28 -68t68 -28zM1160 1120q0 40 -28 68t-68 28q-43 0 -69 -31l-125 -161h194q40 0 68 28t28 68zM1536 864v-320 q0 -14 -9 -23t-23 -9h-96v-416q0 -40 -28 -68t-68 -28h-1088q-40 0 -68 28t-28 68v416h-96q-14 0 -23 9t-9 23v320q0 14 9 23t23 9h440q-93 0 -158.5 65.5t-65.5 158.5t65.5 158.5t158.5 65.5q107 0 168 -77l128 -165l128 165q61 77 168 77q93 0 158.5 -65.5t65.5 -158.5 t-65.5 -158.5t-158.5 -65.5h440q14 0 23 -9t9 -23z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1280 832q0 26 -19 45t-45 19q-172 0 -318 -49.5t-259.5 -134t-235.5 -219.5q-19 -21 -19 -45q0 -26 19 -45t45 -19q24 0 45 19q27 24 74 71t67 66q137 124 268.5 176t313.5 52q26 0 45 19t19 45zM1792 1030q0 -95 -20 -193q-46 -224 -184.5 -383t-357.5 -268 q-214 -108 -438 -108q-148 0 -286 47q-15 5 -88 42t-96 37q-16 0 -39.5 -32t-45 -70t-52.5 -70t-60 -32q-30 0 -51 11t-31 24t-27 42q-2 4 -6 11t-5.5 10t-3 9.5t-1.5 13.5q0 35 31 73.5t68 65.5t68 56t31 48q0 4 -14 38t-16 44q-9 51 -9 104q0 115 43.5 220t119 184.5 t170.5 139t204 95.5q55 18 145 25.5t179.5 9t178.5 6t163.5 24t113.5 56.5l29.5 29.5t29.5 28t27 20t36.5 16t43.5 4.5q39 0 70.5 -46t47.5 -112t24 -124t8 -96z" /> +<glyph unicode="" horiz-adv-x="1408" d="M1408 -160v-64q0 -13 -9.5 -22.5t-22.5 -9.5h-1344q-13 0 -22.5 9.5t-9.5 22.5v64q0 13 9.5 22.5t22.5 9.5h1344q13 0 22.5 -9.5t9.5 -22.5zM1152 896q0 -78 -24.5 -144t-64 -112.5t-87.5 -88t-96 -77.5t-87.5 -72t-64 -81.5t-24.5 -96.5q0 -96 67 -224l-4 1l1 -1 q-90 41 -160 83t-138.5 100t-113.5 122.5t-72.5 150.5t-27.5 184q0 78 24.5 144t64 112.5t87.5 88t96 77.5t87.5 72t64 81.5t24.5 96.5q0 94 -66 224l3 -1l-1 1q90 -41 160 -83t138.5 -100t113.5 -122.5t72.5 -150.5t27.5 -184z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1664 576q-152 236 -381 353q61 -104 61 -225q0 -185 -131.5 -316.5t-316.5 -131.5t-316.5 131.5t-131.5 316.5q0 121 61 225q-229 -117 -381 -353q133 -205 333.5 -326.5t434.5 -121.5t434.5 121.5t333.5 326.5zM944 960q0 20 -14 34t-34 14q-125 0 -214.5 -89.5 t-89.5 -214.5q0 -20 14 -34t34 -14t34 14t14 34q0 86 61 147t147 61q20 0 34 14t14 34zM1792 576q0 -34 -20 -69q-140 -230 -376.5 -368.5t-499.5 -138.5t-499.5 139t-376.5 368q-20 35 -20 69t20 69q140 229 376.5 368t499.5 139t499.5 -139t376.5 -368q20 -35 20 -69z" /> +<glyph unicode="" horiz-adv-x="1792" d="M555 201l78 141q-87 63 -136 159t-49 203q0 121 61 225q-229 -117 -381 -353q167 -258 427 -375zM944 960q0 20 -14 34t-34 14q-125 0 -214.5 -89.5t-89.5 -214.5q0 -20 14 -34t34 -14t34 14t14 34q0 86 61 147t147 61q20 0 34 14t14 34zM1307 1151q0 -7 -1 -9 q-105 -188 -315 -566t-316 -567l-49 -89q-10 -16 -28 -16q-12 0 -134 70q-16 10 -16 28q0 12 44 87q-143 65 -263.5 173t-208.5 245q-20 31 -20 69t20 69q153 235 380 371t496 136q89 0 180 -17l54 97q10 16 28 16q5 0 18 -6t31 -15.5t33 -18.5t31.5 -18.5t19.5 -11.5 q16 -10 16 -27zM1344 704q0 -139 -79 -253.5t-209 -164.5l280 502q8 -45 8 -84zM1792 576q0 -35 -20 -69q-39 -64 -109 -145q-150 -172 -347.5 -267t-419.5 -95l74 132q212 18 392.5 137t301.5 307q-115 179 -282 294l63 112q95 -64 182.5 -153t144.5 -184q20 -34 20 -69z " /> +<glyph unicode="" horiz-adv-x="1792" d="M1024 161v190q0 14 -9.5 23.5t-22.5 9.5h-192q-13 0 -22.5 -9.5t-9.5 -23.5v-190q0 -14 9.5 -23.5t22.5 -9.5h192q13 0 22.5 9.5t9.5 23.5zM1022 535l18 459q0 12 -10 19q-13 11 -24 11h-220q-11 0 -24 -11q-10 -7 -10 -21l17 -457q0 -10 10 -16.5t24 -6.5h185 q14 0 23.5 6.5t10.5 16.5zM1008 1469l768 -1408q35 -63 -2 -126q-17 -29 -46.5 -46t-63.5 -17h-1536q-34 0 -63.5 17t-46.5 46q-37 63 -2 126l768 1408q17 31 47 49t65 18t65 -18t47 -49z" /> +<glyph unicode="" horiz-adv-x="1408" d="M1376 1376q44 -52 12 -148t-108 -172l-161 -161l160 -696q5 -19 -12 -33l-128 -96q-7 -6 -19 -6q-4 0 -7 1q-15 3 -21 16l-279 508l-259 -259l53 -194q5 -17 -8 -31l-96 -96q-9 -9 -23 -9h-2q-15 2 -24 13l-189 252l-252 189q-11 7 -13 23q-1 13 9 25l96 97q9 9 23 9 q6 0 8 -1l194 -53l259 259l-508 279q-14 8 -17 24q-2 16 9 27l128 128q14 13 30 8l665 -159l160 160q76 76 172 108t148 -12z" /> +<glyph unicode="" horiz-adv-x="1664" d="M128 -128h288v288h-288v-288zM480 -128h320v288h-320v-288zM128 224h288v320h-288v-320zM480 224h320v320h-320v-320zM128 608h288v288h-288v-288zM864 -128h320v288h-320v-288zM480 608h320v288h-320v-288zM1248 -128h288v288h-288v-288zM864 224h320v320h-320v-320z M512 1088v288q0 13 -9.5 22.5t-22.5 9.5h-64q-13 0 -22.5 -9.5t-9.5 -22.5v-288q0 -13 9.5 -22.5t22.5 -9.5h64q13 0 22.5 9.5t9.5 22.5zM1248 224h288v320h-288v-320zM864 608h320v288h-320v-288zM1248 608h288v288h-288v-288zM1280 1088v288q0 13 -9.5 22.5t-22.5 9.5h-64 q-13 0 -22.5 -9.5t-9.5 -22.5v-288q0 -13 9.5 -22.5t22.5 -9.5h64q13 0 22.5 9.5t9.5 22.5zM1664 1152v-1280q0 -52 -38 -90t-90 -38h-1408q-52 0 -90 38t-38 90v1280q0 52 38 90t90 38h128v96q0 66 47 113t113 47h64q66 0 113 -47t47 -113v-96h384v96q0 66 47 113t113 47 h64q66 0 113 -47t47 -113v-96h128q52 0 90 -38t38 -90z" /> +<glyph unicode="" horiz-adv-x="1792" d="M666 1055q-60 -92 -137 -273q-22 45 -37 72.5t-40.5 63.5t-51 56.5t-63 35t-81.5 14.5h-224q-14 0 -23 9t-9 23v192q0 14 9 23t23 9h224q250 0 410 -225zM1792 256q0 -14 -9 -23l-320 -320q-9 -9 -23 -9q-13 0 -22.5 9.5t-9.5 22.5v192q-32 0 -85 -0.5t-81 -1t-73 1 t-71 5t-64 10.5t-63 18.5t-58 28.5t-59 40t-55 53.5t-56 69.5q59 93 136 273q22 -45 37 -72.5t40.5 -63.5t51 -56.5t63 -35t81.5 -14.5h256v192q0 14 9 23t23 9q12 0 24 -10l319 -319q9 -9 9 -23zM1792 1152q0 -14 -9 -23l-320 -320q-9 -9 -23 -9q-13 0 -22.5 9.5t-9.5 22.5 v192h-256q-48 0 -87 -15t-69 -45t-51 -61.5t-45 -77.5q-32 -62 -78 -171q-29 -66 -49.5 -111t-54 -105t-64 -100t-74 -83t-90 -68.5t-106.5 -42t-128 -16.5h-224q-14 0 -23 9t-9 23v192q0 14 9 23t23 9h224q48 0 87 15t69 45t51 61.5t45 77.5q32 62 78 171q29 66 49.5 111 t54 105t64 100t74 83t90 68.5t106.5 42t128 16.5h256v192q0 14 9 23t23 9q12 0 24 -10l319 -319q9 -9 9 -23z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1792 640q0 -174 -120 -321.5t-326 -233t-450 -85.5q-70 0 -145 8q-198 -175 -460 -242q-49 -14 -114 -22q-17 -2 -30.5 9t-17.5 29v1q-3 4 -0.5 12t2 10t4.5 9.5l6 9t7 8.5t8 9q7 8 31 34.5t34.5 38t31 39.5t32.5 51t27 59t26 76q-157 89 -247.5 220t-90.5 281 q0 130 71 248.5t191 204.5t286 136.5t348 50.5q244 0 450 -85.5t326 -233t120 -321.5z" /> +<glyph unicode="" d="M1536 704v-128q0 -201 -98.5 -362t-274 -251.5t-395.5 -90.5t-395.5 90.5t-274 251.5t-98.5 362v128q0 26 19 45t45 19h384q26 0 45 -19t19 -45v-128q0 -52 23.5 -90t53.5 -57t71 -30t64 -13t44 -2t44 2t64 13t71 30t53.5 57t23.5 90v128q0 26 19 45t45 19h384 q26 0 45 -19t19 -45zM512 1344v-384q0 -26 -19 -45t-45 -19h-384q-26 0 -45 19t-19 45v384q0 26 19 45t45 19h384q26 0 45 -19t19 -45zM1536 1344v-384q0 -26 -19 -45t-45 -19h-384q-26 0 -45 19t-19 45v384q0 26 19 45t45 19h384q26 0 45 -19t19 -45z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1683 205l-166 -165q-19 -19 -45 -19t-45 19l-531 531l-531 -531q-19 -19 -45 -19t-45 19l-166 165q-19 19 -19 45.5t19 45.5l742 741q19 19 45 19t45 -19l742 -741q19 -19 19 -45.5t-19 -45.5z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1683 728l-742 -741q-19 -19 -45 -19t-45 19l-742 741q-19 19 -19 45.5t19 45.5l166 165q19 19 45 19t45 -19l531 -531l531 531q19 19 45 19t45 -19l166 -165q19 -19 19 -45.5t-19 -45.5z" /> +<glyph unicode="" horiz-adv-x="1920" d="M1280 32q0 -13 -9.5 -22.5t-22.5 -9.5h-960q-8 0 -13.5 2t-9 7t-5.5 8t-3 11.5t-1 11.5v13v11v160v416h-192q-26 0 -45 19t-19 45q0 24 15 41l320 384q19 22 49 22t49 -22l320 -384q15 -17 15 -41q0 -26 -19 -45t-45 -19h-192v-384h576q16 0 25 -11l160 -192q7 -11 7 -21 zM1920 448q0 -24 -15 -41l-320 -384q-20 -23 -49 -23t-49 23l-320 384q-15 17 -15 41q0 26 19 45t45 19h192v384h-576q-16 0 -25 12l-160 192q-7 9 -7 20q0 13 9.5 22.5t22.5 9.5h960q8 0 13.5 -2t9 -7t5.5 -8t3 -11.5t1 -11.5v-13v-11v-160v-416h192q26 0 45 -19t19 -45z " /> +<glyph unicode="" horiz-adv-x="1664" d="M640 0q0 -52 -38 -90t-90 -38t-90 38t-38 90t38 90t90 38t90 -38t38 -90zM1536 0q0 -52 -38 -90t-90 -38t-90 38t-38 90t38 90t90 38t90 -38t38 -90zM1664 1088v-512q0 -24 -16.5 -42.5t-40.5 -21.5l-1044 -122q13 -60 13 -70q0 -16 -24 -64h920q26 0 45 -19t19 -45 t-19 -45t-45 -19h-1024q-26 0 -45 19t-19 45q0 11 8 31.5t16 36t21.5 40t15.5 29.5l-177 823h-204q-26 0 -45 19t-19 45t19 45t45 19h256q16 0 28.5 -6.5t19.5 -15.5t13 -24.5t8 -26t5.5 -29.5t4.5 -26h1201q26 0 45 -19t19 -45z" /> +<glyph unicode="" horiz-adv-x="1664" d="M1664 928v-704q0 -92 -66 -158t-158 -66h-1216q-92 0 -158 66t-66 158v960q0 92 66 158t158 66h320q92 0 158 -66t66 -158v-32h672q92 0 158 -66t66 -158z" /> +<glyph unicode="" horiz-adv-x="1920" d="M1879 584q0 -31 -31 -66l-336 -396q-43 -51 -120.5 -86.5t-143.5 -35.5h-1088q-34 0 -60.5 13t-26.5 43q0 31 31 66l336 396q43 51 120.5 86.5t143.5 35.5h1088q34 0 60.5 -13t26.5 -43zM1536 928v-160h-832q-94 0 -197 -47.5t-164 -119.5l-337 -396l-5 -6q0 4 -0.5 12.5 t-0.5 12.5v960q0 92 66 158t158 66h320q92 0 158 -66t66 -158v-32h544q92 0 158 -66t66 -158z" /> +<glyph unicode="" horiz-adv-x="768" d="M704 1216q0 -26 -19 -45t-45 -19h-128v-1024h128q26 0 45 -19t19 -45t-19 -45l-256 -256q-19 -19 -45 -19t-45 19l-256 256q-19 19 -19 45t19 45t45 19h128v1024h-128q-26 0 -45 19t-19 45t19 45l256 256q19 19 45 19t45 -19l256 -256q19 -19 19 -45z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1792 640q0 -26 -19 -45l-256 -256q-19 -19 -45 -19t-45 19t-19 45v128h-1024v-128q0 -26 -19 -45t-45 -19t-45 19l-256 256q-19 19 -19 45t19 45l256 256q19 19 45 19t45 -19t19 -45v-128h1024v128q0 26 19 45t45 19t45 -19l256 -256q19 -19 19 -45z" /> +<glyph unicode="" horiz-adv-x="2048" d="M640 640v-512h-256v512h256zM1024 1152v-1024h-256v1024h256zM2048 0v-128h-2048v1536h128v-1408h1920zM1408 896v-768h-256v768h256zM1792 1280v-1152h-256v1152h256z" /> +<glyph unicode="" d="M1280 926q-56 -25 -121 -34q68 40 93 117q-65 -38 -134 -51q-61 66 -153 66q-87 0 -148.5 -61.5t-61.5 -148.5q0 -29 5 -48q-129 7 -242 65t-192 155q-29 -50 -29 -106q0 -114 91 -175q-47 1 -100 26v-2q0 -75 50 -133.5t123 -72.5q-29 -8 -51 -8q-13 0 -39 4 q21 -63 74.5 -104t121.5 -42q-116 -90 -261 -90q-26 0 -50 3q148 -94 322 -94q112 0 210 35.5t168 95t120.5 137t75 162t24.5 168.5q0 18 -1 27q63 45 105 109zM1536 1120v-960q0 -119 -84.5 -203.5t-203.5 -84.5h-960q-119 0 -203.5 84.5t-84.5 203.5v960q0 119 84.5 203.5 t203.5 84.5h960q119 0 203.5 -84.5t84.5 -203.5z" /> +<glyph unicode="" d="M1248 1408q119 0 203.5 -84.5t84.5 -203.5v-960q0 -119 -84.5 -203.5t-203.5 -84.5h-188v595h199l30 232h-229v148q0 56 23.5 84t91.5 28l122 1v207q-63 9 -178 9q-136 0 -217.5 -80t-81.5 -226v-171h-200v-232h200v-595h-532q-119 0 -203.5 84.5t-84.5 203.5v960 q0 119 84.5 203.5t203.5 84.5h960z" /> +<glyph unicode="" horiz-adv-x="1792" d="M928 704q0 14 -9 23t-23 9q-66 0 -113 -47t-47 -113q0 -14 9 -23t23 -9t23 9t9 23q0 40 28 68t68 28q14 0 23 9t9 23zM1152 574q0 -106 -75 -181t-181 -75t-181 75t-75 181t75 181t181 75t181 -75t75 -181zM128 0h1536v128h-1536v-128zM1280 574q0 159 -112.5 271.5 t-271.5 112.5t-271.5 -112.5t-112.5 -271.5t112.5 -271.5t271.5 -112.5t271.5 112.5t112.5 271.5zM256 1216h384v128h-384v-128zM128 1024h1536v118v138h-828l-64 -128h-644v-128zM1792 1280v-1280q0 -53 -37.5 -90.5t-90.5 -37.5h-1536q-53 0 -90.5 37.5t-37.5 90.5v1280 q0 53 37.5 90.5t90.5 37.5h1536q53 0 90.5 -37.5t37.5 -90.5z" /> +<glyph unicode="" horiz-adv-x="1792" d="M832 1024q0 80 -56 136t-136 56t-136 -56t-56 -136q0 -42 19 -83q-41 19 -83 19q-80 0 -136 -56t-56 -136t56 -136t136 -56t136 56t56 136q0 42 -19 83q41 -19 83 -19q80 0 136 56t56 136zM1683 320q0 -17 -49 -66t-66 -49q-9 0 -28.5 16t-36.5 33t-38.5 40t-24.5 26 l-96 -96l220 -220q28 -28 28 -68q0 -42 -39 -81t-81 -39q-40 0 -68 28l-671 671q-176 -131 -365 -131q-163 0 -265.5 102.5t-102.5 265.5q0 160 95 313t248 248t313 95q163 0 265.5 -102.5t102.5 -265.5q0 -189 -131 -365l355 -355l96 96q-3 3 -26 24.5t-40 38.5t-33 36.5 t-16 28.5q0 17 49 66t66 49q13 0 23 -10q6 -6 46 -44.5t82 -79.5t86.5 -86t73 -78t28.5 -41z" /> +<glyph unicode="" horiz-adv-x="1920" d="M896 640q0 106 -75 181t-181 75t-181 -75t-75 -181t75 -181t181 -75t181 75t75 181zM1664 128q0 52 -38 90t-90 38t-90 -38t-38 -90q0 -53 37.5 -90.5t90.5 -37.5t90.5 37.5t37.5 90.5zM1664 1152q0 52 -38 90t-90 38t-90 -38t-38 -90q0 -53 37.5 -90.5t90.5 -37.5 t90.5 37.5t37.5 90.5zM1280 731v-185q0 -10 -7 -19.5t-16 -10.5l-155 -24q-11 -35 -32 -76q34 -48 90 -115q7 -10 7 -20q0 -12 -7 -19q-23 -30 -82.5 -89.5t-78.5 -59.5q-11 0 -21 7l-115 90q-37 -19 -77 -31q-11 -108 -23 -155q-7 -24 -30 -24h-186q-11 0 -20 7.5t-10 17.5 l-23 153q-34 10 -75 31l-118 -89q-7 -7 -20 -7q-11 0 -21 8q-144 133 -144 160q0 9 7 19q10 14 41 53t47 61q-23 44 -35 82l-152 24q-10 1 -17 9.5t-7 19.5v185q0 10 7 19.5t16 10.5l155 24q11 35 32 76q-34 48 -90 115q-7 11 -7 20q0 12 7 20q22 30 82 89t79 59q11 0 21 -7 l115 -90q34 18 77 32q11 108 23 154q7 24 30 24h186q11 0 20 -7.5t10 -17.5l23 -153q34 -10 75 -31l118 89q8 7 20 7q11 0 21 -8q144 -133 144 -160q0 -9 -7 -19q-12 -16 -42 -54t-45 -60q23 -48 34 -82l152 -23q10 -2 17 -10.5t7 -19.5zM1920 198v-140q0 -16 -149 -31 q-12 -27 -30 -52q51 -113 51 -138q0 -4 -4 -7q-122 -71 -124 -71q-8 0 -46 47t-52 68q-20 -2 -30 -2t-30 2q-14 -21 -52 -68t-46 -47q-2 0 -124 71q-4 3 -4 7q0 25 51 138q-18 25 -30 52q-149 15 -149 31v140q0 16 149 31q13 29 30 52q-51 113 -51 138q0 4 4 7q4 2 35 20 t59 34t30 16q8 0 46 -46.5t52 -67.5q20 2 30 2t30 -2q51 71 92 112l6 2q4 0 124 -70q4 -3 4 -7q0 -25 -51 -138q17 -23 30 -52q149 -15 149 -31zM1920 1222v-140q0 -16 -149 -31q-12 -27 -30 -52q51 -113 51 -138q0 -4 -4 -7q-122 -71 -124 -71q-8 0 -46 47t-52 68 q-20 -2 -30 -2t-30 2q-14 -21 -52 -68t-46 -47q-2 0 -124 71q-4 3 -4 7q0 25 51 138q-18 25 -30 52q-149 15 -149 31v140q0 16 149 31q13 29 30 52q-51 113 -51 138q0 4 4 7q4 2 35 20t59 34t30 16q8 0 46 -46.5t52 -67.5q20 2 30 2t30 -2q51 71 92 112l6 2q4 0 124 -70 q4 -3 4 -7q0 -25 -51 -138q17 -23 30 -52q149 -15 149 -31z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1408 768q0 -139 -94 -257t-256.5 -186.5t-353.5 -68.5q-86 0 -176 16q-124 -88 -278 -128q-36 -9 -86 -16h-3q-11 0 -20.5 8t-11.5 21q-1 3 -1 6.5t0.5 6.5t2 6l2.5 5t3.5 5.5t4 5t4.5 5t4 4.5q5 6 23 25t26 29.5t22.5 29t25 38.5t20.5 44q-124 72 -195 177t-71 224 q0 139 94 257t256.5 186.5t353.5 68.5t353.5 -68.5t256.5 -186.5t94 -257zM1792 512q0 -120 -71 -224.5t-195 -176.5q10 -24 20.5 -44t25 -38.5t22.5 -29t26 -29.5t23 -25q1 -1 4 -4.5t4.5 -5t4 -5t3.5 -5.5l2.5 -5t2 -6t0.5 -6.5t-1 -6.5q-3 -14 -13 -22t-22 -7 q-50 7 -86 16q-154 40 -278 128q-90 -16 -176 -16q-271 0 -472 132q58 -4 88 -4q161 0 309 45t264 129q125 92 192 212t67 254q0 77 -23 152q129 -71 204 -178t75 -230z" /> +<glyph unicode="" d="M256 192q0 26 -19 45t-45 19t-45 -19t-19 -45t19 -45t45 -19t45 19t19 45zM1408 768q0 51 -39 89.5t-89 38.5h-352q0 58 48 159.5t48 160.5q0 98 -32 145t-128 47q-26 -26 -38 -85t-30.5 -125.5t-59.5 -109.5q-22 -23 -77 -91q-4 -5 -23 -30t-31.5 -41t-34.5 -42.5 t-40 -44t-38.5 -35.5t-40 -27t-35.5 -9h-32v-640h32q13 0 31.5 -3t33 -6.5t38 -11t35 -11.5t35.5 -12.5t29 -10.5q211 -73 342 -73h121q192 0 192 167q0 26 -5 56q30 16 47.5 52.5t17.5 73.5t-18 69q53 50 53 119q0 25 -10 55.5t-25 47.5q32 1 53.5 47t21.5 81zM1536 769 q0 -89 -49 -163q9 -33 9 -69q0 -77 -38 -144q3 -21 3 -43q0 -101 -60 -178q1 -139 -85 -219.5t-227 -80.5h-36h-93q-96 0 -189.5 22.5t-216.5 65.5q-116 40 -138 40h-288q-53 0 -90.5 37.5t-37.5 90.5v640q0 53 37.5 90.5t90.5 37.5h274q36 24 137 155q58 75 107 128 q24 25 35.5 85.5t30.5 126.5t62 108q39 37 90 37q84 0 151 -32.5t102 -101.5t35 -186q0 -93 -48 -192h176q104 0 180 -76t76 -179z" /> +<glyph unicode="" d="M256 1088q0 26 -19 45t-45 19t-45 -19t-19 -45t19 -45t45 -19t45 19t19 45zM1408 512q0 35 -21.5 81t-53.5 47q15 17 25 47.5t10 55.5q0 69 -53 119q18 32 18 69t-17.5 73.5t-47.5 52.5q5 30 5 56q0 85 -49 126t-136 41h-128q-131 0 -342 -73q-5 -2 -29 -10.5 t-35.5 -12.5t-35 -11.5t-38 -11t-33 -6.5t-31.5 -3h-32v-640h32q16 0 35.5 -9t40 -27t38.5 -35.5t40 -44t34.5 -42.5t31.5 -41t23 -30q55 -68 77 -91q41 -43 59.5 -109.5t30.5 -125.5t38 -85q96 0 128 47t32 145q0 59 -48 160.5t-48 159.5h352q50 0 89 38.5t39 89.5z M1536 511q0 -103 -76 -179t-180 -76h-176q48 -99 48 -192q0 -118 -35 -186q-35 -69 -102 -101.5t-151 -32.5q-51 0 -90 37q-34 33 -54 82t-25.5 90.5t-17.5 84.5t-31 64q-48 50 -107 127q-101 131 -137 155h-274q-53 0 -90.5 37.5t-37.5 90.5v640q0 53 37.5 90.5t90.5 37.5 h288q22 0 138 40q128 44 223 66t200 22h112q140 0 226.5 -79t85.5 -216v-5q60 -77 60 -178q0 -22 -3 -43q38 -67 38 -144q0 -36 -9 -69q49 -74 49 -163z" /> +<glyph unicode="" horiz-adv-x="896" d="M832 1504v-1339l-449 -236q-22 -12 -40 -12q-21 0 -31.5 14.5t-10.5 35.5q0 6 2 20l86 500l-364 354q-25 27 -25 48q0 37 56 46l502 73l225 455q19 41 49 41z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1664 940q0 81 -21.5 143t-55 98.5t-81.5 59.5t-94 31t-98 8t-112 -25.5t-110.5 -64t-86.5 -72t-60 -61.5q-18 -22 -49 -22t-49 22q-24 28 -60 61.5t-86.5 72t-110.5 64t-112 25.5t-98 -8t-94 -31t-81.5 -59.5t-55 -98.5t-21.5 -143q0 -168 187 -355l581 -560l580 559 q188 188 188 356zM1792 940q0 -221 -229 -450l-623 -600q-18 -18 -44 -18t-44 18l-624 602q-10 8 -27.5 26t-55.5 65.5t-68 97.5t-53.5 121t-23.5 138q0 220 127 344t351 124q62 0 126.5 -21.5t120 -58t95.5 -68.5t76 -68q36 36 76 68t95.5 68.5t120 58t126.5 21.5 q224 0 351 -124t127 -344z" /> +<glyph unicode="" horiz-adv-x="1664" d="M640 96q0 -4 1 -20t0.5 -26.5t-3 -23.5t-10 -19.5t-20.5 -6.5h-320q-119 0 -203.5 84.5t-84.5 203.5v704q0 119 84.5 203.5t203.5 84.5h320q13 0 22.5 -9.5t9.5 -22.5q0 -4 1 -20t0.5 -26.5t-3 -23.5t-10 -19.5t-20.5 -6.5h-320q-66 0 -113 -47t-47 -113v-704 q0 -66 47 -113t113 -47h288h11h13t11.5 -1t11.5 -3t8 -5.5t7 -9t2 -13.5zM1568 640q0 -26 -19 -45l-544 -544q-19 -19 -45 -19t-45 19t-19 45v288h-448q-26 0 -45 19t-19 45v384q0 26 19 45t45 19h448v288q0 26 19 45t45 19t45 -19l544 -544q19 -19 19 -45z" /> +<glyph unicode="" d="M237 122h231v694h-231v-694zM483 1030q-1 52 -36 86t-93 34t-94.5 -34t-36.5 -86q0 -51 35.5 -85.5t92.5 -34.5h1q59 0 95 34.5t36 85.5zM1068 122h231v398q0 154 -73 233t-193 79q-136 0 -209 -117h2v101h-231q3 -66 0 -694h231v388q0 38 7 56q15 35 45 59.5t74 24.5 q116 0 116 -157v-371zM1536 1120v-960q0 -119 -84.5 -203.5t-203.5 -84.5h-960q-119 0 -203.5 84.5t-84.5 203.5v960q0 119 84.5 203.5t203.5 84.5h960q119 0 203.5 -84.5t84.5 -203.5z" /> +<glyph unicode="" horiz-adv-x="1152" d="M480 672v448q0 14 -9 23t-23 9t-23 -9t-9 -23v-448q0 -14 9 -23t23 -9t23 9t9 23zM1152 320q0 -26 -19 -45t-45 -19h-429l-51 -483q-2 -12 -10.5 -20.5t-20.5 -8.5h-1q-27 0 -32 27l-76 485h-404q-26 0 -45 19t-19 45q0 123 78.5 221.5t177.5 98.5v512q-52 0 -90 38 t-38 90t38 90t90 38h640q52 0 90 -38t38 -90t-38 -90t-90 -38v-512q99 0 177.5 -98.5t78.5 -221.5z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1408 608v-320q0 -119 -84.5 -203.5t-203.5 -84.5h-832q-119 0 -203.5 84.5t-84.5 203.5v832q0 119 84.5 203.5t203.5 84.5h704q14 0 23 -9t9 -23v-64q0 -14 -9 -23t-23 -9h-704q-66 0 -113 -47t-47 -113v-832q0 -66 47 -113t113 -47h832q66 0 113 47t47 113v320 q0 14 9 23t23 9h64q14 0 23 -9t9 -23zM1792 1472v-512q0 -26 -19 -45t-45 -19t-45 19l-176 176l-652 -652q-10 -10 -23 -10t-23 10l-114 114q-10 10 -10 23t10 23l652 652l-176 176q-19 19 -19 45t19 45t45 19h512q26 0 45 -19t19 -45z" /> +<glyph unicode="" d="M1184 640q0 -26 -19 -45l-544 -544q-19 -19 -45 -19t-45 19t-19 45v288h-448q-26 0 -45 19t-19 45v384q0 26 19 45t45 19h448v288q0 26 19 45t45 19t45 -19l544 -544q19 -19 19 -45zM1536 992v-704q0 -119 -84.5 -203.5t-203.5 -84.5h-320q-13 0 -22.5 9.5t-9.5 22.5 q0 4 -1 20t-0.5 26.5t3 23.5t10 19.5t20.5 6.5h320q66 0 113 47t47 113v704q0 66 -47 113t-113 47h-288h-11h-13t-11.5 1t-11.5 3t-8 5.5t-7 9t-2 13.5q0 4 -1 20t-0.5 26.5t3 23.5t10 19.5t20.5 6.5h320q119 0 203.5 -84.5t84.5 -203.5z" /> +<glyph unicode="" horiz-adv-x="1664" d="M458 653q-74 162 -74 371h-256v-96q0 -78 94.5 -162t235.5 -113zM1536 928v96h-256q0 -209 -74 -371q141 29 235.5 113t94.5 162zM1664 1056v-128q0 -71 -41.5 -143t-112 -130t-173 -97.5t-215.5 -44.5q-42 -54 -95 -95q-38 -34 -52.5 -72.5t-14.5 -89.5q0 -54 30.5 -91 t97.5 -37q75 0 133.5 -45.5t58.5 -114.5v-64q0 -14 -9 -23t-23 -9h-832q-14 0 -23 9t-9 23v64q0 69 58.5 114.5t133.5 45.5q67 0 97.5 37t30.5 91q0 51 -14.5 89.5t-52.5 72.5q-53 41 -95 95q-113 5 -215.5 44.5t-173 97.5t-112 130t-41.5 143v128q0 40 28 68t68 28h288v96 q0 66 47 113t113 47h576q66 0 113 -47t47 -113v-96h288q40 0 68 -28t28 -68z" /> +<glyph unicode="" d="M519 336q4 6 -3 13q-9 7 -14 2q-4 -6 3 -13q9 -7 14 -2zM491 377q-5 7 -12 4q-6 -4 0 -12q7 -8 12 -5q6 4 0 13zM450 417q2 4 -5 8q-7 2 -8 -2q-3 -5 4 -8q8 -2 9 2zM471 394q2 1 1.5 4.5t-3.5 5.5q-6 7 -10 3t1 -11q6 -6 11 -2zM557 319q2 7 -9 11q-9 3 -13 -4 q-2 -7 9 -11q9 -3 13 4zM599 316q0 8 -12 8q-10 0 -10 -8t11 -8t11 8zM638 323q-2 7 -13 5t-9 -9q2 -8 12 -6t10 10zM1280 640q0 212 -150 362t-362 150t-362 -150t-150 -362q0 -167 98 -300.5t252 -185.5q18 -3 26.5 5t8.5 20q0 52 -1 95q-6 -1 -15.5 -2.5t-35.5 -2t-48 4 t-43.5 20t-29.5 41.5q-23 59 -57 74q-2 1 -4.5 3.5l-8 8t-7 9.5t4 7.5t19.5 3.5q6 0 15 -2t30 -15.5t33 -35.5q16 -28 37.5 -42t43.5 -14t38 3.5t30 9.5q7 47 33 69q-49 6 -86 18.5t-73 39t-55.5 76t-19.5 119.5q0 79 53 137q-24 62 5 136q19 6 54.5 -7.5t60.5 -29.5l26 -16 q58 17 128 17t128 -17q11 7 28.5 18t55.5 26t57 9q29 -74 5 -136q53 -58 53 -137q0 -57 -14 -100.5t-35.5 -70t-53.5 -44.5t-62.5 -26t-68.5 -12q35 -31 35 -95q0 -40 -0.5 -89t-0.5 -51q0 -12 8.5 -20t26.5 -5q154 52 252 185.5t98 300.5zM1536 1120v-960 q0 -119 -84.5 -203.5t-203.5 -84.5h-960q-119 0 -203.5 84.5t-84.5 203.5v960q0 119 84.5 203.5t203.5 84.5h960q119 0 203.5 -84.5t84.5 -203.5z" /> +<glyph unicode="" horiz-adv-x="1664" d="M1280 64q0 26 -19 45t-45 19t-45 -19t-19 -45t19 -45t45 -19t45 19t19 45zM1536 64q0 26 -19 45t-45 19t-45 -19t-19 -45t19 -45t45 -19t45 19t19 45zM1664 288v-320q0 -40 -28 -68t-68 -28h-1472q-40 0 -68 28t-28 68v320q0 40 28 68t68 28h427q21 -56 70.5 -92 t110.5 -36h256q61 0 110.5 36t70.5 92h427q40 0 68 -28t28 -68zM1339 936q-17 -40 -59 -40h-256v-448q0 -26 -19 -45t-45 -19h-256q-26 0 -45 19t-19 45v448h-256q-42 0 -59 40q-17 39 14 69l448 448q18 19 45 19t45 -19l448 -448q31 -30 14 -69z" /> +<glyph unicode="" d="M1407 710q0 44 -7 113.5t-18 96.5q-12 30 -17 44t-9 36.5t-4 48.5q0 23 5 68.5t5 67.5q0 37 -10 55q-4 1 -13 1q-19 0 -58 -4.5t-59 -4.5q-60 0 -176 24t-175 24q-43 0 -94.5 -11.5t-85 -23.5t-89.5 -34q-137 -54 -202 -103q-96 -73 -159.5 -189.5t-88 -236t-24.5 -248.5 q0 -40 12.5 -120t12.5 -121q0 -23 -11 -66.5t-11 -65.5t12 -36.5t34 -14.5q24 0 72.5 11t73.5 11q57 0 169.5 -15.5t169.5 -15.5q181 0 284 36q129 45 235.5 152.5t166 245.5t59.5 275zM1535 712q0 -165 -70 -327.5t-196 -288t-281 -180.5q-124 -44 -326 -44 q-57 0 -170 14.5t-169 14.5q-24 0 -72.5 -14.5t-73.5 -14.5q-73 0 -123.5 55.5t-50.5 128.5q0 24 11 68t11 67q0 40 -12.5 120.5t-12.5 121.5q0 111 18 217.5t54.5 209.5t100.5 194t150 156q78 59 232 120q194 78 316 78q60 0 175.5 -24t173.5 -24q19 0 57 5t58 5 q81 0 118 -50.5t37 -134.5q0 -23 -5 -68t-5 -68q0 -10 1 -18.5t3 -17t4 -13.5t6.5 -16t6.5 -17q16 -40 25 -118.5t9 -136.5z" /> +<glyph unicode="" horiz-adv-x="1408" d="M1408 296q0 -27 -10 -70.5t-21 -68.5q-21 -50 -122 -106q-94 -51 -186 -51q-27 0 -52.5 3.5t-57.5 12.5t-47.5 14.5t-55.5 20.5t-49 18q-98 35 -175 83q-128 79 -264.5 215.5t-215.5 264.5q-48 77 -83 175q-3 9 -18 49t-20.5 55.5t-14.5 47.5t-12.5 57.5t-3.5 52.5 q0 92 51 186q56 101 106 122q25 11 68.5 21t70.5 10q14 0 21 -3q18 -6 53 -76q11 -19 30 -54t35 -63.5t31 -53.5q3 -4 17.5 -25t21.5 -35.5t7 -28.5q0 -20 -28.5 -50t-62 -55t-62 -53t-28.5 -46q0 -9 5 -22.5t8.5 -20.5t14 -24t11.5 -19q76 -137 174 -235t235 -174 q2 -1 19 -11.5t24 -14t20.5 -8.5t22.5 -5q18 0 46 28.5t53 62t55 62t50 28.5q14 0 28.5 -7t35.5 -21.5t25 -17.5q25 -15 53.5 -31t63.5 -35t54 -30q70 -35 76 -53q3 -7 3 -21z" /> +<glyph unicode="" horiz-adv-x="1408" d="M1120 1280h-832q-66 0 -113 -47t-47 -113v-832q0 -66 47 -113t113 -47h832q66 0 113 47t47 113v832q0 66 -47 113t-113 47zM1408 1120v-832q0 -119 -84.5 -203.5t-203.5 -84.5h-832q-119 0 -203.5 84.5t-84.5 203.5v832q0 119 84.5 203.5t203.5 84.5h832 q119 0 203.5 -84.5t84.5 -203.5z" /> +<glyph unicode="" horiz-adv-x="1280" d="M1152 1280h-1024v-1242l423 406l89 85l89 -85l423 -406v1242zM1164 1408q23 0 44 -9q33 -13 52.5 -41t19.5 -62v-1289q0 -34 -19.5 -62t-52.5 -41q-19 -8 -44 -8q-48 0 -83 32l-441 424l-441 -424q-36 -33 -83 -33q-23 0 -44 9q-33 13 -52.5 41t-19.5 62v1289 q0 34 19.5 62t52.5 41q21 9 44 9h1048z" /> +<glyph unicode="" d="M1280 343q0 11 -2 16q-3 8 -38.5 29.5t-88.5 49.5l-53 29q-5 3 -19 13t-25 15t-21 5q-18 0 -47 -32.5t-57 -65.5t-44 -33q-7 0 -16.5 3.5t-15.5 6.5t-17 9.5t-14 8.5q-99 55 -170.5 126.5t-126.5 170.5q-2 3 -8.5 14t-9.5 17t-6.5 15.5t-3.5 16.5q0 13 20.5 33.5t45 38.5 t45 39.5t20.5 36.5q0 10 -5 21t-15 25t-13 19q-3 6 -15 28.5t-25 45.5t-26.5 47.5t-25 40.5t-16.5 18t-16 2q-48 0 -101 -22q-46 -21 -80 -94.5t-34 -130.5q0 -16 2.5 -34t5 -30.5t9 -33t10 -29.5t12.5 -33t11 -30q60 -164 216.5 -320.5t320.5 -216.5q6 -2 30 -11t33 -12.5 t29.5 -10t33 -9t30.5 -5t34 -2.5q57 0 130.5 34t94.5 80q22 53 22 101zM1536 1120v-960q0 -119 -84.5 -203.5t-203.5 -84.5h-960q-119 0 -203.5 84.5t-84.5 203.5v960q0 119 84.5 203.5t203.5 84.5h960q119 0 203.5 -84.5t84.5 -203.5z" /> +<glyph unicode="" horiz-adv-x="1664" d="M1620 1128q-67 -98 -162 -167q1 -14 1 -42q0 -130 -38 -259.5t-115.5 -248.5t-184.5 -210.5t-258 -146t-323 -54.5q-271 0 -496 145q35 -4 78 -4q225 0 401 138q-105 2 -188 64.5t-114 159.5q33 -5 61 -5q43 0 85 11q-112 23 -185.5 111.5t-73.5 205.5v4q68 -38 146 -41 q-66 44 -105 115t-39 154q0 88 44 163q121 -149 294.5 -238.5t371.5 -99.5q-8 38 -8 74q0 134 94.5 228.5t228.5 94.5q140 0 236 -102q109 21 205 78q-37 -115 -142 -178q93 10 186 50z" /> +<glyph unicode="" horiz-adv-x="1024" d="M959 1524v-264h-157q-86 0 -116 -36t-30 -108v-189h293l-39 -296h-254v-759h-306v759h-255v296h255v218q0 186 104 288.5t277 102.5q147 0 228 -12z" /> +<glyph unicode="" d="M768 1408q209 0 385.5 -103t279.5 -279.5t103 -385.5q0 -251 -146.5 -451.5t-378.5 -277.5q-27 -5 -40 7t-13 30q0 3 0.5 76.5t0.5 134.5q0 97 -52 142q57 6 102.5 18t94 39t81 66.5t53 105t20.5 150.5q0 119 -79 206q37 91 -8 204q-28 9 -81 -11t-92 -44l-38 -24 q-93 26 -192 26t-192 -26q-16 11 -42.5 27t-83.5 38.5t-85 13.5q-45 -113 -8 -204q-79 -87 -79 -206q0 -85 20.5 -150t52.5 -105t80.5 -67t94 -39t102.5 -18q-39 -36 -49 -103q-21 -10 -45 -15t-57 -5t-65.5 21.5t-55.5 62.5q-19 32 -48.5 52t-49.5 24l-20 3q-21 0 -29 -4.5 t-5 -11.5t9 -14t13 -12l7 -5q22 -10 43.5 -38t31.5 -51l10 -23q13 -38 44 -61.5t67 -30t69.5 -7t55.5 3.5l23 4q0 -38 0.5 -88.5t0.5 -54.5q0 -18 -13 -30t-40 -7q-232 77 -378.5 277.5t-146.5 451.5q0 209 103 385.5t279.5 279.5t385.5 103zM291 305q3 7 -7 12 q-10 3 -13 -2q-3 -7 7 -12q9 -6 13 2zM322 271q7 5 -2 16q-10 9 -16 3q-7 -5 2 -16q10 -10 16 -3zM352 226q9 7 0 19q-8 13 -17 6q-9 -5 0 -18t17 -7zM394 184q8 8 -4 19q-12 12 -20 3q-9 -8 4 -19q12 -12 20 -3zM451 159q3 11 -13 16q-15 4 -19 -7t13 -15q15 -6 19 6z M514 154q0 13 -17 11q-16 0 -16 -11q0 -13 17 -11q16 0 16 11zM572 164q-2 11 -18 9q-16 -3 -14 -15t18 -8t14 14z" /> +<glyph unicode="" horiz-adv-x="1664" d="M1664 960v-256q0 -26 -19 -45t-45 -19h-64q-26 0 -45 19t-19 45v256q0 106 -75 181t-181 75t-181 -75t-75 -181v-192h96q40 0 68 -28t28 -68v-576q0 -40 -28 -68t-68 -28h-960q-40 0 -68 28t-28 68v576q0 40 28 68t68 28h672v192q0 185 131.5 316.5t316.5 131.5 t316.5 -131.5t131.5 -316.5z" /> +<glyph unicode="" horiz-adv-x="1920" d="M1760 1408q66 0 113 -47t47 -113v-1216q0 -66 -47 -113t-113 -47h-1600q-66 0 -113 47t-47 113v1216q0 66 47 113t113 47h1600zM160 1280q-13 0 -22.5 -9.5t-9.5 -22.5v-224h1664v224q0 13 -9.5 22.5t-22.5 9.5h-1600zM1760 0q13 0 22.5 9.5t9.5 22.5v608h-1664v-608 q0 -13 9.5 -22.5t22.5 -9.5h1600zM256 128v128h256v-128h-256zM640 128v128h384v-128h-384z" /> +<glyph unicode="" horiz-adv-x="1408" d="M384 192q0 -80 -56 -136t-136 -56t-136 56t-56 136t56 136t136 56t136 -56t56 -136zM896 69q2 -28 -17 -48q-18 -21 -47 -21h-135q-25 0 -43 16.5t-20 41.5q-22 229 -184.5 391.5t-391.5 184.5q-25 2 -41.5 20t-16.5 43v135q0 29 21 47q17 17 43 17h5q160 -13 306 -80.5 t259 -181.5q114 -113 181.5 -259t80.5 -306zM1408 67q2 -27 -18 -47q-18 -20 -46 -20h-143q-26 0 -44.5 17.5t-19.5 42.5q-12 215 -101 408.5t-231.5 336t-336 231.5t-408.5 102q-25 1 -42.5 19.5t-17.5 43.5v143q0 28 20 46q18 18 44 18h3q262 -13 501.5 -120t425.5 -294 q187 -186 294 -425.5t120 -501.5z" /> +<glyph unicode="" d="M1040 320q0 -33 -23.5 -56.5t-56.5 -23.5t-56.5 23.5t-23.5 56.5t23.5 56.5t56.5 23.5t56.5 -23.5t23.5 -56.5zM1296 320q0 -33 -23.5 -56.5t-56.5 -23.5t-56.5 23.5t-23.5 56.5t23.5 56.5t56.5 23.5t56.5 -23.5t23.5 -56.5zM1408 160v320q0 13 -9.5 22.5t-22.5 9.5 h-1216q-13 0 -22.5 -9.5t-9.5 -22.5v-320q0 -13 9.5 -22.5t22.5 -9.5h1216q13 0 22.5 9.5t9.5 22.5zM178 640h1180l-157 482q-4 13 -16 21.5t-26 8.5h-782q-14 0 -26 -8.5t-16 -21.5zM1536 480v-320q0 -66 -47 -113t-113 -47h-1216q-66 0 -113 47t-47 113v320q0 25 16 75 l197 606q17 53 63 86t101 33h782q55 0 101 -33t63 -86l197 -606q16 -50 16 -75z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1664 896q53 0 90.5 -37.5t37.5 -90.5t-37.5 -90.5t-90.5 -37.5v-384q0 -52 -38 -90t-90 -38q-417 347 -812 380q-58 -19 -91 -66t-31 -100.5t40 -92.5q-20 -33 -23 -65.5t6 -58t33.5 -55t48 -50t61.5 -50.5q-29 -58 -111.5 -83t-168.5 -11.5t-132 55.5q-7 23 -29.5 87.5 t-32 94.5t-23 89t-15 101t3.5 98.5t22 110.5h-122q-66 0 -113 47t-47 113v192q0 66 47 113t113 47h480q435 0 896 384q52 0 90 -38t38 -90v-384zM1536 292v954q-394 -302 -768 -343v-270q377 -42 768 -341z" /> +<glyph unicode="" horiz-adv-x="1792" d="M912 -160q0 16 -16 16q-59 0 -101.5 42.5t-42.5 101.5q0 16 -16 16t-16 -16q0 -73 51.5 -124.5t124.5 -51.5q16 0 16 16zM246 128h1300q-266 300 -266 832q0 51 -24 105t-69 103t-121.5 80.5t-169.5 31.5t-169.5 -31.5t-121.5 -80.5t-69 -103t-24 -105q0 -532 -266 -832z M1728 128q0 -52 -38 -90t-90 -38h-448q0 -106 -75 -181t-181 -75t-181 75t-75 181h-448q-52 0 -90 38t-38 90q50 42 91 88t85 119.5t74.5 158.5t50 206t19.5 260q0 152 117 282.5t307 158.5q-8 19 -8 39q0 40 28 68t68 28t68 -28t28 -68q0 -20 -8 -39q190 -28 307 -158.5 t117 -282.5q0 -139 19.5 -260t50 -206t74.5 -158.5t85 -119.5t91 -88z" /> +<glyph unicode="" d="M1376 640l138 -135q30 -28 20 -70q-12 -41 -52 -51l-188 -48l53 -186q12 -41 -19 -70q-29 -31 -70 -19l-186 53l-48 -188q-10 -40 -51 -52q-12 -2 -19 -2q-31 0 -51 22l-135 138l-135 -138q-28 -30 -70 -20q-41 11 -51 52l-48 188l-186 -53q-41 -12 -70 19q-31 29 -19 70 l53 186l-188 48q-40 10 -52 51q-10 42 20 70l138 135l-138 135q-30 28 -20 70q12 41 52 51l188 48l-53 186q-12 41 19 70q29 31 70 19l186 -53l48 188q10 41 51 51q41 12 70 -19l135 -139l135 139q29 30 70 19q41 -10 51 -51l48 -188l186 53q41 12 70 -19q31 -29 19 -70 l-53 -186l188 -48q40 -10 52 -51q10 -42 -20 -70z" /> +<glyph unicode="" horiz-adv-x="1792" d="M256 192q0 26 -19 45t-45 19t-45 -19t-19 -45t19 -45t45 -19t45 19t19 45zM1664 768q0 51 -39 89.5t-89 38.5h-576q0 20 15 48.5t33 55t33 68t15 84.5q0 67 -44.5 97.5t-115.5 30.5q-24 0 -90 -139q-24 -44 -37 -65q-40 -64 -112 -145q-71 -81 -101 -106 q-69 -57 -140 -57h-32v-640h32q72 0 167 -32t193.5 -64t179.5 -32q189 0 189 167q0 26 -5 56q30 16 47.5 52.5t17.5 73.5t-18 69q53 50 53 119q0 25 -10 55.5t-25 47.5h331q52 0 90 38t38 90zM1792 769q0 -105 -75.5 -181t-180.5 -76h-169q-4 -62 -37 -119q3 -21 3 -43 q0 -101 -60 -178q1 -139 -85 -219.5t-227 -80.5q-133 0 -322 69q-164 59 -223 59h-288q-53 0 -90.5 37.5t-37.5 90.5v640q0 53 37.5 90.5t90.5 37.5h288q10 0 21.5 4.5t23.5 14t22.5 18t24 22.5t20.5 21.5t19 21.5t14 17q65 74 100 129q13 21 33 62t37 72t40.5 63t55 49.5 t69.5 17.5q125 0 206.5 -67t81.5 -189q0 -68 -22 -128h374q104 0 180 -76t76 -179z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1376 128h32v640h-32q-35 0 -67.5 12t-62.5 37t-50 46t-49 54q-2 3 -3.5 4.5t-4 4.5t-4.5 5q-72 81 -112 145q-14 22 -38 68q-1 3 -10.5 22.5t-18.5 36t-20 35.5t-21.5 30.5t-18.5 11.5q-71 0 -115.5 -30.5t-44.5 -97.5q0 -43 15 -84.5t33 -68t33 -55t15 -48.5h-576 q-50 0 -89 -38.5t-39 -89.5q0 -52 38 -90t90 -38h331q-15 -17 -25 -47.5t-10 -55.5q0 -69 53 -119q-18 -32 -18 -69t17.5 -73.5t47.5 -52.5q-4 -24 -4 -56q0 -85 48.5 -126t135.5 -41q84 0 183 32t194 64t167 32zM1664 192q0 26 -19 45t-45 19t-45 -19t-19 -45t19 -45 t45 -19t45 19t19 45zM1792 768v-640q0 -53 -37.5 -90.5t-90.5 -37.5h-288q-59 0 -223 -59q-190 -69 -317 -69q-142 0 -230 77.5t-87 217.5l1 5q-61 76 -61 178q0 22 3 43q-33 57 -37 119h-169q-105 0 -180.5 76t-75.5 181q0 103 76 179t180 76h374q-22 60 -22 128 q0 122 81.5 189t206.5 67q38 0 69.5 -17.5t55 -49.5t40.5 -63t37 -72t33 -62q35 -55 100 -129q2 -3 14 -17t19 -21.5t20.5 -21.5t24 -22.5t22.5 -18t23.5 -14t21.5 -4.5h288q53 0 90.5 -37.5t37.5 -90.5z" /> +<glyph unicode="" d="M1280 -64q0 26 -19 45t-45 19t-45 -19t-19 -45t19 -45t45 -19t45 19t19 45zM1408 700q0 189 -167 189q-26 0 -56 -5q-16 30 -52.5 47.5t-73.5 17.5t-69 -18q-50 53 -119 53q-25 0 -55.5 -10t-47.5 -25v331q0 52 -38 90t-90 38q-51 0 -89.5 -39t-38.5 -89v-576 q-20 0 -48.5 15t-55 33t-68 33t-84.5 15q-67 0 -97.5 -44.5t-30.5 -115.5q0 -24 139 -90q44 -24 65 -37q64 -40 145 -112q81 -71 106 -101q57 -69 57 -140v-32h640v32q0 72 32 167t64 193.5t32 179.5zM1536 705q0 -133 -69 -322q-59 -164 -59 -223v-288q0 -53 -37.5 -90.5 t-90.5 -37.5h-640q-53 0 -90.5 37.5t-37.5 90.5v288q0 10 -4.5 21.5t-14 23.5t-18 22.5t-22.5 24t-21.5 20.5t-21.5 19t-17 14q-74 65 -129 100q-21 13 -62 33t-72 37t-63 40.5t-49.5 55t-17.5 69.5q0 125 67 206.5t189 81.5q68 0 128 -22v374q0 104 76 180t179 76 q105 0 181 -75.5t76 -180.5v-169q62 -4 119 -37q21 3 43 3q101 0 178 -60q139 1 219.5 -85t80.5 -227z" /> +<glyph unicode="" d="M1408 576q0 84 -32 183t-64 194t-32 167v32h-640v-32q0 -35 -12 -67.5t-37 -62.5t-46 -50t-54 -49q-9 -8 -14 -12q-81 -72 -145 -112q-22 -14 -68 -38q-3 -1 -22.5 -10.5t-36 -18.5t-35.5 -20t-30.5 -21.5t-11.5 -18.5q0 -71 30.5 -115.5t97.5 -44.5q43 0 84.5 15t68 33 t55 33t48.5 15v-576q0 -50 38.5 -89t89.5 -39q52 0 90 38t38 90v331q46 -35 103 -35q69 0 119 53q32 -18 69 -18t73.5 17.5t52.5 47.5q24 -4 56 -4q85 0 126 48.5t41 135.5zM1280 1344q0 26 -19 45t-45 19t-45 -19t-19 -45t19 -45t45 -19t45 19t19 45zM1536 580 q0 -142 -77.5 -230t-217.5 -87l-5 1q-76 -61 -178 -61q-22 0 -43 3q-54 -30 -119 -37v-169q0 -105 -76 -180.5t-181 -75.5q-103 0 -179 76t-76 180v374q-54 -22 -128 -22q-121 0 -188.5 81.5t-67.5 206.5q0 38 17.5 69.5t49.5 55t63 40.5t72 37t62 33q55 35 129 100 q3 2 17 14t21.5 19t21.5 20.5t22.5 24t18 22.5t14 23.5t4.5 21.5v288q0 53 37.5 90.5t90.5 37.5h640q53 0 90.5 -37.5t37.5 -90.5v-288q0 -59 59 -223q69 -190 69 -317z" /> +<glyph unicode="" d="M1280 576v128q0 26 -19 45t-45 19h-502l189 189q19 19 19 45t-19 45l-91 91q-18 18 -45 18t-45 -18l-362 -362l-91 -91q-18 -18 -18 -45t18 -45l91 -91l362 -362q18 -18 45 -18t45 18l91 91q18 18 18 45t-18 45l-189 189h502q26 0 45 19t19 45zM1536 640 q0 -209 -103 -385.5t-279.5 -279.5t-385.5 -103t-385.5 103t-279.5 279.5t-103 385.5t103 385.5t279.5 279.5t385.5 103t385.5 -103t279.5 -279.5t103 -385.5z" /> +<glyph unicode="" d="M1285 640q0 27 -18 45l-91 91l-362 362q-18 18 -45 18t-45 -18l-91 -91q-18 -18 -18 -45t18 -45l189 -189h-502q-26 0 -45 -19t-19 -45v-128q0 -26 19 -45t45 -19h502l-189 -189q-19 -19 -19 -45t19 -45l91 -91q18 -18 45 -18t45 18l362 362l91 91q18 18 18 45zM1536 640 q0 -209 -103 -385.5t-279.5 -279.5t-385.5 -103t-385.5 103t-279.5 279.5t-103 385.5t103 385.5t279.5 279.5t385.5 103t385.5 -103t279.5 -279.5t103 -385.5z" /> +<glyph unicode="" d="M1284 641q0 27 -18 45l-362 362l-91 91q-18 18 -45 18t-45 -18l-91 -91l-362 -362q-18 -18 -18 -45t18 -45l91 -91q18 -18 45 -18t45 18l189 189v-502q0 -26 19 -45t45 -19h128q26 0 45 19t19 45v502l189 -189q19 -19 45 -19t45 19l91 91q18 18 18 45zM1536 640 q0 -209 -103 -385.5t-279.5 -279.5t-385.5 -103t-385.5 103t-279.5 279.5t-103 385.5t103 385.5t279.5 279.5t385.5 103t385.5 -103t279.5 -279.5t103 -385.5z" /> +<glyph unicode="" d="M1284 639q0 27 -18 45l-91 91q-18 18 -45 18t-45 -18l-189 -189v502q0 26 -19 45t-45 19h-128q-26 0 -45 -19t-19 -45v-502l-189 189q-19 19 -45 19t-45 -19l-91 -91q-18 -18 -18 -45t18 -45l362 -362l91 -91q18 -18 45 -18t45 18l91 91l362 362q18 18 18 45zM1536 640 q0 -209 -103 -385.5t-279.5 -279.5t-385.5 -103t-385.5 103t-279.5 279.5t-103 385.5t103 385.5t279.5 279.5t385.5 103t385.5 -103t279.5 -279.5t103 -385.5z" /> +<glyph unicode="" d="M768 1408q209 0 385.5 -103t279.5 -279.5t103 -385.5t-103 -385.5t-279.5 -279.5t-385.5 -103t-385.5 103t-279.5 279.5t-103 385.5t103 385.5t279.5 279.5t385.5 103zM1042 887q-2 -1 -9.5 -9.5t-13.5 -9.5q2 0 4.5 5t5 11t3.5 7q6 7 22 15q14 6 52 12q34 8 51 -11 q-2 2 9.5 13t14.5 12q3 2 15 4.5t15 7.5l2 22q-12 -1 -17.5 7t-6.5 21q0 -2 -6 -8q0 7 -4.5 8t-11.5 -1t-9 -1q-10 3 -15 7.5t-8 16.5t-4 15q-2 5 -9.5 10.5t-9.5 10.5q-1 2 -2.5 5.5t-3 6.5t-4 5.5t-5.5 2.5t-7 -5t-7.5 -10t-4.5 -5q-3 2 -6 1.5t-4.5 -1t-4.5 -3t-5 -3.5 q-3 -2 -8.5 -3t-8.5 -2q15 5 -1 11q-10 4 -16 3q9 4 7.5 12t-8.5 14h5q-1 4 -8.5 8.5t-17.5 8.5t-13 6q-8 5 -34 9.5t-33 0.5q-5 -6 -4.5 -10.5t4 -14t3.5 -12.5q1 -6 -5.5 -13t-6.5 -12q0 -7 14 -15.5t10 -21.5q-3 -8 -16 -16t-16 -12q-5 -8 -1.5 -18.5t10.5 -16.5 q2 -2 1.5 -4t-3.5 -4.5t-5.5 -4t-6.5 -3.5l-3 -2q-11 -5 -20.5 6t-13.5 26q-7 25 -16 30q-23 8 -29 -1q-5 13 -41 26q-25 9 -58 4q6 1 0 15q-7 15 -19 12q3 6 4 17.5t1 13.5q3 13 12 23q1 1 7 8.5t9.5 13.5t0.5 6q35 -4 50 11q5 5 11.5 17t10.5 17q9 6 14 5.5t14.5 -5.5 t14.5 -5q14 -1 15.5 11t-7.5 20q12 -1 3 17q-5 7 -8 9q-12 4 -27 -5q-8 -4 2 -8q-1 1 -9.5 -10.5t-16.5 -17.5t-16 5q-1 1 -5.5 13.5t-9.5 13.5q-8 0 -16 -15q3 8 -11 15t-24 8q19 12 -8 27q-7 4 -20.5 5t-19.5 -4q-5 -7 -5.5 -11.5t5 -8t10.5 -5.5t11.5 -4t8.5 -3 q14 -10 8 -14q-2 -1 -8.5 -3.5t-11.5 -4.5t-6 -4q-3 -4 0 -14t-2 -14q-5 5 -9 17.5t-7 16.5q7 -9 -25 -6l-10 1q-4 0 -16 -2t-20.5 -1t-13.5 8q-4 8 0 20q1 4 4 2q-4 3 -11 9.5t-10 8.5q-46 -15 -94 -41q6 -1 12 1q5 2 13 6.5t10 5.5q34 14 42 7l5 5q14 -16 20 -25 q-7 4 -30 1q-20 -6 -22 -12q7 -12 5 -18q-4 3 -11.5 10t-14.5 11t-15 5q-16 0 -22 -1q-146 -80 -235 -222q7 -7 12 -8q4 -1 5 -9t2.5 -11t11.5 3q9 -8 3 -19q1 1 44 -27q19 -17 21 -21q3 -11 -10 -18q-1 2 -9 9t-9 4q-3 -5 0.5 -18.5t10.5 -12.5q-7 0 -9.5 -16t-2.5 -35.5 t-1 -23.5l2 -1q-3 -12 5.5 -34.5t21.5 -19.5q-13 -3 20 -43q6 -8 8 -9q3 -2 12 -7.5t15 -10t10 -10.5q4 -5 10 -22.5t14 -23.5q-2 -6 9.5 -20t10.5 -23q-1 0 -2.5 -1t-2.5 -1q3 -7 15.5 -14t15.5 -13q1 -3 2 -10t3 -11t8 -2q2 20 -24 62q-15 25 -17 29q-3 5 -5.5 15.5 t-4.5 14.5q2 0 6 -1.5t8.5 -3.5t7.5 -4t2 -3q-3 -7 2 -17.5t12 -18.5t17 -19t12 -13q6 -6 14 -19.5t0 -13.5q9 0 20 -10t17 -20q5 -8 8 -26t5 -24q2 -7 8.5 -13.5t12.5 -9.5l16 -8t13 -7q5 -2 18.5 -10.5t21.5 -11.5q10 -4 16 -4t14.5 2.5t13.5 3.5q15 2 29 -15t21 -21 q36 -19 55 -11q-2 -1 0.5 -7.5t8 -15.5t9 -14.5t5.5 -8.5q5 -6 18 -15t18 -15q6 4 7 9q-3 -8 7 -20t18 -10q14 3 14 32q-31 -15 -49 18q0 1 -2.5 5.5t-4 8.5t-2.5 8.5t0 7.5t5 3q9 0 10 3.5t-2 12.5t-4 13q-1 8 -11 20t-12 15q-5 -9 -16 -8t-16 9q0 -1 -1.5 -5.5t-1.5 -6.5 q-13 0 -15 1q1 3 2.5 17.5t3.5 22.5q1 4 5.5 12t7.5 14.5t4 12.5t-4.5 9.5t-17.5 2.5q-19 -1 -26 -20q-1 -3 -3 -10.5t-5 -11.5t-9 -7q-7 -3 -24 -2t-24 5q-13 8 -22.5 29t-9.5 37q0 10 2.5 26.5t3 25t-5.5 24.5q3 2 9 9.5t10 10.5q2 1 4.5 1.5t4.5 0t4 1.5t3 6q-1 1 -4 3 q-3 3 -4 3q7 -3 28.5 1.5t27.5 -1.5q15 -11 22 2q0 1 -2.5 9.5t-0.5 13.5q5 -27 29 -9q3 -3 15.5 -5t17.5 -5q3 -2 7 -5.5t5.5 -4.5t5 0.5t8.5 6.5q10 -14 12 -24q11 -40 19 -44q7 -3 11 -2t4.5 9.5t0 14t-1.5 12.5l-1 8v18l-1 8q-15 3 -18.5 12t1.5 18.5t15 18.5q1 1 8 3.5 t15.5 6.5t12.5 8q21 19 15 35q7 0 11 9q-1 0 -5 3t-7.5 5t-4.5 2q9 5 2 16q5 3 7.5 11t7.5 10q9 -12 21 -2q7 8 1 16q5 7 20.5 10.5t18.5 9.5q7 -2 8 2t1 12t3 12q4 5 15 9t13 5l17 11q3 4 0 4q18 -2 31 11q10 11 -6 20q3 6 -3 9.5t-15 5.5q3 1 11.5 0.5t10.5 1.5 q15 10 -7 16q-17 5 -43 -12zM879 10q206 36 351 189q-3 3 -12.5 4.5t-12.5 3.5q-18 7 -24 8q1 7 -2.5 13t-8 9t-12.5 8t-11 7q-2 2 -7 6t-7 5.5t-7.5 4.5t-8.5 2t-10 -1l-3 -1q-3 -1 -5.5 -2.5t-5.5 -3t-4 -3t0 -2.5q-21 17 -36 22q-5 1 -11 5.5t-10.5 7t-10 1.5t-11.5 -7 q-5 -5 -6 -15t-2 -13q-7 5 0 17.5t2 18.5q-3 6 -10.5 4.5t-12 -4.5t-11.5 -8.5t-9 -6.5t-8.5 -5.5t-8.5 -7.5q-3 -4 -6 -12t-5 -11q-2 4 -11.5 6.5t-9.5 5.5q2 -10 4 -35t5 -38q7 -31 -12 -48q-27 -25 -29 -40q-4 -22 12 -26q0 -7 -8 -20.5t-7 -21.5q0 -6 2 -16z" /> +<glyph unicode="" horiz-adv-x="1664" d="M384 64q0 26 -19 45t-45 19t-45 -19t-19 -45t19 -45t45 -19t45 19t19 45zM1028 484l-682 -682q-37 -37 -90 -37q-52 0 -91 37l-106 108q-38 36 -38 90q0 53 38 91l681 681q39 -98 114.5 -173.5t173.5 -114.5zM1662 919q0 -39 -23 -106q-47 -134 -164.5 -217.5 t-258.5 -83.5q-185 0 -316.5 131.5t-131.5 316.5t131.5 316.5t316.5 131.5q58 0 121.5 -16.5t107.5 -46.5q16 -11 16 -28t-16 -28l-293 -169v-224l193 -107q5 3 79 48.5t135.5 81t70.5 35.5q15 0 23.5 -10t8.5 -25z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1024 128h640v128h-640v-128zM640 640h1024v128h-1024v-128zM1280 1152h384v128h-384v-128zM1792 320v-256q0 -26 -19 -45t-45 -19h-1664q-26 0 -45 19t-19 45v256q0 26 19 45t45 19h1664q26 0 45 -19t19 -45zM1792 832v-256q0 -26 -19 -45t-45 -19h-1664q-26 0 -45 19 t-19 45v256q0 26 19 45t45 19h1664q26 0 45 -19t19 -45zM1792 1344v-256q0 -26 -19 -45t-45 -19h-1664q-26 0 -45 19t-19 45v256q0 26 19 45t45 19h1664q26 0 45 -19t19 -45z" /> +<glyph unicode="" horiz-adv-x="1408" d="M1403 1241q17 -41 -14 -70l-493 -493v-742q0 -42 -39 -59q-13 -5 -25 -5q-27 0 -45 19l-256 256q-19 19 -19 45v486l-493 493q-31 29 -14 70q17 39 59 39h1280q42 0 59 -39z" /> +<glyph unicode="" horiz-adv-x="1792" d="M640 1280h512v128h-512v-128zM1792 640v-480q0 -66 -47 -113t-113 -47h-1472q-66 0 -113 47t-47 113v480h672v-160q0 -26 19 -45t45 -19h320q26 0 45 19t19 45v160h672zM1024 640v-128h-256v128h256zM1792 1120v-384h-1792v384q0 66 47 113t113 47h352v160q0 40 28 68 t68 28h576q40 0 68 -28t28 -68v-160h352q66 0 113 -47t47 -113z" /> +<glyph unicode="" d="M1283 995l-355 -355l355 -355l144 144q29 31 70 14q39 -17 39 -59v-448q0 -26 -19 -45t-45 -19h-448q-42 0 -59 40q-17 39 14 69l144 144l-355 355l-355 -355l144 -144q31 -30 14 -69q-17 -40 -59 -40h-448q-26 0 -45 19t-19 45v448q0 42 40 59q39 17 69 -14l144 -144 l355 355l-355 355l-144 -144q-19 -19 -45 -19q-12 0 -24 5q-40 17 -40 59v448q0 26 19 45t45 19h448q42 0 59 -40q17 -39 -14 -69l-144 -144l355 -355l355 355l-144 144q-31 30 -14 69q17 40 59 40h448q26 0 45 -19t19 -45v-448q0 -42 -39 -59q-13 -5 -25 -5q-26 0 -45 19z " /> +<glyph unicode="" horiz-adv-x="1920" d="M593 640q-162 -5 -265 -128h-134q-82 0 -138 40.5t-56 118.5q0 353 124 353q6 0 43.5 -21t97.5 -42.5t119 -21.5q67 0 133 23q-5 -37 -5 -66q0 -139 81 -256zM1664 3q0 -120 -73 -189.5t-194 -69.5h-874q-121 0 -194 69.5t-73 189.5q0 53 3.5 103.5t14 109t26.5 108.5 t43 97.5t62 81t85.5 53.5t111.5 20q10 0 43 -21.5t73 -48t107 -48t135 -21.5t135 21.5t107 48t73 48t43 21.5q61 0 111.5 -20t85.5 -53.5t62 -81t43 -97.5t26.5 -108.5t14 -109t3.5 -103.5zM640 1280q0 -106 -75 -181t-181 -75t-181 75t-75 181t75 181t181 75t181 -75 t75 -181zM1344 896q0 -159 -112.5 -271.5t-271.5 -112.5t-271.5 112.5t-112.5 271.5t112.5 271.5t271.5 112.5t271.5 -112.5t112.5 -271.5zM1920 671q0 -78 -56 -118.5t-138 -40.5h-134q-103 123 -265 128q81 117 81 256q0 29 -5 66q66 -23 133 -23q59 0 119 21.5t97.5 42.5 t43.5 21q124 0 124 -353zM1792 1280q0 -106 -75 -181t-181 -75t-181 75t-75 181t75 181t181 75t181 -75t75 -181z" /> +<glyph unicode="" horiz-adv-x="1664" d="M1456 320q0 40 -28 68l-208 208q-28 28 -68 28q-42 0 -72 -32q3 -3 19 -18.5t21.5 -21.5t15 -19t13 -25.5t3.5 -27.5q0 -40 -28 -68t-68 -28q-15 0 -27.5 3.5t-25.5 13t-19 15t-21.5 21.5t-18.5 19q-33 -31 -33 -73q0 -40 28 -68l206 -207q27 -27 68 -27q40 0 68 26 l147 146q28 28 28 67zM753 1025q0 40 -28 68l-206 207q-28 28 -68 28q-39 0 -68 -27l-147 -146q-28 -28 -28 -67q0 -40 28 -68l208 -208q27 -27 68 -27q42 0 72 31q-3 3 -19 18.5t-21.5 21.5t-15 19t-13 25.5t-3.5 27.5q0 40 28 68t68 28q15 0 27.5 -3.5t25.5 -13t19 -15 t21.5 -21.5t18.5 -19q33 31 33 73zM1648 320q0 -120 -85 -203l-147 -146q-83 -83 -203 -83q-121 0 -204 85l-206 207q-83 83 -83 203q0 123 88 209l-88 88q-86 -88 -208 -88q-120 0 -204 84l-208 208q-84 84 -84 204t85 203l147 146q83 83 203 83q121 0 204 -85l206 -207 q83 -83 83 -203q0 -123 -88 -209l88 -88q86 88 208 88q120 0 204 -84l208 -208q84 -84 84 -204z" /> +<glyph unicode="" horiz-adv-x="1920" d="M1920 384q0 -159 -112.5 -271.5t-271.5 -112.5h-1088q-185 0 -316.5 131.5t-131.5 316.5q0 132 71 241.5t187 163.5q-2 28 -2 43q0 212 150 362t362 150q158 0 286.5 -88t187.5 -230q70 62 166 62q106 0 181 -75t75 -181q0 -75 -41 -138q129 -30 213 -134.5t84 -239.5z " /> +<glyph unicode="" horiz-adv-x="1664" d="M1527 88q56 -89 21.5 -152.5t-140.5 -63.5h-1152q-106 0 -140.5 63.5t21.5 152.5l503 793v399h-64q-26 0 -45 19t-19 45t19 45t45 19h512q26 0 45 -19t19 -45t-19 -45t-45 -19h-64v-399zM748 813l-272 -429h712l-272 429l-20 31v37v399h-128v-399v-37z" /> +<glyph unicode="" horiz-adv-x="1792" d="M960 640q26 0 45 -19t19 -45t-19 -45t-45 -19t-45 19t-19 45t19 45t45 19zM1260 576l507 -398q28 -20 25 -56q-5 -35 -35 -51l-128 -64q-13 -7 -29 -7q-17 0 -31 8l-690 387l-110 -66q-8 -4 -12 -5q14 -49 10 -97q-7 -77 -56 -147.5t-132 -123.5q-132 -84 -277 -84 q-136 0 -222 78q-90 84 -79 207q7 76 56 147t131 124q132 84 278 84q83 0 151 -31q9 13 22 22l122 73l-122 73q-13 9 -22 22q-68 -31 -151 -31q-146 0 -278 84q-82 53 -131 124t-56 147q-5 59 15.5 113t63.5 93q85 79 222 79q145 0 277 -84q83 -52 132 -123t56 -148 q4 -48 -10 -97q4 -1 12 -5l110 -66l690 387q14 8 31 8q16 0 29 -7l128 -64q30 -16 35 -51q3 -36 -25 -56zM579 836q46 42 21 108t-106 117q-92 59 -192 59q-74 0 -113 -36q-46 -42 -21 -108t106 -117q92 -59 192 -59q74 0 113 36zM494 91q81 51 106 117t-21 108 q-39 36 -113 36q-100 0 -192 -59q-81 -51 -106 -117t21 -108q39 -36 113 -36q100 0 192 59zM672 704l96 -58v11q0 36 33 56l14 8l-79 47l-26 -26q-3 -3 -10 -11t-12 -12q-2 -2 -4 -3.5t-3 -2.5zM896 480l96 -32l736 576l-128 64l-768 -431v-113l-160 -96l9 -8q2 -2 7 -6 q4 -4 11 -12t11 -12l26 -26zM1600 64l128 64l-520 408l-177 -138q-2 -3 -13 -7z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1696 1152q40 0 68 -28t28 -68v-1216q0 -40 -28 -68t-68 -28h-960q-40 0 -68 28t-28 68v288h-544q-40 0 -68 28t-28 68v672q0 40 20 88t48 76l408 408q28 28 76 48t88 20h416q40 0 68 -28t28 -68v-328q68 40 128 40h416zM1152 939l-299 -299h299v299zM512 1323l-299 -299 h299v299zM708 676l316 316v416h-384v-416q0 -40 -28 -68t-68 -28h-416v-640h512v256q0 40 20 88t48 76zM1664 -128v1152h-384v-416q0 -40 -28 -68t-68 -28h-416v-640h896z" /> +<glyph unicode="" horiz-adv-x="1408" d="M1404 151q0 -117 -79 -196t-196 -79q-135 0 -235 100l-777 776q-113 115 -113 271q0 159 110 270t269 111q158 0 273 -113l605 -606q10 -10 10 -22q0 -16 -30.5 -46.5t-46.5 -30.5q-13 0 -23 10l-606 607q-79 77 -181 77q-106 0 -179 -75t-73 -181q0 -105 76 -181 l776 -777q63 -63 145 -63q64 0 106 42t42 106q0 82 -63 145l-581 581q-26 24 -60 24q-29 0 -48 -19t-19 -48q0 -32 25 -59l410 -410q10 -10 10 -22q0 -16 -31 -47t-47 -31q-12 0 -22 10l-410 410q-63 61 -63 149q0 82 57 139t139 57q88 0 149 -63l581 -581q100 -98 100 -235 z" /> +<glyph unicode="" d="M384 0h768v384h-768v-384zM1280 0h128v896q0 14 -10 38.5t-20 34.5l-281 281q-10 10 -34 20t-39 10v-416q0 -40 -28 -68t-68 -28h-576q-40 0 -68 28t-28 68v416h-128v-1280h128v416q0 40 28 68t68 28h832q40 0 68 -28t28 -68v-416zM896 928v320q0 13 -9.5 22.5t-22.5 9.5 h-192q-13 0 -22.5 -9.5t-9.5 -22.5v-320q0 -13 9.5 -22.5t22.5 -9.5h192q13 0 22.5 9.5t9.5 22.5zM1536 896v-928q0 -40 -28 -68t-68 -28h-1344q-40 0 -68 28t-28 68v1344q0 40 28 68t68 28h928q40 0 88 -20t76 -48l280 -280q28 -28 48 -76t20 -88z" /> +<glyph unicode="" d="M1536 1120v-960q0 -119 -84.5 -203.5t-203.5 -84.5h-960q-119 0 -203.5 84.5t-84.5 203.5v960q0 119 84.5 203.5t203.5 84.5h960q119 0 203.5 -84.5t84.5 -203.5z" /> +<glyph unicode="" d="M1536 192v-128q0 -26 -19 -45t-45 -19h-1408q-26 0 -45 19t-19 45v128q0 26 19 45t45 19h1408q26 0 45 -19t19 -45zM1536 704v-128q0 -26 -19 -45t-45 -19h-1408q-26 0 -45 19t-19 45v128q0 26 19 45t45 19h1408q26 0 45 -19t19 -45zM1536 1216v-128q0 -26 -19 -45 t-45 -19h-1408q-26 0 -45 19t-19 45v128q0 26 19 45t45 19h1408q26 0 45 -19t19 -45z" /> +<glyph unicode="" horiz-adv-x="1792" d="M384 128q0 -80 -56 -136t-136 -56t-136 56t-56 136t56 136t136 56t136 -56t56 -136zM384 640q0 -80 -56 -136t-136 -56t-136 56t-56 136t56 136t136 56t136 -56t56 -136zM1792 224v-192q0 -13 -9.5 -22.5t-22.5 -9.5h-1216q-13 0 -22.5 9.5t-9.5 22.5v192q0 13 9.5 22.5 t22.5 9.5h1216q13 0 22.5 -9.5t9.5 -22.5zM384 1152q0 -80 -56 -136t-136 -56t-136 56t-56 136t56 136t136 56t136 -56t56 -136zM1792 736v-192q0 -13 -9.5 -22.5t-22.5 -9.5h-1216q-13 0 -22.5 9.5t-9.5 22.5v192q0 13 9.5 22.5t22.5 9.5h1216q13 0 22.5 -9.5t9.5 -22.5z M1792 1248v-192q0 -13 -9.5 -22.5t-22.5 -9.5h-1216q-13 0 -22.5 9.5t-9.5 22.5v192q0 13 9.5 22.5t22.5 9.5h1216q13 0 22.5 -9.5t9.5 -22.5z" /> +<glyph unicode="" horiz-adv-x="1792" d="M381 -84q0 -80 -54.5 -126t-135.5 -46q-106 0 -172 66l57 88q49 -45 106 -45q29 0 50.5 14.5t21.5 42.5q0 64 -105 56l-26 56q8 10 32.5 43.5t42.5 54t37 38.5v1q-16 0 -48.5 -1t-48.5 -1v-53h-106v152h333v-88l-95 -115q51 -12 81 -49t30 -88zM383 543v-159h-362 q-6 36 -6 54q0 51 23.5 93t56.5 68t66 47.5t56.5 43.5t23.5 45q0 25 -14.5 38.5t-39.5 13.5q-46 0 -81 -58l-85 59q24 51 71.5 79.5t105.5 28.5q73 0 123 -41.5t50 -112.5q0 -50 -34 -91.5t-75 -64.5t-75.5 -50.5t-35.5 -52.5h127v60h105zM1792 224v-192q0 -13 -9.5 -22.5 t-22.5 -9.5h-1216q-13 0 -22.5 9.5t-9.5 22.5v192q0 14 9 23t23 9h1216q13 0 22.5 -9.5t9.5 -22.5zM384 1123v-99h-335v99h107q0 41 0.5 122t0.5 121v12h-2q-8 -17 -50 -54l-71 76l136 127h106v-404h108zM1792 736v-192q0 -13 -9.5 -22.5t-22.5 -9.5h-1216q-13 0 -22.5 9.5 t-9.5 22.5v192q0 14 9 23t23 9h1216q13 0 22.5 -9.5t9.5 -22.5zM1792 1248v-192q0 -13 -9.5 -22.5t-22.5 -9.5h-1216q-13 0 -22.5 9.5t-9.5 22.5v192q0 13 9.5 22.5t22.5 9.5h1216q13 0 22.5 -9.5t9.5 -22.5z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1760 640q14 0 23 -9t9 -23v-64q0 -14 -9 -23t-23 -9h-1728q-14 0 -23 9t-9 23v64q0 14 9 23t23 9h1728zM483 704q-28 35 -51 80q-48 97 -48 188q0 181 134 309q133 127 393 127q50 0 167 -19q66 -12 177 -48q10 -38 21 -118q14 -123 14 -183q0 -18 -5 -45l-12 -3l-84 6 l-14 2q-50 149 -103 205q-88 91 -210 91q-114 0 -182 -59q-67 -58 -67 -146q0 -73 66 -140t279 -129q69 -20 173 -66q58 -28 95 -52h-743zM990 448h411q7 -39 7 -92q0 -111 -41 -212q-23 -55 -71 -104q-37 -35 -109 -81q-80 -48 -153 -66q-80 -21 -203 -21q-114 0 -195 23 l-140 40q-57 16 -72 28q-8 8 -8 22v13q0 108 -2 156q-1 30 0 68l2 37v44l102 2q15 -34 30 -71t22.5 -56t12.5 -27q35 -57 80 -94q43 -36 105 -57q59 -22 132 -22q64 0 139 27q77 26 122 86q47 61 47 129q0 84 -81 157q-34 29 -137 71z" /> +<glyph unicode="" d="M48 1313q-37 2 -45 4l-3 88q13 1 40 1q60 0 112 -4q132 -7 166 -7q86 0 168 3q116 4 146 5q56 0 86 2l-1 -14l2 -64v-9q-60 -9 -124 -9q-60 0 -79 -25q-13 -14 -13 -132q0 -13 0.5 -32.5t0.5 -25.5l1 -229l14 -280q6 -124 51 -202q35 -59 96 -92q88 -47 177 -47 q104 0 191 28q56 18 99 51q48 36 65 64q36 56 53 114q21 73 21 229q0 79 -3.5 128t-11 122.5t-13.5 159.5l-4 59q-5 67 -24 88q-34 35 -77 34l-100 -2l-14 3l2 86h84l205 -10q76 -3 196 10l18 -2q6 -38 6 -51q0 -7 -4 -31q-45 -12 -84 -13q-73 -11 -79 -17q-15 -15 -15 -41 q0 -7 1.5 -27t1.5 -31q8 -19 22 -396q6 -195 -15 -304q-15 -76 -41 -122q-38 -65 -112 -123q-75 -57 -182 -89q-109 -33 -255 -33q-167 0 -284 46q-119 47 -179 122q-61 76 -83 195q-16 80 -16 237v333q0 188 -17 213q-25 36 -147 39zM1536 -96v64q0 14 -9 23t-23 9h-1472 q-14 0 -23 -9t-9 -23v-64q0 -14 9 -23t23 -9h1472q14 0 23 9t9 23z" /> +<glyph unicode="" horiz-adv-x="1664" d="M512 160v192q0 14 -9 23t-23 9h-320q-14 0 -23 -9t-9 -23v-192q0 -14 9 -23t23 -9h320q14 0 23 9t9 23zM512 544v192q0 14 -9 23t-23 9h-320q-14 0 -23 -9t-9 -23v-192q0 -14 9 -23t23 -9h320q14 0 23 9t9 23zM1024 160v192q0 14 -9 23t-23 9h-320q-14 0 -23 -9t-9 -23 v-192q0 -14 9 -23t23 -9h320q14 0 23 9t9 23zM512 928v192q0 14 -9 23t-23 9h-320q-14 0 -23 -9t-9 -23v-192q0 -14 9 -23t23 -9h320q14 0 23 9t9 23zM1024 544v192q0 14 -9 23t-23 9h-320q-14 0 -23 -9t-9 -23v-192q0 -14 9 -23t23 -9h320q14 0 23 9t9 23zM1536 160v192 q0 14 -9 23t-23 9h-320q-14 0 -23 -9t-9 -23v-192q0 -14 9 -23t23 -9h320q14 0 23 9t9 23zM1024 928v192q0 14 -9 23t-23 9h-320q-14 0 -23 -9t-9 -23v-192q0 -14 9 -23t23 -9h320q14 0 23 9t9 23zM1536 544v192q0 14 -9 23t-23 9h-320q-14 0 -23 -9t-9 -23v-192 q0 -14 9 -23t23 -9h320q14 0 23 9t9 23zM1536 928v192q0 14 -9 23t-23 9h-320q-14 0 -23 -9t-9 -23v-192q0 -14 9 -23t23 -9h320q14 0 23 9t9 23zM1664 1248v-1088q0 -66 -47 -113t-113 -47h-1344q-66 0 -113 47t-47 113v1088q0 66 47 113t113 47h1344q66 0 113 -47t47 -113 z" /> +<glyph unicode="" horiz-adv-x="1664" d="M1190 955l293 293l-107 107l-293 -293zM1637 1248q0 -27 -18 -45l-1286 -1286q-18 -18 -45 -18t-45 18l-198 198q-18 18 -18 45t18 45l1286 1286q18 18 45 18t45 -18l198 -198q18 -18 18 -45zM286 1438l98 -30l-98 -30l-30 -98l-30 98l-98 30l98 30l30 98zM636 1276 l196 -60l-196 -60l-60 -196l-60 196l-196 60l196 60l60 196zM1566 798l98 -30l-98 -30l-30 -98l-30 98l-98 30l98 30l30 98zM926 1438l98 -30l-98 -30l-30 -98l-30 98l-98 30l98 30l30 98z" /> +<glyph unicode="" horiz-adv-x="1792" d="M640 128q0 52 -38 90t-90 38t-90 -38t-38 -90t38 -90t90 -38t90 38t38 90zM256 640h384v256h-158q-13 0 -22 -9l-195 -195q-9 -9 -9 -22v-30zM1536 128q0 52 -38 90t-90 38t-90 -38t-38 -90t38 -90t90 -38t90 38t38 90zM1792 1216v-1024q0 -15 -4 -26.5t-13.5 -18.5 t-16.5 -11.5t-23.5 -6t-22.5 -2t-25.5 0t-22.5 0.5q0 -106 -75 -181t-181 -75t-181 75t-75 181h-384q0 -106 -75 -181t-181 -75t-181 75t-75 181h-64q-3 0 -22.5 -0.5t-25.5 0t-22.5 2t-23.5 6t-16.5 11.5t-13.5 18.5t-4 26.5q0 26 19 45t45 19v320q0 8 -0.5 35t0 38 t2.5 34.5t6.5 37t14 30.5t22.5 30l198 198q19 19 50.5 32t58.5 13h160v192q0 26 19 45t45 19h1024q26 0 45 -19t19 -45z" /> +<glyph unicode="" d="M1536 640q0 -209 -103 -385.5t-279.5 -279.5t-385.5 -103q-111 0 -218 32q59 93 78 164q9 34 54 211q20 -39 73 -67.5t114 -28.5q121 0 216 68.5t147 188.5t52 270q0 114 -59.5 214t-172.5 163t-255 63q-105 0 -196 -29t-154.5 -77t-109 -110.5t-67 -129.5t-21.5 -134 q0 -104 40 -183t117 -111q30 -12 38 20q2 7 8 31t8 30q6 23 -11 43q-51 61 -51 151q0 151 104.5 259.5t273.5 108.5q151 0 235.5 -82t84.5 -213q0 -170 -68.5 -289t-175.5 -119q-61 0 -98 43.5t-23 104.5q8 35 26.5 93.5t30 103t11.5 75.5q0 50 -27 83t-77 33 q-62 0 -105 -57t-43 -142q0 -73 25 -122l-99 -418q-17 -70 -13 -177q-206 91 -333 281t-127 423q0 209 103 385.5t279.5 279.5t385.5 103t385.5 -103t279.5 -279.5t103 -385.5z" /> +<glyph unicode="" d="M1248 1408q119 0 203.5 -84.5t84.5 -203.5v-960q0 -119 -84.5 -203.5t-203.5 -84.5h-725q85 122 108 210q9 34 53 209q21 -39 73.5 -67t112.5 -28q181 0 295.5 147.5t114.5 373.5q0 84 -35 162.5t-96.5 139t-152.5 97t-197 36.5q-104 0 -194.5 -28.5t-153 -76.5 t-107.5 -109.5t-66.5 -128t-21.5 -132.5q0 -102 39.5 -180t116.5 -110q13 -5 23.5 0t14.5 19q10 44 15 61q6 23 -11 42q-50 62 -50 150q0 150 103.5 256.5t270.5 106.5q149 0 232.5 -81t83.5 -210q0 -168 -67.5 -286t-173.5 -118q-60 0 -97 43.5t-23 103.5q8 34 26.5 92.5 t29.5 102t11 74.5q0 49 -26.5 81.5t-75.5 32.5q-61 0 -103.5 -56.5t-42.5 -139.5q0 -72 24 -121l-98 -414q-24 -100 -7 -254h-183q-119 0 -203.5 84.5t-84.5 203.5v960q0 119 84.5 203.5t203.5 84.5h960z" /> +<glyph unicode="" d="M917 631q0 26 -6 64h-362v-132h217q-3 -24 -16.5 -50t-37.5 -53t-66.5 -44.5t-96.5 -17.5q-99 0 -169 71t-70 171t70 171t169 71q92 0 153 -59l104 101q-108 100 -257 100q-160 0 -272 -112.5t-112 -271.5t112 -271.5t272 -112.5q165 0 266.5 105t101.5 270zM1262 585 h109v110h-109v110h-110v-110h-110v-110h110v-110h110v110zM1536 1120v-960q0 -119 -84.5 -203.5t-203.5 -84.5h-960q-119 0 -203.5 84.5t-84.5 203.5v960q0 119 84.5 203.5t203.5 84.5h960q119 0 203.5 -84.5t84.5 -203.5z" /> +<glyph unicode="" horiz-adv-x="2304" d="M1437 623q0 -208 -87 -370.5t-248 -254t-369 -91.5q-149 0 -285 58t-234 156t-156 234t-58 285t58 285t156 234t234 156t285 58q286 0 491 -192l-199 -191q-117 113 -292 113q-123 0 -227.5 -62t-165.5 -168.5t-61 -232.5t61 -232.5t165.5 -168.5t227.5 -62 q83 0 152.5 23t114.5 57.5t78.5 78.5t49 83t21.5 74h-416v252h692q12 -63 12 -122zM2304 745v-210h-209v-209h-210v209h-209v210h209v209h210v-209h209z" /> +<glyph unicode="" horiz-adv-x="1920" d="M768 384h384v96h-128v448h-114l-148 -137l77 -80q42 37 55 57h2v-288h-128v-96zM1280 640q0 -70 -21 -142t-59.5 -134t-101.5 -101t-138 -39t-138 39t-101.5 101t-59.5 134t-21 142t21 142t59.5 134t101.5 101t138 39t138 -39t101.5 -101t59.5 -134t21 -142zM1792 384 v512q-106 0 -181 75t-75 181h-1152q0 -106 -75 -181t-181 -75v-512q106 0 181 -75t75 -181h1152q0 106 75 181t181 75zM1920 1216v-1152q0 -26 -19 -45t-45 -19h-1792q-26 0 -45 19t-19 45v1152q0 26 19 45t45 19h1792q26 0 45 -19t19 -45z" /> +<glyph unicode="" horiz-adv-x="1024" d="M1024 832q0 -26 -19 -45l-448 -448q-19 -19 -45 -19t-45 19l-448 448q-19 19 -19 45t19 45t45 19h896q26 0 45 -19t19 -45z" /> +<glyph unicode="" horiz-adv-x="1024" d="M1024 320q0 -26 -19 -45t-45 -19h-896q-26 0 -45 19t-19 45t19 45l448 448q19 19 45 19t45 -19l448 -448q19 -19 19 -45z" /> +<glyph unicode="" horiz-adv-x="640" d="M640 1088v-896q0 -26 -19 -45t-45 -19t-45 19l-448 448q-19 19 -19 45t19 45l448 448q19 19 45 19t45 -19t19 -45z" /> +<glyph unicode="" horiz-adv-x="640" d="M576 640q0 -26 -19 -45l-448 -448q-19 -19 -45 -19t-45 19t-19 45v896q0 26 19 45t45 19t45 -19l448 -448q19 -19 19 -45z" /> +<glyph unicode="" horiz-adv-x="1664" d="M160 0h608v1152h-640v-1120q0 -13 9.5 -22.5t22.5 -9.5zM1536 32v1120h-640v-1152h608q13 0 22.5 9.5t9.5 22.5zM1664 1248v-1216q0 -66 -47 -113t-113 -47h-1344q-66 0 -113 47t-47 113v1216q0 66 47 113t113 47h1344q66 0 113 -47t47 -113z" /> +<glyph unicode="" horiz-adv-x="1024" d="M1024 448q0 -26 -19 -45l-448 -448q-19 -19 -45 -19t-45 19l-448 448q-19 19 -19 45t19 45t45 19h896q26 0 45 -19t19 -45zM1024 832q0 -26 -19 -45t-45 -19h-896q-26 0 -45 19t-19 45t19 45l448 448q19 19 45 19t45 -19l448 -448q19 -19 19 -45z" /> +<glyph unicode="" horiz-adv-x="1024" d="M1024 448q0 -26 -19 -45l-448 -448q-19 -19 -45 -19t-45 19l-448 448q-19 19 -19 45t19 45t45 19h896q26 0 45 -19t19 -45z" /> +<glyph unicode="" horiz-adv-x="1024" d="M1024 832q0 -26 -19 -45t-45 -19h-896q-26 0 -45 19t-19 45t19 45l448 448q19 19 45 19t45 -19l448 -448q19 -19 19 -45z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1792 826v-794q0 -66 -47 -113t-113 -47h-1472q-66 0 -113 47t-47 113v794q44 -49 101 -87q362 -246 497 -345q57 -42 92.5 -65.5t94.5 -48t110 -24.5h1h1q51 0 110 24.5t94.5 48t92.5 65.5q170 123 498 345q57 39 100 87zM1792 1120q0 -79 -49 -151t-122 -123 q-376 -261 -468 -325q-10 -7 -42.5 -30.5t-54 -38t-52 -32.5t-57.5 -27t-50 -9h-1h-1q-23 0 -50 9t-57.5 27t-52 32.5t-54 38t-42.5 30.5q-91 64 -262 182.5t-205 142.5q-62 42 -117 115.5t-55 136.5q0 78 41.5 130t118.5 52h1472q65 0 112.5 -47t47.5 -113z" /> +<glyph unicode="" d="M349 911v-991h-330v991h330zM370 1217q1 -73 -50.5 -122t-135.5 -49h-2q-82 0 -132 49t-50 122q0 74 51.5 122.5t134.5 48.5t133 -48.5t51 -122.5zM1536 488v-568h-329v530q0 105 -40.5 164.5t-126.5 59.5q-63 0 -105.5 -34.5t-63.5 -85.5q-11 -30 -11 -81v-553h-329 q2 399 2 647t-1 296l-1 48h329v-144h-2q20 32 41 56t56.5 52t87 43.5t114.5 15.5q171 0 275 -113.5t104 -332.5z" /> +<glyph unicode="" d="M1536 640q0 -156 -61 -298t-164 -245t-245 -164t-298 -61q-172 0 -327 72.5t-264 204.5q-7 10 -6.5 22.5t8.5 20.5l137 138q10 9 25 9q16 -2 23 -12q73 -95 179 -147t225 -52q104 0 198.5 40.5t163.5 109.5t109.5 163.5t40.5 198.5t-40.5 198.5t-109.5 163.5 t-163.5 109.5t-198.5 40.5q-98 0 -188 -35.5t-160 -101.5l137 -138q31 -30 14 -69q-17 -40 -59 -40h-448q-26 0 -45 19t-19 45v448q0 42 40 59q39 17 69 -14l130 -129q107 101 244.5 156.5t284.5 55.5q156 0 298 -61t245 -164t164 -245t61 -298z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1771 0q0 -53 -37 -90l-107 -108q-39 -37 -91 -37q-53 0 -90 37l-363 364q-38 36 -38 90q0 53 43 96l-256 256l-126 -126q-14 -14 -34 -14t-34 14q2 -2 12.5 -12t12.5 -13t10 -11.5t10 -13.5t6 -13.5t5.5 -16.5t1.5 -18q0 -38 -28 -68q-3 -3 -16.5 -18t-19 -20.5 t-18.5 -16.5t-22 -15.5t-22 -9t-26 -4.5q-40 0 -68 28l-408 408q-28 28 -28 68q0 13 4.5 26t9 22t15.5 22t16.5 18.5t20.5 19t18 16.5q30 28 68 28q10 0 18 -1.5t16.5 -5.5t13.5 -6t13.5 -10t11.5 -10t13 -12.5t12 -12.5q-14 14 -14 34t14 34l348 348q14 14 34 14t34 -14 q-2 2 -12.5 12t-12.5 13t-10 11.5t-10 13.5t-6 13.5t-5.5 16.5t-1.5 18q0 38 28 68q3 3 16.5 18t19 20.5t18.5 16.5t22 15.5t22 9t26 4.5q40 0 68 -28l408 -408q28 -28 28 -68q0 -13 -4.5 -26t-9 -22t-15.5 -22t-16.5 -18.5t-20.5 -19t-18 -16.5q-30 -28 -68 -28 q-10 0 -18 1.5t-16.5 5.5t-13.5 6t-13.5 10t-11.5 10t-13 12.5t-12 12.5q14 -14 14 -34t-14 -34l-126 -126l256 -256q43 43 96 43q52 0 91 -37l363 -363q37 -39 37 -91z" /> +<glyph unicode="" horiz-adv-x="1792" d="M384 384q0 53 -37.5 90.5t-90.5 37.5t-90.5 -37.5t-37.5 -90.5t37.5 -90.5t90.5 -37.5t90.5 37.5t37.5 90.5zM576 832q0 53 -37.5 90.5t-90.5 37.5t-90.5 -37.5t-37.5 -90.5t37.5 -90.5t90.5 -37.5t90.5 37.5t37.5 90.5zM1004 351l101 382q6 26 -7.5 48.5t-38.5 29.5 t-48 -6.5t-30 -39.5l-101 -382q-60 -5 -107 -43.5t-63 -98.5q-20 -77 20 -146t117 -89t146 20t89 117q16 60 -6 117t-72 91zM1664 384q0 53 -37.5 90.5t-90.5 37.5t-90.5 -37.5t-37.5 -90.5t37.5 -90.5t90.5 -37.5t90.5 37.5t37.5 90.5zM1024 1024q0 53 -37.5 90.5 t-90.5 37.5t-90.5 -37.5t-37.5 -90.5t37.5 -90.5t90.5 -37.5t90.5 37.5t37.5 90.5zM1472 832q0 53 -37.5 90.5t-90.5 37.5t-90.5 -37.5t-37.5 -90.5t37.5 -90.5t90.5 -37.5t90.5 37.5t37.5 90.5zM1792 384q0 -261 -141 -483q-19 -29 -54 -29h-1402q-35 0 -54 29 q-141 221 -141 483q0 182 71 348t191 286t286 191t348 71t348 -71t286 -191t191 -286t71 -348z" /> +<glyph unicode="" horiz-adv-x="1792" d="M896 1152q-204 0 -381.5 -69.5t-282 -187.5t-104.5 -255q0 -112 71.5 -213.5t201.5 -175.5l87 -50l-27 -96q-24 -91 -70 -172q152 63 275 171l43 38l57 -6q69 -8 130 -8q204 0 381.5 69.5t282 187.5t104.5 255t-104.5 255t-282 187.5t-381.5 69.5zM1792 640 q0 -174 -120 -321.5t-326 -233t-450 -85.5q-70 0 -145 8q-198 -175 -460 -242q-49 -14 -114 -22h-5q-15 0 -27 10.5t-16 27.5v1q-3 4 -0.5 12t2 10t4.5 9.5l6 9t7 8.5t8 9q7 8 31 34.5t34.5 38t31 39.5t32.5 51t27 59t26 76q-157 89 -247.5 220t-90.5 281q0 174 120 321.5 t326 233t450 85.5t450 -85.5t326 -233t120 -321.5z" /> +<glyph unicode="" horiz-adv-x="1792" d="M704 1152q-153 0 -286 -52t-211.5 -141t-78.5 -191q0 -82 53 -158t149 -132l97 -56l-35 -84q34 20 62 39l44 31l53 -10q78 -14 153 -14q153 0 286 52t211.5 141t78.5 191t-78.5 191t-211.5 141t-286 52zM704 1280q191 0 353.5 -68.5t256.5 -186.5t94 -257t-94 -257 t-256.5 -186.5t-353.5 -68.5q-86 0 -176 16q-124 -88 -278 -128q-36 -9 -86 -16h-3q-11 0 -20.5 8t-11.5 21q-1 3 -1 6.5t0.5 6.5t2 6l2.5 5t3.5 5.5t4 5t4.5 5t4 4.5q5 6 23 25t26 29.5t22.5 29t25 38.5t20.5 44q-124 72 -195 177t-71 224q0 139 94 257t256.5 186.5 t353.5 68.5zM1526 111q10 -24 20.5 -44t25 -38.5t22.5 -29t26 -29.5t23 -25q1 -1 4 -4.5t4.5 -5t4 -5t3.5 -5.5l2.5 -5t2 -6t0.5 -6.5t-1 -6.5q-3 -14 -13 -22t-22 -7q-50 7 -86 16q-154 40 -278 128q-90 -16 -176 -16q-271 0 -472 132q58 -4 88 -4q161 0 309 45t264 129 q125 92 192 212t67 254q0 77 -23 152q129 -71 204 -178t75 -230q0 -120 -71 -224.5t-195 -176.5z" /> +<glyph unicode="" horiz-adv-x="896" d="M885 970q18 -20 7 -44l-540 -1157q-13 -25 -42 -25q-4 0 -14 2q-17 5 -25.5 19t-4.5 30l197 808l-406 -101q-4 -1 -12 -1q-18 0 -31 11q-18 15 -13 39l201 825q4 14 16 23t28 9h328q19 0 32 -12.5t13 -29.5q0 -8 -5 -18l-171 -463l396 98q8 2 12 2q19 0 34 -15z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1792 288v-320q0 -40 -28 -68t-68 -28h-320q-40 0 -68 28t-28 68v320q0 40 28 68t68 28h96v192h-512v-192h96q40 0 68 -28t28 -68v-320q0 -40 -28 -68t-68 -28h-320q-40 0 -68 28t-28 68v320q0 40 28 68t68 28h96v192h-512v-192h96q40 0 68 -28t28 -68v-320 q0 -40 -28 -68t-68 -28h-320q-40 0 -68 28t-28 68v320q0 40 28 68t68 28h96v192q0 52 38 90t90 38h512v192h-96q-40 0 -68 28t-28 68v320q0 40 28 68t68 28h320q40 0 68 -28t28 -68v-320q0 -40 -28 -68t-68 -28h-96v-192h512q52 0 90 -38t38 -90v-192h96q40 0 68 -28t28 -68 z" /> +<glyph unicode="" horiz-adv-x="1664" d="M896 708v-580q0 -104 -76 -180t-180 -76t-180 76t-76 180q0 26 19 45t45 19t45 -19t19 -45q0 -50 39 -89t89 -39t89 39t39 89v580q33 11 64 11t64 -11zM1664 681q0 -13 -9.5 -22.5t-22.5 -9.5q-11 0 -23 10q-49 46 -93 69t-102 23q-68 0 -128 -37t-103 -97 q-7 -10 -17.5 -28t-14.5 -24q-11 -17 -28 -17q-18 0 -29 17q-4 6 -14.5 24t-17.5 28q-43 60 -102.5 97t-127.5 37t-127.5 -37t-102.5 -97q-7 -10 -17.5 -28t-14.5 -24q-11 -17 -29 -17q-17 0 -28 17q-4 6 -14.5 24t-17.5 28q-43 60 -103 97t-128 37q-58 0 -102 -23t-93 -69 q-12 -10 -23 -10q-13 0 -22.5 9.5t-9.5 22.5q0 5 1 7q45 183 172.5 319.5t298 204.5t360.5 68q140 0 274.5 -40t246.5 -113.5t194.5 -187t115.5 -251.5q1 -2 1 -7zM896 1408v-98q-42 2 -64 2t-64 -2v98q0 26 19 45t45 19t45 -19t19 -45z" /> +<glyph unicode="" horiz-adv-x="1792" d="M768 -128h896v640h-416q-40 0 -68 28t-28 68v416h-384v-1152zM1024 1312v64q0 13 -9.5 22.5t-22.5 9.5h-704q-13 0 -22.5 -9.5t-9.5 -22.5v-64q0 -13 9.5 -22.5t22.5 -9.5h704q13 0 22.5 9.5t9.5 22.5zM1280 640h299l-299 299v-299zM1792 512v-672q0 -40 -28 -68t-68 -28 h-960q-40 0 -68 28t-28 68v160h-544q-40 0 -68 28t-28 68v1344q0 40 28 68t68 28h1088q40 0 68 -28t28 -68v-328q21 -13 36 -28l408 -408q28 -28 48 -76t20 -88z" /> +<glyph unicode="" horiz-adv-x="1024" d="M736 960q0 -13 -9.5 -22.5t-22.5 -9.5t-22.5 9.5t-9.5 22.5q0 46 -54 71t-106 25q-13 0 -22.5 9.5t-9.5 22.5t9.5 22.5t22.5 9.5q50 0 99.5 -16t87 -54t37.5 -90zM896 960q0 72 -34.5 134t-90 101.5t-123 62t-136.5 22.5t-136.5 -22.5t-123 -62t-90 -101.5t-34.5 -134 q0 -101 68 -180q10 -11 30.5 -33t30.5 -33q128 -153 141 -298h228q13 145 141 298q10 11 30.5 33t30.5 33q68 79 68 180zM1024 960q0 -155 -103 -268q-45 -49 -74.5 -87t-59.5 -95.5t-34 -107.5q47 -28 47 -82q0 -37 -25 -64q25 -27 25 -64q0 -52 -45 -81q13 -23 13 -47 q0 -46 -31.5 -71t-77.5 -25q-20 -44 -60 -70t-87 -26t-87 26t-60 70q-46 0 -77.5 25t-31.5 71q0 24 13 47q-45 29 -45 81q0 37 25 64q-25 27 -25 64q0 54 47 82q-4 50 -34 107.5t-59.5 95.5t-74.5 87q-103 113 -103 268q0 99 44.5 184.5t117 142t164 89t186.5 32.5 t186.5 -32.5t164 -89t117 -142t44.5 -184.5z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1792 352v-192q0 -13 -9.5 -22.5t-22.5 -9.5h-1376v-192q0 -13 -9.5 -22.5t-22.5 -9.5q-12 0 -24 10l-319 320q-9 9 -9 22q0 14 9 23l320 320q9 9 23 9q13 0 22.5 -9.5t9.5 -22.5v-192h1376q13 0 22.5 -9.5t9.5 -22.5zM1792 896q0 -14 -9 -23l-320 -320q-9 -9 -23 -9 q-13 0 -22.5 9.5t-9.5 22.5v192h-1376q-13 0 -22.5 9.5t-9.5 22.5v192q0 13 9.5 22.5t22.5 9.5h1376v192q0 14 9 23t23 9q12 0 24 -10l319 -319q9 -9 9 -23z" /> +<glyph unicode="" horiz-adv-x="1920" d="M1280 608q0 14 -9 23t-23 9h-224v352q0 13 -9.5 22.5t-22.5 9.5h-192q-13 0 -22.5 -9.5t-9.5 -22.5v-352h-224q-13 0 -22.5 -9.5t-9.5 -22.5q0 -14 9 -23l352 -352q9 -9 23 -9t23 9l351 351q10 12 10 24zM1920 384q0 -159 -112.5 -271.5t-271.5 -112.5h-1088 q-185 0 -316.5 131.5t-131.5 316.5q0 130 70 240t188 165q-2 30 -2 43q0 212 150 362t362 150q156 0 285.5 -87t188.5 -231q71 62 166 62q106 0 181 -75t75 -181q0 -76 -41 -138q130 -31 213.5 -135.5t83.5 -238.5z" /> +<glyph unicode="" horiz-adv-x="1920" d="M1280 672q0 14 -9 23l-352 352q-9 9 -23 9t-23 -9l-351 -351q-10 -12 -10 -24q0 -14 9 -23t23 -9h224v-352q0 -13 9.5 -22.5t22.5 -9.5h192q13 0 22.5 9.5t9.5 22.5v352h224q13 0 22.5 9.5t9.5 22.5zM1920 384q0 -159 -112.5 -271.5t-271.5 -112.5h-1088 q-185 0 -316.5 131.5t-131.5 316.5q0 130 70 240t188 165q-2 30 -2 43q0 212 150 362t362 150q156 0 285.5 -87t188.5 -231q71 62 166 62q106 0 181 -75t75 -181q0 -76 -41 -138q130 -31 213.5 -135.5t83.5 -238.5z" /> +<glyph unicode="" horiz-adv-x="1408" d="M384 192q0 -26 -19 -45t-45 -19t-45 19t-19 45t19 45t45 19t45 -19t19 -45zM1408 131q0 -121 -73 -190t-194 -69h-874q-121 0 -194 69t-73 190q0 68 5.5 131t24 138t47.5 132.5t81 103t120 60.5q-22 -52 -22 -120v-203q-58 -20 -93 -70t-35 -111q0 -80 56 -136t136 -56 t136 56t56 136q0 61 -35.5 111t-92.5 70v203q0 62 25 93q132 -104 295 -104t295 104q25 -31 25 -93v-64q-106 0 -181 -75t-75 -181v-89q-32 -29 -32 -71q0 -40 28 -68t68 -28t68 28t28 68q0 42 -32 71v89q0 52 38 90t90 38t90 -38t38 -90v-89q-32 -29 -32 -71q0 -40 28 -68 t68 -28t68 28t28 68q0 42 -32 71v89q0 68 -34.5 127.5t-93.5 93.5q0 10 0.5 42.5t0 48t-2.5 41.5t-7 47t-13 40q68 -15 120 -60.5t81 -103t47.5 -132.5t24 -138t5.5 -131zM1088 1024q0 -159 -112.5 -271.5t-271.5 -112.5t-271.5 112.5t-112.5 271.5t112.5 271.5t271.5 112.5 t271.5 -112.5t112.5 -271.5z" /> +<glyph unicode="" horiz-adv-x="1408" d="M1280 832q0 26 -19 45t-45 19t-45 -19t-19 -45t19 -45t45 -19t45 19t19 45zM1408 832q0 -62 -35.5 -111t-92.5 -70v-395q0 -159 -131.5 -271.5t-316.5 -112.5t-316.5 112.5t-131.5 271.5v132q-164 20 -274 128t-110 252v512q0 26 19 45t45 19q6 0 16 -2q17 30 47 48 t65 18q53 0 90.5 -37.5t37.5 -90.5t-37.5 -90.5t-90.5 -37.5q-33 0 -64 18v-402q0 -106 94 -181t226 -75t226 75t94 181v402q-31 -18 -64 -18q-53 0 -90.5 37.5t-37.5 90.5t37.5 90.5t90.5 37.5q35 0 65 -18t47 -48q10 2 16 2q26 0 45 -19t19 -45v-512q0 -144 -110 -252 t-274 -128v-132q0 -106 94 -181t226 -75t226 75t94 181v395q-57 21 -92.5 70t-35.5 111q0 80 56 136t136 56t136 -56t56 -136z" /> +<glyph unicode="" horiz-adv-x="1792" d="M640 1152h512v128h-512v-128zM288 1152v-1280h-64q-92 0 -158 66t-66 158v832q0 92 66 158t158 66h64zM1408 1152v-1280h-1024v1280h128v160q0 40 28 68t68 28h576q40 0 68 -28t28 -68v-160h128zM1792 928v-832q0 -92 -66 -158t-158 -66h-64v1280h64q92 0 158 -66 t66 -158z" /> +<glyph unicode="" horiz-adv-x="1792" d="M912 -160q0 16 -16 16q-59 0 -101.5 42.5t-42.5 101.5q0 16 -16 16t-16 -16q0 -73 51.5 -124.5t124.5 -51.5q16 0 16 16zM1728 128q0 -52 -38 -90t-90 -38h-448q0 -106 -75 -181t-181 -75t-181 75t-75 181h-448q-52 0 -90 38t-38 90q50 42 91 88t85 119.5t74.5 158.5 t50 206t19.5 260q0 152 117 282.5t307 158.5q-8 19 -8 39q0 40 28 68t68 28t68 -28t28 -68q0 -20 -8 -39q190 -28 307 -158.5t117 -282.5q0 -139 19.5 -260t50 -206t74.5 -158.5t85 -119.5t91 -88z" /> +<glyph unicode="" horiz-adv-x="1920" d="M1664 896q0 80 -56 136t-136 56h-64v-384h64q80 0 136 56t56 136zM0 128h1792q0 -106 -75 -181t-181 -75h-1280q-106 0 -181 75t-75 181zM1856 896q0 -159 -112.5 -271.5t-271.5 -112.5h-64v-32q0 -92 -66 -158t-158 -66h-704q-92 0 -158 66t-66 158v736q0 26 19 45 t45 19h1152q159 0 271.5 -112.5t112.5 -271.5z" /> +<glyph unicode="" horiz-adv-x="1408" d="M640 1472v-640q0 -61 -35.5 -111t-92.5 -70v-779q0 -52 -38 -90t-90 -38h-128q-52 0 -90 38t-38 90v779q-57 20 -92.5 70t-35.5 111v640q0 26 19 45t45 19t45 -19t19 -45v-416q0 -26 19 -45t45 -19t45 19t19 45v416q0 26 19 45t45 19t45 -19t19 -45v-416q0 -26 19 -45 t45 -19t45 19t19 45v416q0 26 19 45t45 19t45 -19t19 -45zM1408 1472v-1600q0 -52 -38 -90t-90 -38h-128q-52 0 -90 38t-38 90v512h-224q-13 0 -22.5 9.5t-9.5 22.5v800q0 132 94 226t226 94h256q26 0 45 -19t19 -45z" /> +<glyph unicode="" d="M1468 1156q28 -28 48 -76t20 -88v-1152q0 -40 -28 -68t-68 -28h-1344q-40 0 -68 28t-28 68v1600q0 40 28 68t68 28h896q40 0 88 -20t76 -48zM1024 1400v-376h376q-10 29 -22 41l-313 313q-12 12 -41 22zM1408 -128v1024h-416q-40 0 -68 28t-28 68v416h-768v-1536h1280z M384 736q0 14 9 23t23 9h704q14 0 23 -9t9 -23v-64q0 -14 -9 -23t-23 -9h-704q-14 0 -23 9t-9 23v64zM1120 512q14 0 23 -9t9 -23v-64q0 -14 -9 -23t-23 -9h-704q-14 0 -23 9t-9 23v64q0 14 9 23t23 9h704zM1120 256q14 0 23 -9t9 -23v-64q0 -14 -9 -23t-23 -9h-704 q-14 0 -23 9t-9 23v64q0 14 9 23t23 9h704z" /> +<glyph unicode="" horiz-adv-x="1408" d="M384 224v-64q0 -13 -9.5 -22.5t-22.5 -9.5h-64q-13 0 -22.5 9.5t-9.5 22.5v64q0 13 9.5 22.5t22.5 9.5h64q13 0 22.5 -9.5t9.5 -22.5zM384 480v-64q0 -13 -9.5 -22.5t-22.5 -9.5h-64q-13 0 -22.5 9.5t-9.5 22.5v64q0 13 9.5 22.5t22.5 9.5h64q13 0 22.5 -9.5t9.5 -22.5z M640 480v-64q0 -13 -9.5 -22.5t-22.5 -9.5h-64q-13 0 -22.5 9.5t-9.5 22.5v64q0 13 9.5 22.5t22.5 9.5h64q13 0 22.5 -9.5t9.5 -22.5zM384 736v-64q0 -13 -9.5 -22.5t-22.5 -9.5h-64q-13 0 -22.5 9.5t-9.5 22.5v64q0 13 9.5 22.5t22.5 9.5h64q13 0 22.5 -9.5t9.5 -22.5z M1152 224v-64q0 -13 -9.5 -22.5t-22.5 -9.5h-64q-13 0 -22.5 9.5t-9.5 22.5v64q0 13 9.5 22.5t22.5 9.5h64q13 0 22.5 -9.5t9.5 -22.5zM896 480v-64q0 -13 -9.5 -22.5t-22.5 -9.5h-64q-13 0 -22.5 9.5t-9.5 22.5v64q0 13 9.5 22.5t22.5 9.5h64q13 0 22.5 -9.5t9.5 -22.5z M640 736v-64q0 -13 -9.5 -22.5t-22.5 -9.5h-64q-13 0 -22.5 9.5t-9.5 22.5v64q0 13 9.5 22.5t22.5 9.5h64q13 0 22.5 -9.5t9.5 -22.5zM384 992v-64q0 -13 -9.5 -22.5t-22.5 -9.5h-64q-13 0 -22.5 9.5t-9.5 22.5v64q0 13 9.5 22.5t22.5 9.5h64q13 0 22.5 -9.5t9.5 -22.5z M1152 480v-64q0 -13 -9.5 -22.5t-22.5 -9.5h-64q-13 0 -22.5 9.5t-9.5 22.5v64q0 13 9.5 22.5t22.5 9.5h64q13 0 22.5 -9.5t9.5 -22.5zM896 736v-64q0 -13 -9.5 -22.5t-22.5 -9.5h-64q-13 0 -22.5 9.5t-9.5 22.5v64q0 13 9.5 22.5t22.5 9.5h64q13 0 22.5 -9.5t9.5 -22.5z M640 992v-64q0 -13 -9.5 -22.5t-22.5 -9.5h-64q-13 0 -22.5 9.5t-9.5 22.5v64q0 13 9.5 22.5t22.5 9.5h64q13 0 22.5 -9.5t9.5 -22.5zM384 1248v-64q0 -13 -9.5 -22.5t-22.5 -9.5h-64q-13 0 -22.5 9.5t-9.5 22.5v64q0 13 9.5 22.5t22.5 9.5h64q13 0 22.5 -9.5t9.5 -22.5z M1152 736v-64q0 -13 -9.5 -22.5t-22.5 -9.5h-64q-13 0 -22.5 9.5t-9.5 22.5v64q0 13 9.5 22.5t22.5 9.5h64q13 0 22.5 -9.5t9.5 -22.5zM896 992v-64q0 -13 -9.5 -22.5t-22.5 -9.5h-64q-13 0 -22.5 9.5t-9.5 22.5v64q0 13 9.5 22.5t22.5 9.5h64q13 0 22.5 -9.5t9.5 -22.5z M640 1248v-64q0 -13 -9.5 -22.5t-22.5 -9.5h-64q-13 0 -22.5 9.5t-9.5 22.5v64q0 13 9.5 22.5t22.5 9.5h64q13 0 22.5 -9.5t9.5 -22.5zM1152 992v-64q0 -13 -9.5 -22.5t-22.5 -9.5h-64q-13 0 -22.5 9.5t-9.5 22.5v64q0 13 9.5 22.5t22.5 9.5h64q13 0 22.5 -9.5t9.5 -22.5z M896 1248v-64q0 -13 -9.5 -22.5t-22.5 -9.5h-64q-13 0 -22.5 9.5t-9.5 22.5v64q0 13 9.5 22.5t22.5 9.5h64q13 0 22.5 -9.5t9.5 -22.5zM1152 1248v-64q0 -13 -9.5 -22.5t-22.5 -9.5h-64q-13 0 -22.5 9.5t-9.5 22.5v64q0 13 9.5 22.5t22.5 9.5h64q13 0 22.5 -9.5t9.5 -22.5z M896 -128h384v1536h-1152v-1536h384v224q0 13 9.5 22.5t22.5 9.5h320q13 0 22.5 -9.5t9.5 -22.5v-224zM1408 1472v-1664q0 -26 -19 -45t-45 -19h-1280q-26 0 -45 19t-19 45v1664q0 26 19 45t45 19h1280q26 0 45 -19t19 -45z" /> +<glyph unicode="" horiz-adv-x="1408" d="M384 224v-64q0 -13 -9.5 -22.5t-22.5 -9.5h-64q-13 0 -22.5 9.5t-9.5 22.5v64q0 13 9.5 22.5t22.5 9.5h64q13 0 22.5 -9.5t9.5 -22.5zM384 480v-64q0 -13 -9.5 -22.5t-22.5 -9.5h-64q-13 0 -22.5 9.5t-9.5 22.5v64q0 13 9.5 22.5t22.5 9.5h64q13 0 22.5 -9.5t9.5 -22.5z M640 480v-64q0 -13 -9.5 -22.5t-22.5 -9.5h-64q-13 0 -22.5 9.5t-9.5 22.5v64q0 13 9.5 22.5t22.5 9.5h64q13 0 22.5 -9.5t9.5 -22.5zM384 736v-64q0 -13 -9.5 -22.5t-22.5 -9.5h-64q-13 0 -22.5 9.5t-9.5 22.5v64q0 13 9.5 22.5t22.5 9.5h64q13 0 22.5 -9.5t9.5 -22.5z M1152 224v-64q0 -13 -9.5 -22.5t-22.5 -9.5h-64q-13 0 -22.5 9.5t-9.5 22.5v64q0 13 9.5 22.5t22.5 9.5h64q13 0 22.5 -9.5t9.5 -22.5zM896 480v-64q0 -13 -9.5 -22.5t-22.5 -9.5h-64q-13 0 -22.5 9.5t-9.5 22.5v64q0 13 9.5 22.5t22.5 9.5h64q13 0 22.5 -9.5t9.5 -22.5z M640 736v-64q0 -13 -9.5 -22.5t-22.5 -9.5h-64q-13 0 -22.5 9.5t-9.5 22.5v64q0 13 9.5 22.5t22.5 9.5h64q13 0 22.5 -9.5t9.5 -22.5zM1152 480v-64q0 -13 -9.5 -22.5t-22.5 -9.5h-64q-13 0 -22.5 9.5t-9.5 22.5v64q0 13 9.5 22.5t22.5 9.5h64q13 0 22.5 -9.5t9.5 -22.5z M896 736v-64q0 -13 -9.5 -22.5t-22.5 -9.5h-64q-13 0 -22.5 9.5t-9.5 22.5v64q0 13 9.5 22.5t22.5 9.5h64q13 0 22.5 -9.5t9.5 -22.5zM1152 736v-64q0 -13 -9.5 -22.5t-22.5 -9.5h-64q-13 0 -22.5 9.5t-9.5 22.5v64q0 13 9.5 22.5t22.5 9.5h64q13 0 22.5 -9.5t9.5 -22.5z M896 -128h384v1152h-256v-32q0 -40 -28 -68t-68 -28h-448q-40 0 -68 28t-28 68v32h-256v-1152h384v224q0 13 9.5 22.5t22.5 9.5h320q13 0 22.5 -9.5t9.5 -22.5v-224zM896 1056v320q0 13 -9.5 22.5t-22.5 9.5h-64q-13 0 -22.5 -9.5t-9.5 -22.5v-96h-128v96q0 13 -9.5 22.5 t-22.5 9.5h-64q-13 0 -22.5 -9.5t-9.5 -22.5v-320q0 -13 9.5 -22.5t22.5 -9.5h64q13 0 22.5 9.5t9.5 22.5v96h128v-96q0 -13 9.5 -22.5t22.5 -9.5h64q13 0 22.5 9.5t9.5 22.5zM1408 1088v-1280q0 -26 -19 -45t-45 -19h-1280q-26 0 -45 19t-19 45v1280q0 26 19 45t45 19h320 v288q0 40 28 68t68 28h448q40 0 68 -28t28 -68v-288h320q26 0 45 -19t19 -45z" /> +<glyph unicode="" horiz-adv-x="1920" d="M640 128q0 53 -37.5 90.5t-90.5 37.5t-90.5 -37.5t-37.5 -90.5t37.5 -90.5t90.5 -37.5t90.5 37.5t37.5 90.5zM256 640h384v256h-158q-14 -2 -22 -9l-195 -195q-7 -12 -9 -22v-30zM1536 128q0 53 -37.5 90.5t-90.5 37.5t-90.5 -37.5t-37.5 -90.5t37.5 -90.5t90.5 -37.5 t90.5 37.5t37.5 90.5zM1664 800v192q0 14 -9 23t-23 9h-224v224q0 14 -9 23t-23 9h-192q-14 0 -23 -9t-9 -23v-224h-224q-14 0 -23 -9t-9 -23v-192q0 -14 9 -23t23 -9h224v-224q0 -14 9 -23t23 -9h192q14 0 23 9t9 23v224h224q14 0 23 9t9 23zM1920 1344v-1152 q0 -26 -19 -45t-45 -19h-192q0 -106 -75 -181t-181 -75t-181 75t-75 181h-384q0 -106 -75 -181t-181 -75t-181 75t-75 181h-128q-26 0 -45 19t-19 45t19 45t45 19v416q0 26 13 58t32 51l198 198q19 19 51 32t58 13h160v320q0 26 19 45t45 19h1152q26 0 45 -19t19 -45z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1280 416v192q0 14 -9 23t-23 9h-224v224q0 14 -9 23t-23 9h-192q-14 0 -23 -9t-9 -23v-224h-224q-14 0 -23 -9t-9 -23v-192q0 -14 9 -23t23 -9h224v-224q0 -14 9 -23t23 -9h192q14 0 23 9t9 23v224h224q14 0 23 9t9 23zM640 1152h512v128h-512v-128zM256 1152v-1280h-32 q-92 0 -158 66t-66 158v832q0 92 66 158t158 66h32zM1440 1152v-1280h-1088v1280h160v160q0 40 28 68t68 28h576q40 0 68 -28t28 -68v-160h160zM1792 928v-832q0 -92 -66 -158t-158 -66h-32v1280h32q92 0 158 -66t66 -158z" /> +<glyph unicode="" horiz-adv-x="1920" d="M1920 576q-1 -32 -288 -96l-352 -32l-224 -64h-64l-293 -352h69q26 0 45 -4.5t19 -11.5t-19 -11.5t-45 -4.5h-96h-160h-64v32h64v416h-160l-192 -224h-96l-32 32v192h32v32h128v8l-192 24v128l192 24v8h-128v32h-32v192l32 32h96l192 -224h160v416h-64v32h64h160h96 q26 0 45 -4.5t19 -11.5t-19 -11.5t-45 -4.5h-69l293 -352h64l224 -64l352 -32q261 -58 287 -93z" /> +<glyph unicode="" horiz-adv-x="1664" d="M640 640v384h-256v-256q0 -53 37.5 -90.5t90.5 -37.5h128zM1664 192v-192h-1152v192l128 192h-128q-159 0 -271.5 112.5t-112.5 271.5v320l-64 64l32 128h480l32 128h960l32 -192l-64 -32v-800z" /> +<glyph unicode="" d="M1280 192v896q0 26 -19 45t-45 19h-128q-26 0 -45 -19t-19 -45v-320h-512v320q0 26 -19 45t-45 19h-128q-26 0 -45 -19t-19 -45v-896q0 -26 19 -45t45 -19h128q26 0 45 19t19 45v320h512v-320q0 -26 19 -45t45 -19h128q26 0 45 19t19 45zM1536 1120v-960 q0 -119 -84.5 -203.5t-203.5 -84.5h-960q-119 0 -203.5 84.5t-84.5 203.5v960q0 119 84.5 203.5t203.5 84.5h960q119 0 203.5 -84.5t84.5 -203.5z" /> +<glyph unicode="" d="M1280 576v128q0 26 -19 45t-45 19h-320v320q0 26 -19 45t-45 19h-128q-26 0 -45 -19t-19 -45v-320h-320q-26 0 -45 -19t-19 -45v-128q0 -26 19 -45t45 -19h320v-320q0 -26 19 -45t45 -19h128q26 0 45 19t19 45v320h320q26 0 45 19t19 45zM1536 1120v-960 q0 -119 -84.5 -203.5t-203.5 -84.5h-960q-119 0 -203.5 84.5t-84.5 203.5v960q0 119 84.5 203.5t203.5 84.5h960q119 0 203.5 -84.5t84.5 -203.5z" /> +<glyph unicode="" horiz-adv-x="1024" d="M627 160q0 -13 -10 -23l-50 -50q-10 -10 -23 -10t-23 10l-466 466q-10 10 -10 23t10 23l466 466q10 10 23 10t23 -10l50 -50q10 -10 10 -23t-10 -23l-393 -393l393 -393q10 -10 10 -23zM1011 160q0 -13 -10 -23l-50 -50q-10 -10 -23 -10t-23 10l-466 466q-10 10 -10 23 t10 23l466 466q10 10 23 10t23 -10l50 -50q10 -10 10 -23t-10 -23l-393 -393l393 -393q10 -10 10 -23z" /> +<glyph unicode="" horiz-adv-x="1024" d="M595 576q0 -13 -10 -23l-466 -466q-10 -10 -23 -10t-23 10l-50 50q-10 10 -10 23t10 23l393 393l-393 393q-10 10 -10 23t10 23l50 50q10 10 23 10t23 -10l466 -466q10 -10 10 -23zM979 576q0 -13 -10 -23l-466 -466q-10 -10 -23 -10t-23 10l-50 50q-10 10 -10 23t10 23 l393 393l-393 393q-10 10 -10 23t10 23l50 50q10 10 23 10t23 -10l466 -466q10 -10 10 -23z" /> +<glyph unicode="" horiz-adv-x="1152" d="M1075 224q0 -13 -10 -23l-50 -50q-10 -10 -23 -10t-23 10l-393 393l-393 -393q-10 -10 -23 -10t-23 10l-50 50q-10 10 -10 23t10 23l466 466q10 10 23 10t23 -10l466 -466q10 -10 10 -23zM1075 608q0 -13 -10 -23l-50 -50q-10 -10 -23 -10t-23 10l-393 393l-393 -393 q-10 -10 -23 -10t-23 10l-50 50q-10 10 -10 23t10 23l466 466q10 10 23 10t23 -10l466 -466q10 -10 10 -23z" /> +<glyph unicode="" horiz-adv-x="1152" d="M1075 672q0 -13 -10 -23l-466 -466q-10 -10 -23 -10t-23 10l-466 466q-10 10 -10 23t10 23l50 50q10 10 23 10t23 -10l393 -393l393 393q10 10 23 10t23 -10l50 -50q10 -10 10 -23zM1075 1056q0 -13 -10 -23l-466 -466q-10 -10 -23 -10t-23 10l-466 466q-10 10 -10 23 t10 23l50 50q10 10 23 10t23 -10l393 -393l393 393q10 10 23 10t23 -10l50 -50q10 -10 10 -23z" /> +<glyph unicode="" horiz-adv-x="640" d="M627 992q0 -13 -10 -23l-393 -393l393 -393q10 -10 10 -23t-10 -23l-50 -50q-10 -10 -23 -10t-23 10l-466 466q-10 10 -10 23t10 23l466 466q10 10 23 10t23 -10l50 -50q10 -10 10 -23z" /> +<glyph unicode="" horiz-adv-x="640" d="M595 576q0 -13 -10 -23l-466 -466q-10 -10 -23 -10t-23 10l-50 50q-10 10 -10 23t10 23l393 393l-393 393q-10 10 -10 23t10 23l50 50q10 10 23 10t23 -10l466 -466q10 -10 10 -23z" /> +<glyph unicode="" horiz-adv-x="1152" d="M1075 352q0 -13 -10 -23l-50 -50q-10 -10 -23 -10t-23 10l-393 393l-393 -393q-10 -10 -23 -10t-23 10l-50 50q-10 10 -10 23t10 23l466 466q10 10 23 10t23 -10l466 -466q10 -10 10 -23z" /> +<glyph unicode="" horiz-adv-x="1152" d="M1075 800q0 -13 -10 -23l-466 -466q-10 -10 -23 -10t-23 10l-466 466q-10 10 -10 23t10 23l50 50q10 10 23 10t23 -10l393 -393l393 393q10 10 23 10t23 -10l50 -50q10 -10 10 -23z" /> +<glyph unicode="" horiz-adv-x="1920" d="M1792 544v832q0 13 -9.5 22.5t-22.5 9.5h-1600q-13 0 -22.5 -9.5t-9.5 -22.5v-832q0 -13 9.5 -22.5t22.5 -9.5h1600q13 0 22.5 9.5t9.5 22.5zM1920 1376v-1088q0 -66 -47 -113t-113 -47h-544q0 -37 16 -77.5t32 -71t16 -43.5q0 -26 -19 -45t-45 -19h-512q-26 0 -45 19 t-19 45q0 14 16 44t32 70t16 78h-544q-66 0 -113 47t-47 113v1088q0 66 47 113t113 47h1600q66 0 113 -47t47 -113z" /> +<glyph unicode="" horiz-adv-x="1920" d="M416 256q-66 0 -113 47t-47 113v704q0 66 47 113t113 47h1088q66 0 113 -47t47 -113v-704q0 -66 -47 -113t-113 -47h-1088zM384 1120v-704q0 -13 9.5 -22.5t22.5 -9.5h1088q13 0 22.5 9.5t9.5 22.5v704q0 13 -9.5 22.5t-22.5 9.5h-1088q-13 0 -22.5 -9.5t-9.5 -22.5z M1760 192h160v-96q0 -40 -47 -68t-113 -28h-1600q-66 0 -113 28t-47 68v96h160h1600zM1040 96q16 0 16 16t-16 16h-160q-16 0 -16 -16t16 -16h160z" /> +<glyph unicode="" horiz-adv-x="1152" d="M640 128q0 26 -19 45t-45 19t-45 -19t-19 -45t19 -45t45 -19t45 19t19 45zM1024 288v960q0 13 -9.5 22.5t-22.5 9.5h-832q-13 0 -22.5 -9.5t-9.5 -22.5v-960q0 -13 9.5 -22.5t22.5 -9.5h832q13 0 22.5 9.5t9.5 22.5zM1152 1248v-1088q0 -66 -47 -113t-113 -47h-832 q-66 0 -113 47t-47 113v1088q0 66 47 113t113 47h832q66 0 113 -47t47 -113z" /> +<glyph unicode="" horiz-adv-x="768" d="M464 128q0 33 -23.5 56.5t-56.5 23.5t-56.5 -23.5t-23.5 -56.5t23.5 -56.5t56.5 -23.5t56.5 23.5t23.5 56.5zM672 288v704q0 13 -9.5 22.5t-22.5 9.5h-512q-13 0 -22.5 -9.5t-9.5 -22.5v-704q0 -13 9.5 -22.5t22.5 -9.5h512q13 0 22.5 9.5t9.5 22.5zM480 1136 q0 16 -16 16h-160q-16 0 -16 -16t16 -16h160q16 0 16 16zM768 1152v-1024q0 -52 -38 -90t-90 -38h-512q-52 0 -90 38t-38 90v1024q0 52 38 90t90 38h512q52 0 90 -38t38 -90z" /> +<glyph unicode="" d="M768 1184q-148 0 -273 -73t-198 -198t-73 -273t73 -273t198 -198t273 -73t273 73t198 198t73 273t-73 273t-198 198t-273 73zM1536 640q0 -209 -103 -385.5t-279.5 -279.5t-385.5 -103t-385.5 103t-279.5 279.5t-103 385.5t103 385.5t279.5 279.5t385.5 103t385.5 -103 t279.5 -279.5t103 -385.5z" /> +<glyph unicode="" horiz-adv-x="1664" d="M768 576v-384q0 -80 -56 -136t-136 -56h-384q-80 0 -136 56t-56 136v704q0 104 40.5 198.5t109.5 163.5t163.5 109.5t198.5 40.5h64q26 0 45 -19t19 -45v-128q0 -26 -19 -45t-45 -19h-64q-106 0 -181 -75t-75 -181v-32q0 -40 28 -68t68 -28h224q80 0 136 -56t56 -136z M1664 576v-384q0 -80 -56 -136t-136 -56h-384q-80 0 -136 56t-56 136v704q0 104 40.5 198.5t109.5 163.5t163.5 109.5t198.5 40.5h64q26 0 45 -19t19 -45v-128q0 -26 -19 -45t-45 -19h-64q-106 0 -181 -75t-75 -181v-32q0 -40 28 -68t68 -28h224q80 0 136 -56t56 -136z" /> +<glyph unicode="" horiz-adv-x="1664" d="M768 1216v-704q0 -104 -40.5 -198.5t-109.5 -163.5t-163.5 -109.5t-198.5 -40.5h-64q-26 0 -45 19t-19 45v128q0 26 19 45t45 19h64q106 0 181 75t75 181v32q0 40 -28 68t-68 28h-224q-80 0 -136 56t-56 136v384q0 80 56 136t136 56h384q80 0 136 -56t56 -136zM1664 1216 v-704q0 -104 -40.5 -198.5t-109.5 -163.5t-163.5 -109.5t-198.5 -40.5h-64q-26 0 -45 19t-19 45v128q0 26 19 45t45 19h64q106 0 181 75t75 181v32q0 40 -28 68t-68 28h-224q-80 0 -136 56t-56 136v384q0 80 56 136t136 56h384q80 0 136 -56t56 -136z" /> +<glyph unicode="" horiz-adv-x="1792" d="M526 142q0 -53 -37.5 -90.5t-90.5 -37.5q-52 0 -90 38t-38 90q0 53 37.5 90.5t90.5 37.5t90.5 -37.5t37.5 -90.5zM1024 -64q0 -53 -37.5 -90.5t-90.5 -37.5t-90.5 37.5t-37.5 90.5t37.5 90.5t90.5 37.5t90.5 -37.5t37.5 -90.5zM320 640q0 -53 -37.5 -90.5t-90.5 -37.5 t-90.5 37.5t-37.5 90.5t37.5 90.5t90.5 37.5t90.5 -37.5t37.5 -90.5zM1522 142q0 -52 -38 -90t-90 -38q-53 0 -90.5 37.5t-37.5 90.5t37.5 90.5t90.5 37.5t90.5 -37.5t37.5 -90.5zM558 1138q0 -66 -47 -113t-113 -47t-113 47t-47 113t47 113t113 47t113 -47t47 -113z M1728 640q0 -53 -37.5 -90.5t-90.5 -37.5t-90.5 37.5t-37.5 90.5t37.5 90.5t90.5 37.5t90.5 -37.5t37.5 -90.5zM1088 1344q0 -80 -56 -136t-136 -56t-136 56t-56 136t56 136t136 56t136 -56t56 -136zM1618 1138q0 -93 -66 -158.5t-158 -65.5q-93 0 -158.5 65.5t-65.5 158.5 q0 92 65.5 158t158.5 66q92 0 158 -66t66 -158z" /> +<glyph unicode="" d="M1536 640q0 -209 -103 -385.5t-279.5 -279.5t-385.5 -103t-385.5 103t-279.5 279.5t-103 385.5t103 385.5t279.5 279.5t385.5 103t385.5 -103t279.5 -279.5t103 -385.5z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1792 416q0 -166 -127 -451q-3 -7 -10.5 -24t-13.5 -30t-13 -22q-12 -17 -28 -17q-15 0 -23.5 10t-8.5 25q0 9 2.5 26.5t2.5 23.5q5 68 5 123q0 101 -17.5 181t-48.5 138.5t-80 101t-105.5 69.5t-133 42.5t-154 21.5t-175.5 6h-224v-256q0 -26 -19 -45t-45 -19t-45 19 l-512 512q-19 19 -19 45t19 45l512 512q19 19 45 19t45 -19t19 -45v-256h224q713 0 875 -403q53 -134 53 -333z" /> +<glyph unicode="" horiz-adv-x="1664" d="M640 320q0 -40 -12.5 -82t-43 -76t-72.5 -34t-72.5 34t-43 76t-12.5 82t12.5 82t43 76t72.5 34t72.5 -34t43 -76t12.5 -82zM1280 320q0 -40 -12.5 -82t-43 -76t-72.5 -34t-72.5 34t-43 76t-12.5 82t12.5 82t43 76t72.5 34t72.5 -34t43 -76t12.5 -82zM1440 320 q0 120 -69 204t-187 84q-41 0 -195 -21q-71 -11 -157 -11t-157 11q-152 21 -195 21q-118 0 -187 -84t-69 -204q0 -88 32 -153.5t81 -103t122 -60t140 -29.5t149 -7h168q82 0 149 7t140 29.5t122 60t81 103t32 153.5zM1664 496q0 -207 -61 -331q-38 -77 -105.5 -133t-141 -86 t-170 -47.5t-171.5 -22t-167 -4.5q-78 0 -142 3t-147.5 12.5t-152.5 30t-137 51.5t-121 81t-86 115q-62 123 -62 331q0 237 136 396q-27 82 -27 170q0 116 51 218q108 0 190 -39.5t189 -123.5q147 35 309 35q148 0 280 -32q105 82 187 121t189 39q51 -102 51 -218 q0 -87 -27 -168q136 -160 136 -398z" /> +<glyph unicode="" horiz-adv-x="1664" d="M1536 224v704q0 40 -28 68t-68 28h-704q-40 0 -68 28t-28 68v64q0 40 -28 68t-68 28h-320q-40 0 -68 -28t-28 -68v-960q0 -40 28 -68t68 -28h1216q40 0 68 28t28 68zM1664 928v-704q0 -92 -66 -158t-158 -66h-1216q-92 0 -158 66t-66 158v960q0 92 66 158t158 66h320 q92 0 158 -66t66 -158v-32h672q92 0 158 -66t66 -158z" /> +<glyph unicode="" horiz-adv-x="1920" d="M1781 605q0 35 -53 35h-1088q-40 0 -85.5 -21.5t-71.5 -52.5l-294 -363q-18 -24 -18 -40q0 -35 53 -35h1088q40 0 86 22t71 53l294 363q18 22 18 39zM640 768h768v160q0 40 -28 68t-68 28h-576q-40 0 -68 28t-28 68v64q0 40 -28 68t-68 28h-320q-40 0 -68 -28t-28 -68 v-853l256 315q44 53 116 87.5t140 34.5zM1909 605q0 -62 -46 -120l-295 -363q-43 -53 -116 -87.5t-140 -34.5h-1088q-92 0 -158 66t-66 158v960q0 92 66 158t158 66h320q92 0 158 -66t66 -158v-32h544q92 0 158 -66t66 -158v-160h192q54 0 99 -24.5t67 -70.5q15 -32 15 -68z " /> +<glyph unicode="" horiz-adv-x="1792" /> +<glyph unicode="" horiz-adv-x="1792" /> +<glyph unicode="" d="M1134 461q-37 -121 -138 -195t-228 -74t-228 74t-138 195q-8 25 4 48.5t38 31.5q25 8 48.5 -4t31.5 -38q25 -80 92.5 -129.5t151.5 -49.5t151.5 49.5t92.5 129.5q8 26 32 38t49 4t37 -31.5t4 -48.5zM640 896q0 -53 -37.5 -90.5t-90.5 -37.5t-90.5 37.5t-37.5 90.5 t37.5 90.5t90.5 37.5t90.5 -37.5t37.5 -90.5zM1152 896q0 -53 -37.5 -90.5t-90.5 -37.5t-90.5 37.5t-37.5 90.5t37.5 90.5t90.5 37.5t90.5 -37.5t37.5 -90.5zM1408 640q0 130 -51 248.5t-136.5 204t-204 136.5t-248.5 51t-248.5 -51t-204 -136.5t-136.5 -204t-51 -248.5 t51 -248.5t136.5 -204t204 -136.5t248.5 -51t248.5 51t204 136.5t136.5 204t51 248.5zM1536 640q0 -209 -103 -385.5t-279.5 -279.5t-385.5 -103t-385.5 103t-279.5 279.5t-103 385.5t103 385.5t279.5 279.5t385.5 103t385.5 -103t279.5 -279.5t103 -385.5z" /> +<glyph unicode="" d="M1134 307q8 -25 -4 -48.5t-37 -31.5t-49 4t-32 38q-25 80 -92.5 129.5t-151.5 49.5t-151.5 -49.5t-92.5 -129.5q-8 -26 -31.5 -38t-48.5 -4q-26 8 -38 31.5t-4 48.5q37 121 138 195t228 74t228 -74t138 -195zM640 896q0 -53 -37.5 -90.5t-90.5 -37.5t-90.5 37.5 t-37.5 90.5t37.5 90.5t90.5 37.5t90.5 -37.5t37.5 -90.5zM1152 896q0 -53 -37.5 -90.5t-90.5 -37.5t-90.5 37.5t-37.5 90.5t37.5 90.5t90.5 37.5t90.5 -37.5t37.5 -90.5zM1408 640q0 130 -51 248.5t-136.5 204t-204 136.5t-248.5 51t-248.5 -51t-204 -136.5t-136.5 -204 t-51 -248.5t51 -248.5t136.5 -204t204 -136.5t248.5 -51t248.5 51t204 136.5t136.5 204t51 248.5zM1536 640q0 -209 -103 -385.5t-279.5 -279.5t-385.5 -103t-385.5 103t-279.5 279.5t-103 385.5t103 385.5t279.5 279.5t385.5 103t385.5 -103t279.5 -279.5t103 -385.5z" /> +<glyph unicode="" d="M1152 448q0 -26 -19 -45t-45 -19h-640q-26 0 -45 19t-19 45t19 45t45 19h640q26 0 45 -19t19 -45zM640 896q0 -53 -37.5 -90.5t-90.5 -37.5t-90.5 37.5t-37.5 90.5t37.5 90.5t90.5 37.5t90.5 -37.5t37.5 -90.5zM1152 896q0 -53 -37.5 -90.5t-90.5 -37.5t-90.5 37.5 t-37.5 90.5t37.5 90.5t90.5 37.5t90.5 -37.5t37.5 -90.5zM1408 640q0 130 -51 248.5t-136.5 204t-204 136.5t-248.5 51t-248.5 -51t-204 -136.5t-136.5 -204t-51 -248.5t51 -248.5t136.5 -204t204 -136.5t248.5 -51t248.5 51t204 136.5t136.5 204t51 248.5zM1536 640 q0 -209 -103 -385.5t-279.5 -279.5t-385.5 -103t-385.5 103t-279.5 279.5t-103 385.5t103 385.5t279.5 279.5t385.5 103t385.5 -103t279.5 -279.5t103 -385.5z" /> +<glyph unicode="" horiz-adv-x="1920" d="M832 448v128q0 14 -9 23t-23 9h-192v192q0 14 -9 23t-23 9h-128q-14 0 -23 -9t-9 -23v-192h-192q-14 0 -23 -9t-9 -23v-128q0 -14 9 -23t23 -9h192v-192q0 -14 9 -23t23 -9h128q14 0 23 9t9 23v192h192q14 0 23 9t9 23zM1408 384q0 53 -37.5 90.5t-90.5 37.5t-90.5 -37.5 t-37.5 -90.5t37.5 -90.5t90.5 -37.5t90.5 37.5t37.5 90.5zM1664 640q0 53 -37.5 90.5t-90.5 37.5t-90.5 -37.5t-37.5 -90.5t37.5 -90.5t90.5 -37.5t90.5 37.5t37.5 90.5zM1920 512q0 -212 -150 -362t-362 -150q-192 0 -338 128h-220q-146 -128 -338 -128q-212 0 -362 150 t-150 362t150 362t362 150h896q212 0 362 -150t150 -362z" /> +<glyph unicode="" horiz-adv-x="1920" d="M384 368v-96q0 -16 -16 -16h-96q-16 0 -16 16v96q0 16 16 16h96q16 0 16 -16zM512 624v-96q0 -16 -16 -16h-224q-16 0 -16 16v96q0 16 16 16h224q16 0 16 -16zM384 880v-96q0 -16 -16 -16h-96q-16 0 -16 16v96q0 16 16 16h96q16 0 16 -16zM1408 368v-96q0 -16 -16 -16 h-864q-16 0 -16 16v96q0 16 16 16h864q16 0 16 -16zM768 624v-96q0 -16 -16 -16h-96q-16 0 -16 16v96q0 16 16 16h96q16 0 16 -16zM640 880v-96q0 -16 -16 -16h-96q-16 0 -16 16v96q0 16 16 16h96q16 0 16 -16zM1024 624v-96q0 -16 -16 -16h-96q-16 0 -16 16v96q0 16 16 16 h96q16 0 16 -16zM896 880v-96q0 -16 -16 -16h-96q-16 0 -16 16v96q0 16 16 16h96q16 0 16 -16zM1280 624v-96q0 -16 -16 -16h-96q-16 0 -16 16v96q0 16 16 16h96q16 0 16 -16zM1664 368v-96q0 -16 -16 -16h-96q-16 0 -16 16v96q0 16 16 16h96q16 0 16 -16zM1152 880v-96 q0 -16 -16 -16h-96q-16 0 -16 16v96q0 16 16 16h96q16 0 16 -16zM1408 880v-96q0 -16 -16 -16h-96q-16 0 -16 16v96q0 16 16 16h96q16 0 16 -16zM1664 880v-352q0 -16 -16 -16h-224q-16 0 -16 16v96q0 16 16 16h112v240q0 16 16 16h96q16 0 16 -16zM1792 128v896h-1664v-896 h1664zM1920 1024v-896q0 -53 -37.5 -90.5t-90.5 -37.5h-1664q-53 0 -90.5 37.5t-37.5 90.5v896q0 53 37.5 90.5t90.5 37.5h1664q53 0 90.5 -37.5t37.5 -90.5z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1664 491v616q-169 -91 -306 -91q-82 0 -145 32q-100 49 -184 76.5t-178 27.5q-173 0 -403 -127v-599q245 113 433 113q55 0 103.5 -7.5t98 -26t77 -31t82.5 -39.5l28 -14q44 -22 101 -22q120 0 293 92zM320 1280q0 -35 -17.5 -64t-46.5 -46v-1266q0 -14 -9 -23t-23 -9 h-64q-14 0 -23 9t-9 23v1266q-29 17 -46.5 46t-17.5 64q0 53 37.5 90.5t90.5 37.5t90.5 -37.5t37.5 -90.5zM1792 1216v-763q0 -39 -35 -57q-10 -5 -17 -9q-218 -116 -369 -116q-88 0 -158 35l-28 14q-64 33 -99 48t-91 29t-114 14q-102 0 -235.5 -44t-228.5 -102 q-15 -9 -33 -9q-16 0 -32 8q-32 19 -32 56v742q0 35 31 55q35 21 78.5 42.5t114 52t152.5 49.5t155 19q112 0 209 -31t209 -86q38 -19 89 -19q122 0 310 112q22 12 31 17q31 16 62 -2q31 -20 31 -55z" /> +<glyph unicode="" horiz-adv-x="1792" d="M832 536v192q-181 -16 -384 -117v-185q205 96 384 110zM832 954v197q-172 -8 -384 -126v-189q215 111 384 118zM1664 491v184q-235 -116 -384 -71v224q-20 6 -39 15q-5 3 -33 17t-34.5 17t-31.5 15t-34.5 15.5t-32.5 13t-36 12.5t-35 8.5t-39.5 7.5t-39.5 4t-44 2 q-23 0 -49 -3v-222h19q102 0 192.5 -29t197.5 -82q19 -9 39 -15v-188q42 -17 91 -17q120 0 293 92zM1664 918v189q-169 -91 -306 -91q-45 0 -78 8v-196q148 -42 384 90zM320 1280q0 -35 -17.5 -64t-46.5 -46v-1266q0 -14 -9 -23t-23 -9h-64q-14 0 -23 9t-9 23v1266 q-29 17 -46.5 46t-17.5 64q0 53 37.5 90.5t90.5 37.5t90.5 -37.5t37.5 -90.5zM1792 1216v-763q0 -39 -35 -57q-10 -5 -17 -9q-218 -116 -369 -116q-88 0 -158 35l-28 14q-64 33 -99 48t-91 29t-114 14q-102 0 -235.5 -44t-228.5 -102q-15 -9 -33 -9q-16 0 -32 8 q-32 19 -32 56v742q0 35 31 55q35 21 78.5 42.5t114 52t152.5 49.5t155 19q112 0 209 -31t209 -86q38 -19 89 -19q122 0 310 112q22 12 31 17q31 16 62 -2q31 -20 31 -55z" /> +<glyph unicode="" horiz-adv-x="1664" d="M585 553l-466 -466q-10 -10 -23 -10t-23 10l-50 50q-10 10 -10 23t10 23l393 393l-393 393q-10 10 -10 23t10 23l50 50q10 10 23 10t23 -10l466 -466q10 -10 10 -23t-10 -23zM1664 96v-64q0 -14 -9 -23t-23 -9h-960q-14 0 -23 9t-9 23v64q0 14 9 23t23 9h960q14 0 23 -9 t9 -23z" /> +<glyph unicode="" horiz-adv-x="1920" d="M617 137l-50 -50q-10 -10 -23 -10t-23 10l-466 466q-10 10 -10 23t10 23l466 466q10 10 23 10t23 -10l50 -50q10 -10 10 -23t-10 -23l-393 -393l393 -393q10 -10 10 -23t-10 -23zM1208 1204l-373 -1291q-4 -13 -15.5 -19.5t-23.5 -2.5l-62 17q-13 4 -19.5 15.5t-2.5 24.5 l373 1291q4 13 15.5 19.5t23.5 2.5l62 -17q13 -4 19.5 -15.5t2.5 -24.5zM1865 553l-466 -466q-10 -10 -23 -10t-23 10l-50 50q-10 10 -10 23t10 23l393 393l-393 393q-10 10 -10 23t10 23l50 50q10 10 23 10t23 -10l466 -466q10 -10 10 -23t-10 -23z" /> +<glyph unicode="" horiz-adv-x="1792" d="M640 454v-70q0 -42 -39 -59q-13 -5 -25 -5q-27 0 -45 19l-512 512q-19 19 -19 45t19 45l512 512q29 31 70 14q39 -17 39 -59v-69l-397 -398q-19 -19 -19 -45t19 -45zM1792 416q0 -58 -17 -133.5t-38.5 -138t-48 -125t-40.5 -90.5l-20 -40q-8 -17 -28 -17q-6 0 -9 1 q-25 8 -23 34q43 400 -106 565q-64 71 -170.5 110.5t-267.5 52.5v-251q0 -42 -39 -59q-13 -5 -25 -5q-27 0 -45 19l-512 512q-19 19 -19 45t19 45l512 512q29 31 70 14q39 -17 39 -59v-262q411 -28 599 -221q169 -173 169 -509z" /> +<glyph unicode="" horiz-adv-x="1664" d="M1186 579l257 250l-356 52l-66 10l-30 60l-159 322v-963l59 -31l318 -168l-60 355l-12 66zM1638 841l-363 -354l86 -500q5 -33 -6 -51.5t-34 -18.5q-17 0 -40 12l-449 236l-449 -236q-23 -12 -40 -12q-23 0 -34 18.5t-6 51.5l86 500l-364 354q-32 32 -23 59.5t54 34.5 l502 73l225 455q20 41 49 41q28 0 49 -41l225 -455l502 -73q45 -7 54 -34.5t-24 -59.5z" /> +<glyph unicode="" horiz-adv-x="1408" d="M1401 1187l-640 -1280q-17 -35 -57 -35q-5 0 -15 2q-22 5 -35.5 22.5t-13.5 39.5v576h-576q-22 0 -39.5 13.5t-22.5 35.5t4 42t29 30l1280 640q13 7 29 7q27 0 45 -19q15 -14 18.5 -34.5t-6.5 -39.5z" /> +<glyph unicode="" horiz-adv-x="1664" d="M557 256h595v595zM512 301l595 595h-595v-595zM1664 224v-192q0 -14 -9 -23t-23 -9h-224v-224q0 -14 -9 -23t-23 -9h-192q-14 0 -23 9t-9 23v224h-864q-14 0 -23 9t-9 23v864h-224q-14 0 -23 9t-9 23v192q0 14 9 23t23 9h224v224q0 14 9 23t23 9h192q14 0 23 -9t9 -23 v-224h851l246 247q10 9 23 9t23 -9q9 -10 9 -23t-9 -23l-247 -246v-851h224q14 0 23 -9t9 -23z" /> +<glyph unicode="" horiz-adv-x="1024" d="M288 64q0 40 -28 68t-68 28t-68 -28t-28 -68t28 -68t68 -28t68 28t28 68zM288 1216q0 40 -28 68t-68 28t-68 -28t-28 -68t28 -68t68 -28t68 28t28 68zM928 1088q0 40 -28 68t-68 28t-68 -28t-28 -68t28 -68t68 -28t68 28t28 68zM1024 1088q0 -52 -26 -96.5t-70 -69.5 q-2 -287 -226 -414q-68 -38 -203 -81q-128 -40 -169.5 -71t-41.5 -100v-26q44 -25 70 -69.5t26 -96.5q0 -80 -56 -136t-136 -56t-136 56t-56 136q0 52 26 96.5t70 69.5v820q-44 25 -70 69.5t-26 96.5q0 80 56 136t136 56t136 -56t56 -136q0 -52 -26 -96.5t-70 -69.5v-497 q54 26 154 57q55 17 87.5 29.5t70.5 31t59 39.5t40.5 51t28 69.5t8.5 91.5q-44 25 -70 69.5t-26 96.5q0 80 56 136t136 56t136 -56t56 -136z" /> +<glyph unicode="" horiz-adv-x="1664" d="M439 265l-256 -256q-10 -9 -23 -9q-12 0 -23 9q-9 10 -9 23t9 23l256 256q10 9 23 9t23 -9q9 -10 9 -23t-9 -23zM608 224v-320q0 -14 -9 -23t-23 -9t-23 9t-9 23v320q0 14 9 23t23 9t23 -9t9 -23zM384 448q0 -14 -9 -23t-23 -9h-320q-14 0 -23 9t-9 23t9 23t23 9h320 q14 0 23 -9t9 -23zM1648 320q0 -120 -85 -203l-147 -146q-83 -83 -203 -83q-121 0 -204 85l-334 335q-21 21 -42 56l239 18l273 -274q27 -27 68 -27.5t68 26.5l147 146q28 28 28 67q0 40 -28 68l-274 275l18 239q35 -21 56 -42l336 -336q84 -86 84 -204zM1031 1044l-239 -18 l-273 274q-28 28 -68 28q-39 0 -68 -27l-147 -146q-28 -28 -28 -67q0 -40 28 -68l274 -274l-18 -240q-35 21 -56 42l-336 336q-84 86 -84 204q0 120 85 203l147 146q83 83 203 83q121 0 204 -85l334 -335q21 -21 42 -56zM1664 960q0 -14 -9 -23t-23 -9h-320q-14 0 -23 9 t-9 23t9 23t23 9h320q14 0 23 -9t9 -23zM1120 1504v-320q0 -14 -9 -23t-23 -9t-23 9t-9 23v320q0 14 9 23t23 9t23 -9t9 -23zM1527 1353l-256 -256q-11 -9 -23 -9t-23 9q-9 10 -9 23t9 23l256 256q10 9 23 9t23 -9q9 -10 9 -23t-9 -23z" /> +<glyph unicode="" horiz-adv-x="1024" d="M704 280v-240q0 -16 -12 -28t-28 -12h-240q-16 0 -28 12t-12 28v240q0 16 12 28t28 12h240q16 0 28 -12t12 -28zM1020 880q0 -54 -15.5 -101t-35 -76.5t-55 -59.5t-57.5 -43.5t-61 -35.5q-41 -23 -68.5 -65t-27.5 -67q0 -17 -12 -32.5t-28 -15.5h-240q-15 0 -25.5 18.5 t-10.5 37.5v45q0 83 65 156.5t143 108.5q59 27 84 56t25 76q0 42 -46.5 74t-107.5 32q-65 0 -108 -29q-35 -25 -107 -115q-13 -16 -31 -16q-12 0 -25 8l-164 125q-13 10 -15.5 25t5.5 28q160 266 464 266q80 0 161 -31t146 -83t106 -127.5t41 -158.5z" /> +<glyph unicode="" horiz-adv-x="640" d="M640 192v-128q0 -26 -19 -45t-45 -19h-512q-26 0 -45 19t-19 45v128q0 26 19 45t45 19h64v384h-64q-26 0 -45 19t-19 45v128q0 26 19 45t45 19h384q26 0 45 -19t19 -45v-576h64q26 0 45 -19t19 -45zM512 1344v-192q0 -26 -19 -45t-45 -19h-256q-26 0 -45 19t-19 45v192 q0 26 19 45t45 19h256q26 0 45 -19t19 -45z" /> +<glyph unicode="" horiz-adv-x="640" d="M512 288v-224q0 -26 -19 -45t-45 -19h-256q-26 0 -45 19t-19 45v224q0 26 19 45t45 19h256q26 0 45 -19t19 -45zM542 1344l-28 -768q-1 -26 -20.5 -45t-45.5 -19h-256q-26 0 -45.5 19t-20.5 45l-28 768q-1 26 17.5 45t44.5 19h320q26 0 44.5 -19t17.5 -45z" /> +<glyph unicode="" d="M897 167v-167h-248l-159 252l-24 42q-8 9 -11 21h-3l-9 -21q-10 -20 -25 -44l-155 -250h-258v167h128l197 291l-185 272h-137v168h276l139 -228q2 -4 23 -42q8 -9 11 -21h3q3 9 11 21l25 42l140 228h257v-168h-125l-184 -267l204 -296h109zM1534 846v-206h-514l-3 27 q-4 28 -4 46q0 64 26 117t65 86.5t84 65t84 54.5t65 54t26 64q0 38 -29.5 62.5t-70.5 24.5q-51 0 -97 -39q-14 -11 -36 -38l-105 92q26 37 63 66q83 65 188 65q110 0 178 -59.5t68 -158.5q0 -56 -24.5 -103t-62 -76.5t-81.5 -58.5t-82 -50.5t-65.5 -51.5t-30.5 -63h232v80 h126z" /> +<glyph unicode="" d="M897 167v-167h-248l-159 252l-24 42q-8 9 -11 21h-3l-9 -21q-10 -20 -25 -44l-155 -250h-258v167h128l197 291l-185 272h-137v168h276l139 -228q2 -4 23 -42q8 -9 11 -21h3q3 9 11 21l25 42l140 228h257v-168h-125l-184 -267l204 -296h109zM1536 -50v-206h-514l-4 27 q-3 45 -3 46q0 64 26 117t65 86.5t84 65t84 54.5t65 54t26 64q0 38 -29.5 62.5t-70.5 24.5q-51 0 -97 -39q-14 -11 -36 -38l-105 92q26 37 63 66q80 65 188 65q110 0 178 -59.5t68 -158.5q0 -66 -34.5 -118.5t-84 -86t-99.5 -62.5t-87 -63t-41 -73h232v80h126z" /> +<glyph unicode="" horiz-adv-x="1920" d="M896 128l336 384h-768l-336 -384h768zM1909 1205q15 -34 9.5 -71.5t-30.5 -65.5l-896 -1024q-38 -44 -96 -44h-768q-38 0 -69.5 20.5t-47.5 54.5q-15 34 -9.5 71.5t30.5 65.5l896 1024q38 44 96 44h768q38 0 69.5 -20.5t47.5 -54.5z" /> +<glyph unicode="" horiz-adv-x="1664" d="M1664 438q0 -81 -44.5 -135t-123.5 -54q-41 0 -77.5 17.5t-59 38t-56.5 38t-71 17.5q-110 0 -110 -124q0 -39 16 -115t15 -115v-5q-22 0 -33 -1q-34 -3 -97.5 -11.5t-115.5 -13.5t-98 -5q-61 0 -103 26.5t-42 83.5q0 37 17.5 71t38 56.5t38 59t17.5 77.5q0 79 -54 123.5 t-135 44.5q-84 0 -143 -45.5t-59 -127.5q0 -43 15 -83t33.5 -64.5t33.5 -53t15 -50.5q0 -45 -46 -89q-37 -35 -117 -35q-95 0 -245 24q-9 2 -27.5 4t-27.5 4l-13 2q-1 0 -3 1q-2 0 -2 1v1024q2 -1 17.5 -3.5t34 -5t21.5 -3.5q150 -24 245 -24q80 0 117 35q46 44 46 89 q0 22 -15 50.5t-33.5 53t-33.5 64.5t-15 83q0 82 59 127.5t144 45.5q80 0 134 -44.5t54 -123.5q0 -41 -17.5 -77.5t-38 -59t-38 -56.5t-17.5 -71q0 -57 42 -83.5t103 -26.5q64 0 180 15t163 17v-2q-1 -2 -3.5 -17.5t-5 -34t-3.5 -21.5q-24 -150 -24 -245q0 -80 35 -117 q44 -46 89 -46q22 0 50.5 15t53 33.5t64.5 33.5t83 15q82 0 127.5 -59t45.5 -143z" /> +<glyph unicode="" horiz-adv-x="1152" d="M1152 832v-128q0 -221 -147.5 -384.5t-364.5 -187.5v-132h256q26 0 45 -19t19 -45t-19 -45t-45 -19h-640q-26 0 -45 19t-19 45t19 45t45 19h256v132q-217 24 -364.5 187.5t-147.5 384.5v128q0 26 19 45t45 19t45 -19t19 -45v-128q0 -185 131.5 -316.5t316.5 -131.5 t316.5 131.5t131.5 316.5v128q0 26 19 45t45 19t45 -19t19 -45zM896 1216v-512q0 -132 -94 -226t-226 -94t-226 94t-94 226v512q0 132 94 226t226 94t226 -94t94 -226z" /> +<glyph unicode="" horiz-adv-x="1408" d="M271 591l-101 -101q-42 103 -42 214v128q0 26 19 45t45 19t45 -19t19 -45v-128q0 -53 15 -113zM1385 1193l-361 -361v-128q0 -132 -94 -226t-226 -94q-55 0 -109 19l-96 -96q97 -51 205 -51q185 0 316.5 131.5t131.5 316.5v128q0 26 19 45t45 19t45 -19t19 -45v-128 q0 -221 -147.5 -384.5t-364.5 -187.5v-132h256q26 0 45 -19t19 -45t-19 -45t-45 -19h-640q-26 0 -45 19t-19 45t19 45t45 19h256v132q-125 13 -235 81l-254 -254q-10 -10 -23 -10t-23 10l-82 82q-10 10 -10 23t10 23l1234 1234q10 10 23 10t23 -10l82 -82q10 -10 10 -23 t-10 -23zM1005 1325l-621 -621v512q0 132 94 226t226 94q102 0 184.5 -59t116.5 -152z" /> +<glyph unicode="" horiz-adv-x="1280" d="M1088 576v640h-448v-1137q119 63 213 137q235 184 235 360zM1280 1344v-768q0 -86 -33.5 -170.5t-83 -150t-118 -127.5t-126.5 -103t-121 -77.5t-89.5 -49.5t-42.5 -20q-12 -6 -26 -6t-26 6q-16 7 -42.5 20t-89.5 49.5t-121 77.5t-126.5 103t-118 127.5t-83 150 t-33.5 170.5v768q0 26 19 45t45 19h1152q26 0 45 -19t19 -45z" /> +<glyph unicode="" horiz-adv-x="1664" d="M128 -128h1408v1024h-1408v-1024zM512 1088v288q0 14 -9 23t-23 9h-64q-14 0 -23 -9t-9 -23v-288q0 -14 9 -23t23 -9h64q14 0 23 9t9 23zM1280 1088v288q0 14 -9 23t-23 9h-64q-14 0 -23 -9t-9 -23v-288q0 -14 9 -23t23 -9h64q14 0 23 9t9 23zM1664 1152v-1280 q0 -52 -38 -90t-90 -38h-1408q-52 0 -90 38t-38 90v1280q0 52 38 90t90 38h128v96q0 66 47 113t113 47h64q66 0 113 -47t47 -113v-96h384v96q0 66 47 113t113 47h64q66 0 113 -47t47 -113v-96h128q52 0 90 -38t38 -90z" /> +<glyph unicode="" horiz-adv-x="1408" d="M512 1344q0 26 -19 45t-45 19t-45 -19t-19 -45t19 -45t45 -19t45 19t19 45zM1408 1376v-320q0 -16 -12 -25q-8 -7 -20 -7q-4 0 -7 1l-448 96q-11 2 -18 11t-7 20h-256v-102q111 -23 183.5 -111t72.5 -203v-800q0 -26 -19 -45t-45 -19h-512q-26 0 -45 19t-19 45v800 q0 106 62.5 190.5t161.5 114.5v111h-32q-59 0 -115 -23.5t-91.5 -53t-66 -66.5t-40.5 -53.5t-14 -24.5q-17 -35 -57 -35q-16 0 -29 7q-23 12 -31.5 37t3.5 49q5 10 14.5 26t37.5 53.5t60.5 70t85 67t108.5 52.5q-25 42 -25 86q0 66 47 113t113 47t113 -47t47 -113 q0 -33 -14 -64h302q0 11 7 20t18 11l448 96q3 1 7 1q12 0 20 -7q12 -9 12 -25z" /> +<glyph unicode="" horiz-adv-x="1664" d="M1440 1088q0 40 -28 68t-68 28t-68 -28t-28 -68t28 -68t68 -28t68 28t28 68zM1664 1376q0 -249 -75.5 -430.5t-253.5 -360.5q-81 -80 -195 -176l-20 -379q-2 -16 -16 -26l-384 -224q-7 -4 -16 -4q-12 0 -23 9l-64 64q-13 14 -8 32l85 276l-281 281l-276 -85q-3 -1 -9 -1 q-14 0 -23 9l-64 64q-17 19 -5 39l224 384q10 14 26 16l379 20q96 114 176 195q188 187 358 258t431 71q14 0 24 -9.5t10 -22.5z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1745 763l-164 -763h-334l178 832q13 56 -15 88q-27 33 -83 33h-169l-204 -953h-334l204 953h-286l-204 -953h-334l204 953l-153 327h1276q101 0 189.5 -40.5t147.5 -113.5q60 -73 81 -168.5t0 -194.5z" /> +<glyph unicode="" d="M909 141l102 102q19 19 19 45t-19 45l-307 307l307 307q19 19 19 45t-19 45l-102 102q-19 19 -45 19t-45 -19l-454 -454q-19 -19 -19 -45t19 -45l454 -454q19 -19 45 -19t45 19zM1536 640q0 -209 -103 -385.5t-279.5 -279.5t-385.5 -103t-385.5 103t-279.5 279.5 t-103 385.5t103 385.5t279.5 279.5t385.5 103t385.5 -103t279.5 -279.5t103 -385.5z" /> +<glyph unicode="" d="M717 141l454 454q19 19 19 45t-19 45l-454 454q-19 19 -45 19t-45 -19l-102 -102q-19 -19 -19 -45t19 -45l307 -307l-307 -307q-19 -19 -19 -45t19 -45l102 -102q19 -19 45 -19t45 19zM1536 640q0 -209 -103 -385.5t-279.5 -279.5t-385.5 -103t-385.5 103t-279.5 279.5 t-103 385.5t103 385.5t279.5 279.5t385.5 103t385.5 -103t279.5 -279.5t103 -385.5z" /> +<glyph unicode="" d="M1165 397l102 102q19 19 19 45t-19 45l-454 454q-19 19 -45 19t-45 -19l-454 -454q-19 -19 -19 -45t19 -45l102 -102q19 -19 45 -19t45 19l307 307l307 -307q19 -19 45 -19t45 19zM1536 640q0 -209 -103 -385.5t-279.5 -279.5t-385.5 -103t-385.5 103t-279.5 279.5 t-103 385.5t103 385.5t279.5 279.5t385.5 103t385.5 -103t279.5 -279.5t103 -385.5z" /> +<glyph unicode="" d="M813 237l454 454q19 19 19 45t-19 45l-102 102q-19 19 -45 19t-45 -19l-307 -307l-307 307q-19 19 -45 19t-45 -19l-102 -102q-19 -19 -19 -45t19 -45l454 -454q19 -19 45 -19t45 19zM1536 640q0 -209 -103 -385.5t-279.5 -279.5t-385.5 -103t-385.5 103t-279.5 279.5 t-103 385.5t103 385.5t279.5 279.5t385.5 103t385.5 -103t279.5 -279.5t103 -385.5z" /> +<glyph unicode="" horiz-adv-x="1408" d="M1130 939l16 175h-884l47 -534h612l-22 -228l-197 -53l-196 53l-13 140h-175l22 -278l362 -100h4v1l359 99l50 544h-644l-15 181h674zM0 1408h1408l-128 -1438l-578 -162l-574 162z" /> +<glyph unicode="" horiz-adv-x="1792" d="M275 1408h1505l-266 -1333l-804 -267l-698 267l71 356h297l-29 -147l422 -161l486 161l68 339h-1208l58 297h1209l38 191h-1208z" /> +<glyph unicode="" horiz-adv-x="1792" d="M960 1280q0 26 -19 45t-45 19t-45 -19t-19 -45t19 -45t45 -19t45 19t19 45zM1792 352v-352q0 -22 -20 -30q-8 -2 -12 -2q-13 0 -23 9l-93 93q-119 -143 -318.5 -226.5t-429.5 -83.5t-429.5 83.5t-318.5 226.5l-93 -93q-9 -9 -23 -9q-4 0 -12 2q-20 8 -20 30v352 q0 14 9 23t23 9h352q22 0 30 -20q8 -19 -7 -35l-100 -100q67 -91 189.5 -153.5t271.5 -82.5v647h-192q-26 0 -45 19t-19 45v128q0 26 19 45t45 19h192v163q-58 34 -93 92.5t-35 128.5q0 106 75 181t181 75t181 -75t75 -181q0 -70 -35 -128.5t-93 -92.5v-163h192q26 0 45 -19 t19 -45v-128q0 -26 -19 -45t-45 -19h-192v-647q149 20 271.5 82.5t189.5 153.5l-100 100q-15 16 -7 35q8 20 30 20h352q14 0 23 -9t9 -23z" /> +<glyph unicode="" horiz-adv-x="1152" d="M1056 768q40 0 68 -28t28 -68v-576q0 -40 -28 -68t-68 -28h-960q-40 0 -68 28t-28 68v576q0 40 28 68t68 28h32v320q0 185 131.5 316.5t316.5 131.5t316.5 -131.5t131.5 -316.5q0 -26 -19 -45t-45 -19h-64q-26 0 -45 19t-19 45q0 106 -75 181t-181 75t-181 -75t-75 -181 v-320h736z" /> +<glyph unicode="" d="M1024 640q0 -106 -75 -181t-181 -75t-181 75t-75 181t75 181t181 75t181 -75t75 -181zM1152 640q0 159 -112.5 271.5t-271.5 112.5t-271.5 -112.5t-112.5 -271.5t112.5 -271.5t271.5 -112.5t271.5 112.5t112.5 271.5zM1280 640q0 -212 -150 -362t-362 -150t-362 150 t-150 362t150 362t362 150t362 -150t150 -362zM1408 640q0 130 -51 248.5t-136.5 204t-204 136.5t-248.5 51t-248.5 -51t-204 -136.5t-136.5 -204t-51 -248.5t51 -248.5t136.5 -204t204 -136.5t248.5 -51t248.5 51t204 136.5t136.5 204t51 248.5zM1536 640 q0 -209 -103 -385.5t-279.5 -279.5t-385.5 -103t-385.5 103t-279.5 279.5t-103 385.5t103 385.5t279.5 279.5t385.5 103t385.5 -103t279.5 -279.5t103 -385.5z" /> +<glyph unicode="" horiz-adv-x="1408" d="M384 800v-192q0 -40 -28 -68t-68 -28h-192q-40 0 -68 28t-28 68v192q0 40 28 68t68 28h192q40 0 68 -28t28 -68zM896 800v-192q0 -40 -28 -68t-68 -28h-192q-40 0 -68 28t-28 68v192q0 40 28 68t68 28h192q40 0 68 -28t28 -68zM1408 800v-192q0 -40 -28 -68t-68 -28h-192 q-40 0 -68 28t-28 68v192q0 40 28 68t68 28h192q40 0 68 -28t28 -68z" /> +<glyph unicode="" horiz-adv-x="384" d="M384 288v-192q0 -40 -28 -68t-68 -28h-192q-40 0 -68 28t-28 68v192q0 40 28 68t68 28h192q40 0 68 -28t28 -68zM384 800v-192q0 -40 -28 -68t-68 -28h-192q-40 0 -68 28t-28 68v192q0 40 28 68t68 28h192q40 0 68 -28t28 -68zM384 1312v-192q0 -40 -28 -68t-68 -28h-192 q-40 0 -68 28t-28 68v192q0 40 28 68t68 28h192q40 0 68 -28t28 -68z" /> +<glyph unicode="" d="M512 256q0 53 -37.5 90.5t-90.5 37.5t-90.5 -37.5t-37.5 -90.5t37.5 -90.5t90.5 -37.5t90.5 37.5t37.5 90.5zM863 162q-13 232 -177 396t-396 177q-14 1 -24 -9t-10 -23v-128q0 -13 8.5 -22t21.5 -10q154 -11 264 -121t121 -264q1 -13 10 -21.5t22 -8.5h128q13 0 23 10 t9 24zM1247 161q-5 154 -56 297.5t-139.5 260t-205 205t-260 139.5t-297.5 56q-14 1 -23 -9q-10 -10 -10 -23v-128q0 -13 9 -22t22 -10q204 -7 378 -111.5t278.5 -278.5t111.5 -378q1 -13 10 -22t22 -9h128q13 0 23 10q11 9 9 23zM1536 1120v-960q0 -119 -84.5 -203.5 t-203.5 -84.5h-960q-119 0 -203.5 84.5t-84.5 203.5v960q0 119 84.5 203.5t203.5 84.5h960q119 0 203.5 -84.5t84.5 -203.5z" /> +<glyph unicode="" d="M768 1408q209 0 385.5 -103t279.5 -279.5t103 -385.5t-103 -385.5t-279.5 -279.5t-385.5 -103t-385.5 103t-279.5 279.5t-103 385.5t103 385.5t279.5 279.5t385.5 103zM1152 585q32 18 32 55t-32 55l-544 320q-31 19 -64 1q-32 -19 -32 -56v-640q0 -37 32 -56 q16 -8 32 -8q17 0 32 9z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1024 1084l316 -316l-572 -572l-316 316zM813 105l618 618q19 19 19 45t-19 45l-362 362q-18 18 -45 18t-45 -18l-618 -618q-19 -19 -19 -45t19 -45l362 -362q18 -18 45 -18t45 18zM1702 742l-907 -908q-37 -37 -90.5 -37t-90.5 37l-126 126q56 56 56 136t-56 136 t-136 56t-136 -56l-125 126q-37 37 -37 90.5t37 90.5l907 906q37 37 90.5 37t90.5 -37l125 -125q-56 -56 -56 -136t56 -136t136 -56t136 56l126 -125q37 -37 37 -90.5t-37 -90.5z" /> +<glyph unicode="" d="M1280 576v128q0 26 -19 45t-45 19h-896q-26 0 -45 -19t-19 -45v-128q0 -26 19 -45t45 -19h896q26 0 45 19t19 45zM1536 1120v-960q0 -119 -84.5 -203.5t-203.5 -84.5h-960q-119 0 -203.5 84.5t-84.5 203.5v960q0 119 84.5 203.5t203.5 84.5h960q119 0 203.5 -84.5 t84.5 -203.5z" /> +<glyph unicode="" horiz-adv-x="1408" d="M1152 736v-64q0 -14 -9 -23t-23 -9h-832q-14 0 -23 9t-9 23v64q0 14 9 23t23 9h832q14 0 23 -9t9 -23zM1280 288v832q0 66 -47 113t-113 47h-832q-66 0 -113 -47t-47 -113v-832q0 -66 47 -113t113 -47h832q66 0 113 47t47 113zM1408 1120v-832q0 -119 -84.5 -203.5 t-203.5 -84.5h-832q-119 0 -203.5 84.5t-84.5 203.5v832q0 119 84.5 203.5t203.5 84.5h832q119 0 203.5 -84.5t84.5 -203.5z" /> +<glyph unicode="" horiz-adv-x="1024" d="M1018 933q-18 -37 -58 -37h-192v-864q0 -14 -9 -23t-23 -9h-704q-21 0 -29 18q-8 20 4 35l160 192q9 11 25 11h320v640h-192q-40 0 -58 37q-17 37 9 68l320 384q18 22 49 22t49 -22l320 -384q27 -32 9 -68z" /> +<glyph unicode="" horiz-adv-x="1024" d="M32 1280h704q13 0 22.5 -9.5t9.5 -23.5v-863h192q40 0 58 -37t-9 -69l-320 -384q-18 -22 -49 -22t-49 22l-320 384q-26 31 -9 69q18 37 58 37h192v640h-320q-14 0 -25 11l-160 192q-13 14 -4 34q9 19 29 19z" /> +<glyph unicode="" d="M685 237l614 614q19 19 19 45t-19 45l-102 102q-19 19 -45 19t-45 -19l-467 -467l-211 211q-19 19 -45 19t-45 -19l-102 -102q-19 -19 -19 -45t19 -45l358 -358q19 -19 45 -19t45 19zM1536 1120v-960q0 -119 -84.5 -203.5t-203.5 -84.5h-960q-119 0 -203.5 84.5 t-84.5 203.5v960q0 119 84.5 203.5t203.5 84.5h960q119 0 203.5 -84.5t84.5 -203.5z" /> +<glyph unicode="" d="M404 428l152 -152l-52 -52h-56v96h-96v56zM818 818q14 -13 -3 -30l-291 -291q-17 -17 -30 -3q-14 13 3 30l291 291q17 17 30 3zM544 128l544 544l-288 288l-544 -544v-288h288zM1152 736l92 92q28 28 28 68t-28 68l-152 152q-28 28 -68 28t-68 -28l-92 -92zM1536 1120 v-960q0 -119 -84.5 -203.5t-203.5 -84.5h-960q-119 0 -203.5 84.5t-84.5 203.5v960q0 119 84.5 203.5t203.5 84.5h960q119 0 203.5 -84.5t84.5 -203.5z" /> +<glyph unicode="" d="M1280 608v480q0 26 -19 45t-45 19h-480q-42 0 -59 -39q-17 -41 14 -70l144 -144l-534 -534q-19 -19 -19 -45t19 -45l102 -102q19 -19 45 -19t45 19l534 534l144 -144q18 -19 45 -19q12 0 25 5q39 17 39 59zM1536 1120v-960q0 -119 -84.5 -203.5t-203.5 -84.5h-960 q-119 0 -203.5 84.5t-84.5 203.5v960q0 119 84.5 203.5t203.5 84.5h960q119 0 203.5 -84.5t84.5 -203.5z" /> +<glyph unicode="" d="M1005 435l352 352q19 19 19 45t-19 45l-352 352q-30 31 -69 14q-40 -17 -40 -59v-160q-119 0 -216 -19.5t-162.5 -51t-114 -79t-76.5 -95.5t-44.5 -109t-21.5 -111.5t-5 -110.5q0 -181 167 -404q10 -12 25 -12q7 0 13 3q22 9 19 33q-44 354 62 473q46 52 130 75.5 t224 23.5v-160q0 -42 40 -59q12 -5 24 -5q26 0 45 19zM1536 1120v-960q0 -119 -84.5 -203.5t-203.5 -84.5h-960q-119 0 -203.5 84.5t-84.5 203.5v960q0 119 84.5 203.5t203.5 84.5h960q119 0 203.5 -84.5t84.5 -203.5z" /> +<glyph unicode="" d="M640 448l256 128l-256 128v-256zM1024 1039v-542l-512 -256v542zM1312 640q0 148 -73 273t-198 198t-273 73t-273 -73t-198 -198t-73 -273t73 -273t198 -198t273 -73t273 73t198 198t73 273zM1536 640q0 -209 -103 -385.5t-279.5 -279.5t-385.5 -103t-385.5 103 t-279.5 279.5t-103 385.5t103 385.5t279.5 279.5t385.5 103t385.5 -103t279.5 -279.5t103 -385.5z" /> +<glyph unicode="" d="M1145 861q18 -35 -5 -66l-320 -448q-19 -27 -52 -27t-52 27l-320 448q-23 31 -5 66q17 35 57 35h640q40 0 57 -35zM1280 160v960q0 13 -9.5 22.5t-22.5 9.5h-960q-13 0 -22.5 -9.5t-9.5 -22.5v-960q0 -13 9.5 -22.5t22.5 -9.5h960q13 0 22.5 9.5t9.5 22.5zM1536 1120 v-960q0 -119 -84.5 -203.5t-203.5 -84.5h-960q-119 0 -203.5 84.5t-84.5 203.5v960q0 119 84.5 203.5t203.5 84.5h960q119 0 203.5 -84.5t84.5 -203.5z" /> +<glyph unicode="" d="M1145 419q-17 -35 -57 -35h-640q-40 0 -57 35q-18 35 5 66l320 448q19 27 52 27t52 -27l320 -448q23 -31 5 -66zM1280 160v960q0 13 -9.5 22.5t-22.5 9.5h-960q-13 0 -22.5 -9.5t-9.5 -22.5v-960q0 -13 9.5 -22.5t22.5 -9.5h960q13 0 22.5 9.5t9.5 22.5zM1536 1120v-960 q0 -119 -84.5 -203.5t-203.5 -84.5h-960q-119 0 -203.5 84.5t-84.5 203.5v960q0 119 84.5 203.5t203.5 84.5h960q119 0 203.5 -84.5t84.5 -203.5z" /> +<glyph unicode="" d="M1088 640q0 -33 -27 -52l-448 -320q-31 -23 -66 -5q-35 17 -35 57v640q0 40 35 57q35 18 66 -5l448 -320q27 -19 27 -52zM1280 160v960q0 14 -9 23t-23 9h-960q-14 0 -23 -9t-9 -23v-960q0 -14 9 -23t23 -9h960q14 0 23 9t9 23zM1536 1120v-960q0 -119 -84.5 -203.5 t-203.5 -84.5h-960q-119 0 -203.5 84.5t-84.5 203.5v960q0 119 84.5 203.5t203.5 84.5h960q119 0 203.5 -84.5t84.5 -203.5z" /> +<glyph unicode="" horiz-adv-x="1024" d="M976 229l35 -159q3 -12 -3 -22.5t-17 -14.5l-5 -1q-4 -2 -10.5 -3.5t-16 -4.5t-21.5 -5.5t-25.5 -5t-30 -5t-33.5 -4.5t-36.5 -3t-38.5 -1q-234 0 -409 130.5t-238 351.5h-95q-13 0 -22.5 9.5t-9.5 22.5v113q0 13 9.5 22.5t22.5 9.5h66q-2 57 1 105h-67q-14 0 -23 9 t-9 23v114q0 14 9 23t23 9h98q67 210 243.5 338t400.5 128q102 0 194 -23q11 -3 20 -15q6 -11 3 -24l-43 -159q-3 -13 -14 -19.5t-24 -2.5l-4 1q-4 1 -11.5 2.5l-17.5 3.5t-22.5 3.5t-26 3t-29 2.5t-29.5 1q-126 0 -226 -64t-150 -176h468q16 0 25 -12q10 -12 7 -26 l-24 -114q-5 -26 -32 -26h-488q-3 -37 0 -105h459q15 0 25 -12q9 -12 6 -27l-24 -112q-2 -11 -11 -18.5t-20 -7.5h-387q48 -117 149.5 -185.5t228.5 -68.5q18 0 36 1.5t33.5 3.5t29.5 4.5t24.5 5t18.5 4.5l12 3l5 2q13 5 26 -2q12 -7 15 -21z" /> +<glyph unicode="" horiz-adv-x="1024" d="M1020 399v-367q0 -14 -9 -23t-23 -9h-956q-14 0 -23 9t-9 23v150q0 13 9.5 22.5t22.5 9.5h97v383h-95q-14 0 -23 9.5t-9 22.5v131q0 14 9 23t23 9h95v223q0 171 123.5 282t314.5 111q185 0 335 -125q9 -8 10 -20.5t-7 -22.5l-103 -127q-9 -11 -22 -12q-13 -2 -23 7 q-5 5 -26 19t-69 32t-93 18q-85 0 -137 -47t-52 -123v-215h305q13 0 22.5 -9t9.5 -23v-131q0 -13 -9.5 -22.5t-22.5 -9.5h-305v-379h414v181q0 13 9 22.5t23 9.5h162q14 0 23 -9.5t9 -22.5z" /> +<glyph unicode="" horiz-adv-x="1024" d="M978 351q0 -153 -99.5 -263.5t-258.5 -136.5v-175q0 -14 -9 -23t-23 -9h-135q-13 0 -22.5 9.5t-9.5 22.5v175q-66 9 -127.5 31t-101.5 44.5t-74 48t-46.5 37.5t-17.5 18q-17 21 -2 41l103 135q7 10 23 12q15 2 24 -9l2 -2q113 -99 243 -125q37 -8 74 -8q81 0 142.5 43 t61.5 122q0 28 -15 53t-33.5 42t-58.5 37.5t-66 32t-80 32.5q-39 16 -61.5 25t-61.5 26.5t-62.5 31t-56.5 35.5t-53.5 42.5t-43.5 49t-35.5 58t-21 66.5t-8.5 78q0 138 98 242t255 134v180q0 13 9.5 22.5t22.5 9.5h135q14 0 23 -9t9 -23v-176q57 -6 110.5 -23t87 -33.5 t63.5 -37.5t39 -29t15 -14q17 -18 5 -38l-81 -146q-8 -15 -23 -16q-14 -3 -27 7q-3 3 -14.5 12t-39 26.5t-58.5 32t-74.5 26t-85.5 11.5q-95 0 -155 -43t-60 -111q0 -26 8.5 -48t29.5 -41.5t39.5 -33t56 -31t60.5 -27t70 -27.5q53 -20 81 -31.5t76 -35t75.5 -42.5t62 -50 t53 -63.5t31.5 -76.5t13 -94z" /> +<glyph unicode="" horiz-adv-x="898" d="M898 1066v-102q0 -14 -9 -23t-23 -9h-168q-23 -144 -129 -234t-276 -110q167 -178 459 -536q14 -16 4 -34q-8 -18 -29 -18h-195q-16 0 -25 12q-306 367 -498 571q-9 9 -9 22v127q0 13 9.5 22.5t22.5 9.5h112q132 0 212.5 43t102.5 125h-427q-14 0 -23 9t-9 23v102 q0 14 9 23t23 9h413q-57 113 -268 113h-145q-13 0 -22.5 9.5t-9.5 22.5v133q0 14 9 23t23 9h832q14 0 23 -9t9 -23v-102q0 -14 -9 -23t-23 -9h-233q47 -61 64 -144h171q14 0 23 -9t9 -23z" /> +<glyph unicode="" horiz-adv-x="1027" d="M603 0h-172q-13 0 -22.5 9t-9.5 23v330h-288q-13 0 -22.5 9t-9.5 23v103q0 13 9.5 22.5t22.5 9.5h288v85h-288q-13 0 -22.5 9t-9.5 23v104q0 13 9.5 22.5t22.5 9.5h214l-321 578q-8 16 0 32q10 16 28 16h194q19 0 29 -18l215 -425q19 -38 56 -125q10 24 30.5 68t27.5 61 l191 420q8 19 29 19h191q17 0 27 -16q9 -14 1 -31l-313 -579h215q13 0 22.5 -9.5t9.5 -22.5v-104q0 -14 -9.5 -23t-22.5 -9h-290v-85h290q13 0 22.5 -9.5t9.5 -22.5v-103q0 -14 -9.5 -23t-22.5 -9h-290v-330q0 -13 -9.5 -22.5t-22.5 -9.5z" /> +<glyph unicode="" horiz-adv-x="1280" d="M1043 971q0 100 -65 162t-171 62h-320v-448h320q106 0 171 62t65 162zM1280 971q0 -193 -126.5 -315t-326.5 -122h-340v-118h505q14 0 23 -9t9 -23v-128q0 -14 -9 -23t-23 -9h-505v-192q0 -14 -9.5 -23t-22.5 -9h-167q-14 0 -23 9t-9 23v192h-224q-14 0 -23 9t-9 23v128 q0 14 9 23t23 9h224v118h-224q-14 0 -23 9t-9 23v149q0 13 9 22.5t23 9.5h224v629q0 14 9 23t23 9h539q200 0 326.5 -122t126.5 -315z" /> +<glyph unicode="" horiz-adv-x="1792" d="M514 341l81 299h-159l75 -300q1 -1 1 -3t1 -3q0 1 0.5 3.5t0.5 3.5zM630 768l35 128h-292l32 -128h225zM822 768h139l-35 128h-70zM1271 340l78 300h-162l81 -299q0 -1 0.5 -3.5t1.5 -3.5q0 1 0.5 3t0.5 3zM1382 768l33 128h-297l34 -128h230zM1792 736v-64q0 -14 -9 -23 t-23 -9h-213l-164 -616q-7 -24 -31 -24h-159q-24 0 -31 24l-166 616h-209l-167 -616q-7 -24 -31 -24h-159q-11 0 -19.5 7t-10.5 17l-160 616h-208q-14 0 -23 9t-9 23v64q0 14 9 23t23 9h175l-33 128h-142q-14 0 -23 9t-9 23v64q0 14 9 23t23 9h109l-89 344q-5 15 5 28 q10 12 26 12h137q26 0 31 -24l90 -360h359l97 360q7 24 31 24h126q24 0 31 -24l98 -360h365l93 360q5 24 31 24h137q16 0 26 -12q10 -13 5 -28l-91 -344h111q14 0 23 -9t9 -23v-64q0 -14 -9 -23t-23 -9h-145l-34 -128h179q14 0 23 -9t9 -23z" /> +<glyph unicode="" horiz-adv-x="1280" d="M1167 896q18 -182 -131 -258q117 -28 175 -103t45 -214q-7 -71 -32.5 -125t-64.5 -89t-97 -58.5t-121.5 -34.5t-145.5 -15v-255h-154v251q-80 0 -122 1v-252h-154v255q-18 0 -54 0.5t-55 0.5h-200l31 183h111q50 0 58 51v402h16q-6 1 -16 1v287q-13 68 -89 68h-111v164 l212 -1q64 0 97 1v252h154v-247q82 2 122 2v245h154v-252q79 -7 140 -22.5t113 -45t82.5 -78t36.5 -114.5zM952 351q0 36 -15 64t-37 46t-57.5 30.5t-65.5 18.5t-74 9t-69 3t-64.5 -1t-47.5 -1v-338q8 0 37 -0.5t48 -0.5t53 1.5t58.5 4t57 8.5t55.5 14t47.5 21t39.5 30 t24.5 40t9.5 51zM881 827q0 33 -12.5 58.5t-30.5 42t-48 28t-55 16.5t-61.5 8t-58 2.5t-54 -1t-39.5 -0.5v-307q5 0 34.5 -0.5t46.5 0t50 2t55 5.5t51.5 11t48.5 18.5t37 27t27 38.5t9 51z" /> +<glyph unicode="" d="M1024 1024v472q22 -14 36 -28l408 -408q14 -14 28 -36h-472zM896 992q0 -40 28 -68t68 -28h544v-1056q0 -40 -28 -68t-68 -28h-1344q-40 0 -68 28t-28 68v1600q0 40 28 68t68 28h800v-544z" /> +<glyph unicode="" d="M1468 1060q14 -14 28 -36h-472v472q22 -14 36 -28zM992 896h544v-1056q0 -40 -28 -68t-68 -28h-1344q-40 0 -68 28t-28 68v1600q0 40 28 68t68 28h800v-544q0 -40 28 -68t68 -28zM1152 160v64q0 14 -9 23t-23 9h-704q-14 0 -23 -9t-9 -23v-64q0 -14 9 -23t23 -9h704 q14 0 23 9t9 23zM1152 416v64q0 14 -9 23t-23 9h-704q-14 0 -23 -9t-9 -23v-64q0 -14 9 -23t23 -9h704q14 0 23 9t9 23zM1152 672v64q0 14 -9 23t-23 9h-704q-14 0 -23 -9t-9 -23v-64q0 -14 9 -23t23 -9h704q14 0 23 9t9 23z" /> +<glyph unicode="" horiz-adv-x="1664" d="M1191 1128h177l-72 218l-12 47q-2 16 -2 20h-4l-3 -20q0 -1 -3.5 -18t-7.5 -29zM736 96q0 -12 -10 -24l-319 -319q-10 -9 -23 -9q-12 0 -23 9l-320 320q-15 16 -7 35q8 20 30 20h192v1376q0 14 9 23t23 9h192q14 0 23 -9t9 -23v-1376h192q14 0 23 -9t9 -23zM1572 -23 v-233h-584v90l369 529q12 18 21 27l11 9v3q-2 0 -6.5 -0.5t-7.5 -0.5q-12 -3 -30 -3h-232v-115h-120v229h567v-89l-369 -530q-6 -8 -21 -26l-11 -11v-2l14 2q9 2 30 2h248v119h121zM1661 874v-106h-288v106h75l-47 144h-243l-47 -144h75v-106h-287v106h70l230 662h162 l230 -662h70z" /> +<glyph unicode="" horiz-adv-x="1664" d="M1191 104h177l-72 218l-12 47q-2 16 -2 20h-4l-3 -20q0 -1 -3.5 -18t-7.5 -29zM736 96q0 -12 -10 -24l-319 -319q-10 -9 -23 -9q-12 0 -23 9l-320 320q-15 16 -7 35q8 20 30 20h192v1376q0 14 9 23t23 9h192q14 0 23 -9t9 -23v-1376h192q14 0 23 -9t9 -23zM1661 -150 v-106h-288v106h75l-47 144h-243l-47 -144h75v-106h-287v106h70l230 662h162l230 -662h70zM1572 1001v-233h-584v90l369 529q12 18 21 27l11 9v3q-2 0 -6.5 -0.5t-7.5 -0.5q-12 -3 -30 -3h-232v-115h-120v229h567v-89l-369 -530q-6 -8 -21 -26l-11 -10v-3l14 3q9 1 30 1h248 v119h121z" /> +<glyph unicode="" horiz-adv-x="1792" d="M736 96q0 -12 -10 -24l-319 -319q-10 -9 -23 -9q-12 0 -23 9l-320 320q-15 16 -7 35q8 20 30 20h192v1376q0 14 9 23t23 9h192q14 0 23 -9t9 -23v-1376h192q14 0 23 -9t9 -23zM1792 -32v-192q0 -14 -9 -23t-23 -9h-832q-14 0 -23 9t-9 23v192q0 14 9 23t23 9h832 q14 0 23 -9t9 -23zM1600 480v-192q0 -14 -9 -23t-23 -9h-640q-14 0 -23 9t-9 23v192q0 14 9 23t23 9h640q14 0 23 -9t9 -23zM1408 992v-192q0 -14 -9 -23t-23 -9h-448q-14 0 -23 9t-9 23v192q0 14 9 23t23 9h448q14 0 23 -9t9 -23zM1216 1504v-192q0 -14 -9 -23t-23 -9h-256 q-14 0 -23 9t-9 23v192q0 14 9 23t23 9h256q14 0 23 -9t9 -23z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1216 -32v-192q0 -14 -9 -23t-23 -9h-256q-14 0 -23 9t-9 23v192q0 14 9 23t23 9h256q14 0 23 -9t9 -23zM736 96q0 -12 -10 -24l-319 -319q-10 -9 -23 -9q-12 0 -23 9l-320 320q-15 16 -7 35q8 20 30 20h192v1376q0 14 9 23t23 9h192q14 0 23 -9t9 -23v-1376h192 q14 0 23 -9t9 -23zM1408 480v-192q0 -14 -9 -23t-23 -9h-448q-14 0 -23 9t-9 23v192q0 14 9 23t23 9h448q14 0 23 -9t9 -23zM1600 992v-192q0 -14 -9 -23t-23 -9h-640q-14 0 -23 9t-9 23v192q0 14 9 23t23 9h640q14 0 23 -9t9 -23zM1792 1504v-192q0 -14 -9 -23t-23 -9h-832 q-14 0 -23 9t-9 23v192q0 14 9 23t23 9h832q14 0 23 -9t9 -23z" /> +<glyph unicode="" d="M1346 223q0 63 -44 116t-103 53q-52 0 -83 -37t-31 -94t36.5 -95t104.5 -38q50 0 85 27t35 68zM736 96q0 -12 -10 -24l-319 -319q-10 -9 -23 -9q-12 0 -23 9l-320 320q-15 16 -7 35q8 20 30 20h192v1376q0 14 9 23t23 9h192q14 0 23 -9t9 -23v-1376h192q14 0 23 -9t9 -23 zM1486 165q0 -62 -13 -121.5t-41 -114t-68 -95.5t-98.5 -65.5t-127.5 -24.5q-62 0 -108 16q-24 8 -42 15l39 113q15 -7 31 -11q37 -13 75 -13q84 0 134.5 58.5t66.5 145.5h-2q-21 -23 -61.5 -37t-84.5 -14q-106 0 -173 71.5t-67 172.5q0 105 72 178t181 73q123 0 205 -94.5 t82 -252.5zM1456 882v-114h-469v114h167v432q0 7 0.5 19t0.5 17v16h-2l-7 -12q-8 -13 -26 -31l-62 -58l-82 86l192 185h123v-654h165z" /> +<glyph unicode="" d="M1346 1247q0 63 -44 116t-103 53q-52 0 -83 -37t-31 -94t36.5 -95t104.5 -38q50 0 85 27t35 68zM736 96q0 -12 -10 -24l-319 -319q-10 -9 -23 -9q-12 0 -23 9l-320 320q-15 16 -7 35q8 20 30 20h192v1376q0 14 9 23t23 9h192q14 0 23 -9t9 -23v-1376h192q14 0 23 -9 t9 -23zM1456 -142v-114h-469v114h167v432q0 7 0.5 19t0.5 17v16h-2l-7 -12q-8 -13 -26 -31l-62 -58l-82 86l192 185h123v-654h165zM1486 1189q0 -62 -13 -121.5t-41 -114t-68 -95.5t-98.5 -65.5t-127.5 -24.5q-62 0 -108 16q-24 8 -42 15l39 113q15 -7 31 -11q37 -13 75 -13 q84 0 134.5 58.5t66.5 145.5h-2q-21 -23 -61.5 -37t-84.5 -14q-106 0 -173 71.5t-67 172.5q0 105 72 178t181 73q123 0 205 -94.5t82 -252.5z" /> +<glyph unicode="" horiz-adv-x="1664" d="M256 192q0 26 -19 45t-45 19q-27 0 -45.5 -19t-18.5 -45q0 -27 18.5 -45.5t45.5 -18.5q26 0 45 18.5t19 45.5zM416 704v-640q0 -26 -19 -45t-45 -19h-288q-26 0 -45 19t-19 45v640q0 26 19 45t45 19h288q26 0 45 -19t19 -45zM1600 704q0 -86 -55 -149q15 -44 15 -76 q3 -76 -43 -137q17 -56 0 -117q-15 -57 -54 -94q9 -112 -49 -181q-64 -76 -197 -78h-36h-76h-17q-66 0 -144 15.5t-121.5 29t-120.5 39.5q-123 43 -158 44q-26 1 -45 19.5t-19 44.5v641q0 25 18 43.5t43 20.5q24 2 76 59t101 121q68 87 101 120q18 18 31 48t17.5 48.5 t13.5 60.5q7 39 12.5 61t19.5 52t34 50q19 19 45 19q46 0 82.5 -10.5t60 -26t40 -40.5t24 -45t12 -50t5 -45t0.5 -39q0 -38 -9.5 -76t-19 -60t-27.5 -56q-3 -6 -10 -18t-11 -22t-8 -24h277q78 0 135 -57t57 -135z" /> +<glyph unicode="" horiz-adv-x="1664" d="M256 960q0 -26 -19 -45t-45 -19q-27 0 -45.5 19t-18.5 45q0 27 18.5 45.5t45.5 18.5q26 0 45 -18.5t19 -45.5zM416 448v640q0 26 -19 45t-45 19h-288q-26 0 -45 -19t-19 -45v-640q0 -26 19 -45t45 -19h288q26 0 45 19t19 45zM1545 597q55 -61 55 -149q-1 -78 -57.5 -135 t-134.5 -57h-277q4 -14 8 -24t11 -22t10 -18q18 -37 27 -57t19 -58.5t10 -76.5q0 -24 -0.5 -39t-5 -45t-12 -50t-24 -45t-40 -40.5t-60 -26t-82.5 -10.5q-26 0 -45 19q-20 20 -34 50t-19.5 52t-12.5 61q-9 42 -13.5 60.5t-17.5 48.5t-31 48q-33 33 -101 120q-49 64 -101 121 t-76 59q-25 2 -43 20.5t-18 43.5v641q0 26 19 44.5t45 19.5q35 1 158 44q77 26 120.5 39.5t121.5 29t144 15.5h17h76h36q133 -2 197 -78q58 -69 49 -181q39 -37 54 -94q17 -61 0 -117q46 -61 43 -137q0 -32 -15 -76z" /> +<glyph unicode="" d="M919 233v157q0 50 -29 50q-17 0 -33 -16v-224q16 -16 33 -16q29 0 29 49zM1103 355h66v34q0 51 -33 51t-33 -51v-34zM532 621v-70h-80v-423h-74v423h-78v70h232zM733 495v-367h-67v40q-39 -45 -76 -45q-33 0 -42 28q-6 16 -6 54v290h66v-270q0 -24 1 -26q1 -15 15 -15 q20 0 42 31v280h67zM985 384v-146q0 -52 -7 -73q-12 -42 -53 -42q-35 0 -68 41v-36h-67v493h67v-161q32 40 68 40q41 0 53 -42q7 -21 7 -74zM1236 255v-9q0 -29 -2 -43q-3 -22 -15 -40q-27 -40 -80 -40q-52 0 -81 38q-21 27 -21 86v129q0 59 20 86q29 38 80 38t78 -38 q21 -28 21 -86v-76h-133v-65q0 -51 34 -51q24 0 30 26q0 1 0.5 7t0.5 16.5v21.5h68zM785 1079v-156q0 -51 -32 -51t-32 51v156q0 52 32 52t32 -52zM1318 366q0 177 -19 260q-10 44 -43 73.5t-76 34.5q-136 15 -412 15q-275 0 -411 -15q-44 -5 -76.5 -34.5t-42.5 -73.5 q-20 -87 -20 -260q0 -176 20 -260q10 -43 42.5 -73t75.5 -35q137 -15 412 -15t412 15q43 5 75.5 35t42.5 73q20 84 20 260zM563 1017l90 296h-75l-51 -195l-53 195h-78l24 -69t23 -69q35 -103 46 -158v-201h74v201zM852 936v130q0 58 -21 87q-29 38 -78 38q-51 0 -78 -38 q-21 -29 -21 -87v-130q0 -58 21 -87q27 -38 78 -38q49 0 78 38q21 27 21 87zM1033 816h67v370h-67v-283q-22 -31 -42 -31q-15 0 -16 16q-1 2 -1 26v272h-67v-293q0 -37 6 -55q11 -27 43 -27q36 0 77 45v-40zM1536 1120v-960q0 -119 -84.5 -203.5t-203.5 -84.5h-960 q-119 0 -203.5 84.5t-84.5 203.5v960q0 119 84.5 203.5t203.5 84.5h960q119 0 203.5 -84.5t84.5 -203.5z" /> +<glyph unicode="" d="M971 292v-211q0 -67 -39 -67q-23 0 -45 22v301q22 22 45 22q39 0 39 -67zM1309 291v-46h-90v46q0 68 45 68t45 -68zM343 509h107v94h-312v-94h105v-569h100v569zM631 -60h89v494h-89v-378q-30 -42 -57 -42q-18 0 -21 21q-1 3 -1 35v364h-89v-391q0 -49 8 -73 q12 -37 58 -37q48 0 102 61v-54zM1060 88v197q0 73 -9 99q-17 56 -71 56q-50 0 -93 -54v217h-89v-663h89v48q45 -55 93 -55q54 0 71 55q9 27 9 100zM1398 98v13h-91q0 -51 -2 -61q-7 -36 -40 -36q-46 0 -46 69v87h179v103q0 79 -27 116q-39 51 -106 51q-68 0 -107 -51 q-28 -37 -28 -116v-173q0 -79 29 -116q39 -51 108 -51q72 0 108 53q18 27 21 54q2 9 2 58zM790 1011v210q0 69 -43 69t-43 -69v-210q0 -70 43 -70t43 70zM1509 260q0 -234 -26 -350q-14 -59 -58 -99t-102 -46q-184 -21 -555 -21t-555 21q-58 6 -102.5 46t-57.5 99 q-26 112 -26 350q0 234 26 350q14 59 58 99t103 47q183 20 554 20t555 -20q58 -7 102.5 -47t57.5 -99q26 -112 26 -350zM511 1536h102l-121 -399v-271h-100v271q-14 74 -61 212q-37 103 -65 187h106l71 -263zM881 1203v-175q0 -81 -28 -118q-37 -51 -106 -51q-67 0 -105 51 q-28 38 -28 118v175q0 80 28 117q38 51 105 51q69 0 106 -51q28 -37 28 -117zM1216 1365v-499h-91v55q-53 -62 -103 -62q-46 0 -59 37q-8 24 -8 75v394h91v-367q0 -33 1 -35q3 -22 21 -22q27 0 57 43v381h91z" /> +<glyph unicode="" horiz-adv-x="1408" d="M597 869q-10 -18 -257 -456q-27 -46 -65 -46h-239q-21 0 -31 17t0 36l253 448q1 0 0 1l-161 279q-12 22 -1 37q9 15 32 15h239q40 0 66 -45zM1403 1511q11 -16 0 -37l-528 -934v-1l336 -615q11 -20 1 -37q-10 -15 -32 -15h-239q-42 0 -66 45l-339 622q18 32 531 942 q25 45 64 45h241q22 0 31 -15z" /> +<glyph unicode="" d="M685 771q0 1 -126 222q-21 34 -52 34h-184q-18 0 -26 -11q-7 -12 1 -29l125 -216v-1l-196 -346q-9 -14 0 -28q8 -13 24 -13h185q31 0 50 36zM1309 1268q-7 12 -24 12h-187q-30 0 -49 -35l-411 -729q1 -2 262 -481q20 -35 52 -35h184q18 0 25 12q8 13 -1 28l-260 476v1 l409 723q8 16 0 28zM1536 1120v-960q0 -119 -84.5 -203.5t-203.5 -84.5h-960q-119 0 -203.5 84.5t-84.5 203.5v960q0 119 84.5 203.5t203.5 84.5h960q119 0 203.5 -84.5t84.5 -203.5z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1280 640q0 37 -30 54l-512 320q-31 20 -65 2q-33 -18 -33 -56v-640q0 -38 33 -56q16 -8 31 -8q20 0 34 10l512 320q30 17 30 54zM1792 640q0 -96 -1 -150t-8.5 -136.5t-22.5 -147.5q-16 -73 -69 -123t-124 -58q-222 -25 -671 -25t-671 25q-71 8 -124.5 58t-69.5 123 q-14 65 -21.5 147.5t-8.5 136.5t-1 150t1 150t8.5 136.5t22.5 147.5q16 73 69 123t124 58q222 25 671 25t671 -25q71 -8 124.5 -58t69.5 -123q14 -65 21.5 -147.5t8.5 -136.5t1 -150z" /> +<glyph unicode="" horiz-adv-x="1792" d="M402 829l494 -305l-342 -285l-490 319zM1388 274v-108l-490 -293v-1l-1 1l-1 -1v1l-489 293v108l147 -96l342 284v2l1 -1l1 1v-2l343 -284zM554 1418l342 -285l-494 -304l-338 270zM1390 829l338 -271l-489 -319l-343 285zM1239 1418l489 -319l-338 -270l-494 304z" /> +<glyph unicode="" d="M1289 -96h-1118v480h-160v-640h1438v640h-160v-480zM347 428l33 157l783 -165l-33 -156zM450 802l67 146l725 -339l-67 -145zM651 1158l102 123l614 -513l-102 -123zM1048 1536l477 -641l-128 -96l-477 641zM330 65v159h800v-159h-800z" /> +<glyph unicode="" d="M1024 640q0 106 -75 181t-181 75t-181 -75t-75 -181t75 -181t181 -75t181 75t75 181zM1162 640q0 -164 -115 -279t-279 -115t-279 115t-115 279t115 279t279 115t279 -115t115 -279zM1270 1050q0 -38 -27 -65t-65 -27t-65 27t-27 65t27 65t65 27t65 -27t27 -65zM768 1270 q-7 0 -76.5 0.5t-105.5 0t-96.5 -3t-103 -10t-71.5 -18.5q-50 -20 -88 -58t-58 -88q-11 -29 -18.5 -71.5t-10 -103t-3 -96.5t0 -105.5t0.5 -76.5t-0.5 -76.5t0 -105.5t3 -96.5t10 -103t18.5 -71.5q20 -50 58 -88t88 -58q29 -11 71.5 -18.5t103 -10t96.5 -3t105.5 0t76.5 0.5 t76.5 -0.5t105.5 0t96.5 3t103 10t71.5 18.5q50 20 88 58t58 88q11 29 18.5 71.5t10 103t3 96.5t0 105.5t-0.5 76.5t0.5 76.5t0 105.5t-3 96.5t-10 103t-18.5 71.5q-20 50 -58 88t-88 58q-29 11 -71.5 18.5t-103 10t-96.5 3t-105.5 0t-76.5 -0.5zM1536 640q0 -229 -5 -317 q-10 -208 -124 -322t-322 -124q-88 -5 -317 -5t-317 5q-208 10 -322 124t-124 322q-5 88 -5 317t5 317q10 208 124 322t322 124q88 5 317 5t317 -5q208 -10 322 -124t124 -322q5 -88 5 -317z" /> +<glyph unicode="" d="M1248 1408q119 0 203.5 -84.5t84.5 -203.5v-960q0 -119 -84.5 -203.5t-203.5 -84.5h-960q-119 0 -203.5 84.5t-84.5 203.5v960q0 119 84.5 203.5t203.5 84.5h960zM698 640q0 88 -62 150t-150 62t-150 -62t-62 -150t62 -150t150 -62t150 62t62 150zM1262 640q0 88 -62 150 t-150 62t-150 -62t-62 -150t62 -150t150 -62t150 62t62 150z" /> +<glyph unicode="" d="M768 914l201 -306h-402zM1133 384h94l-459 691l-459 -691h94l104 160h522zM1536 640q0 -209 -103 -385.5t-279.5 -279.5t-385.5 -103t-385.5 103t-279.5 279.5t-103 385.5t103 385.5t279.5 279.5t385.5 103t385.5 -103t279.5 -279.5t103 -385.5z" /> +<glyph unicode="" horiz-adv-x="1408" d="M815 677q8 -63 -50.5 -101t-111.5 -6q-39 17 -53.5 58t-0.5 82t52 58q36 18 72.5 12t64 -35.5t27.5 -67.5zM926 698q-14 107 -113 164t-197 13q-63 -28 -100.5 -88.5t-34.5 -129.5q4 -91 77.5 -155t165.5 -56q91 8 152 84t50 168zM1165 1240q-20 27 -56 44.5t-58 22 t-71 12.5q-291 47 -566 -2q-43 -7 -66 -12t-55 -22t-50 -43q30 -28 76 -45.5t73.5 -22t87.5 -11.5q228 -29 448 -1q63 8 89.5 12t72.5 21.5t75 46.5zM1222 205q-8 -26 -15.5 -76.5t-14 -84t-28.5 -70t-58 -56.5q-86 -48 -189.5 -71.5t-202 -22t-201.5 18.5q-46 8 -81.5 18 t-76.5 27t-73 43.5t-52 61.5q-25 96 -57 292l6 16l18 9q223 -148 506.5 -148t507.5 148q21 -6 24 -23t-5 -45t-8 -37zM1403 1166q-26 -167 -111 -655q-5 -30 -27 -56t-43.5 -40t-54.5 -31q-252 -126 -610 -88q-248 27 -394 139q-15 12 -25.5 26.5t-17 35t-9 34t-6 39.5 t-5.5 35q-9 50 -26.5 150t-28 161.5t-23.5 147.5t-22 158q3 26 17.5 48.5t31.5 37.5t45 30t46 22.5t48 18.5q125 46 313 64q379 37 676 -50q155 -46 215 -122q16 -20 16.5 -51t-5.5 -54z" /> +<glyph unicode="" d="M848 666q0 43 -41 66t-77 1q-43 -20 -42.5 -72.5t43.5 -70.5q39 -23 81 4t36 72zM928 682q8 -66 -36 -121t-110 -61t-119 40t-56 113q-2 49 25.5 93t72.5 64q70 31 141.5 -10t81.5 -118zM1100 1073q-20 -21 -53.5 -34t-53 -16t-63.5 -8q-155 -20 -324 0q-44 6 -63 9.5 t-52.5 16t-54.5 32.5q13 19 36 31t40 15.5t47 8.5q198 35 408 1q33 -5 51 -8.5t43 -16t39 -31.5zM1142 327q0 7 5.5 26.5t3 32t-17.5 16.5q-161 -106 -365 -106t-366 106l-12 -6l-5 -12q26 -154 41 -210q47 -81 204 -108q249 -46 428 53q34 19 49 51.5t22.5 85.5t12.5 71z M1272 1020q9 53 -8 75q-43 55 -155 88q-216 63 -487 36q-132 -12 -226 -46q-38 -15 -59.5 -25t-47 -34t-29.5 -54q8 -68 19 -138t29 -171t24 -137q1 -5 5 -31t7 -36t12 -27t22 -28q105 -80 284 -100q259 -28 440 63q24 13 39.5 23t31 29t19.5 40q48 267 80 473zM1536 1120 v-960q0 -119 -84.5 -203.5t-203.5 -84.5h-960q-119 0 -203.5 84.5t-84.5 203.5v960q0 119 84.5 203.5t203.5 84.5h960q119 0 203.5 -84.5t84.5 -203.5z" /> +<glyph unicode="" horiz-adv-x="1024" d="M944 207l80 -237q-23 -35 -111 -66t-177 -32q-104 -2 -190.5 26t-142.5 74t-95 106t-55.5 120t-16.5 118v544h-168v215q72 26 129 69.5t91 90t58 102t34 99t15 88.5q1 5 4.5 8.5t7.5 3.5h244v-424h333v-252h-334v-518q0 -30 6.5 -56t22.5 -52.5t49.5 -41.5t81.5 -14 q78 2 134 29z" /> +<glyph unicode="" d="M1136 75l-62 183q-44 -22 -103 -22q-36 -1 -62 10.5t-38.5 31.5t-17.5 40.5t-5 43.5v398h257v194h-256v326h-188q-8 0 -9 -10q-5 -44 -17.5 -87t-39 -95t-77 -95t-118.5 -68v-165h130v-418q0 -57 21.5 -115t65 -111t121 -85.5t176.5 -30.5q69 1 136.5 25t85.5 50z M1536 1120v-960q0 -119 -84.5 -203.5t-203.5 -84.5h-960q-119 0 -203.5 84.5t-84.5 203.5v960q0 119 84.5 203.5t203.5 84.5h960q119 0 203.5 -84.5t84.5 -203.5z" /> +<glyph unicode="" horiz-adv-x="768" d="M765 237q8 -19 -5 -35l-350 -384q-10 -10 -23 -10q-14 0 -24 10l-355 384q-13 16 -5 35q9 19 29 19h224v1248q0 14 9 23t23 9h192q14 0 23 -9t9 -23v-1248h224q21 0 29 -19z" /> +<glyph unicode="" horiz-adv-x="768" d="M765 1043q-9 -19 -29 -19h-224v-1248q0 -14 -9 -23t-23 -9h-192q-14 0 -23 9t-9 23v1248h-224q-21 0 -29 19t5 35l350 384q10 10 23 10q14 0 24 -10l355 -384q13 -16 5 -35z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1792 736v-192q0 -14 -9 -23t-23 -9h-1248v-224q0 -21 -19 -29t-35 5l-384 350q-10 10 -10 23q0 14 10 24l384 354q16 14 35 6q19 -9 19 -29v-224h1248q14 0 23 -9t9 -23z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1728 643q0 -14 -10 -24l-384 -354q-16 -14 -35 -6q-19 9 -19 29v224h-1248q-14 0 -23 9t-9 23v192q0 14 9 23t23 9h1248v224q0 21 19 29t35 -5l384 -350q10 -10 10 -23z" /> +<glyph unicode="" horiz-adv-x="1408" d="M1393 321q-39 -125 -123 -250q-129 -196 -257 -196q-49 0 -140 32q-86 32 -151 32q-61 0 -142 -33q-81 -34 -132 -34q-152 0 -301 259q-147 261 -147 503q0 228 113 374q112 144 284 144q72 0 177 -30q104 -30 138 -30q45 0 143 34q102 34 173 34q119 0 213 -65 q52 -36 104 -100q-79 -67 -114 -118q-65 -94 -65 -207q0 -124 69 -223t158 -126zM1017 1494q0 -61 -29 -136q-30 -75 -93 -138q-54 -54 -108 -72q-37 -11 -104 -17q3 149 78 257q74 107 250 148q1 -3 2.5 -11t2.5 -11q0 -4 0.5 -10t0.5 -10z" /> +<glyph unicode="" horiz-adv-x="1664" d="M682 530v-651l-682 94v557h682zM682 1273v-659h-682v565zM1664 530v-786l-907 125v661h907zM1664 1408v-794h-907v669z" /> +<glyph unicode="" horiz-adv-x="1408" d="M493 1053q16 0 27.5 11.5t11.5 27.5t-11.5 27.5t-27.5 11.5t-27 -11.5t-11 -27.5t11 -27.5t27 -11.5zM915 1053q16 0 27 11.5t11 27.5t-11 27.5t-27 11.5t-27.5 -11.5t-11.5 -27.5t11.5 -27.5t27.5 -11.5zM103 869q42 0 72 -30t30 -72v-430q0 -43 -29.5 -73t-72.5 -30 t-73 30t-30 73v430q0 42 30 72t73 30zM1163 850v-666q0 -46 -32 -78t-77 -32h-75v-227q0 -43 -30 -73t-73 -30t-73 30t-30 73v227h-138v-227q0 -43 -30 -73t-73 -30q-42 0 -72 30t-30 73l-1 227h-74q-46 0 -78 32t-32 78v666h918zM931 1255q107 -55 171 -153.5t64 -215.5 h-925q0 117 64 215.5t172 153.5l-71 131q-7 13 5 20q13 6 20 -6l72 -132q95 42 201 42t201 -42l72 132q7 12 20 6q12 -7 5 -20zM1408 767v-430q0 -43 -30 -73t-73 -30q-42 0 -72 30t-30 73v430q0 43 30 72.5t72 29.5q43 0 73 -29.5t30 -72.5z" /> +<glyph unicode="" d="M663 1125q-11 -1 -15.5 -10.5t-8.5 -9.5q-5 -1 -5 5q0 12 19 15h10zM750 1111q-4 -1 -11.5 6.5t-17.5 4.5q24 11 32 -2q3 -6 -3 -9zM399 684q-4 1 -6 -3t-4.5 -12.5t-5.5 -13.5t-10 -13q-7 -10 -1 -12q4 -1 12.5 7t12.5 18q1 3 2 7t2 6t1.5 4.5t0.5 4v3t-1 2.5t-3 2z M1254 325q0 18 -55 42q4 15 7.5 27.5t5 26t3 21.5t0.5 22.5t-1 19.5t-3.5 22t-4 20.5t-5 25t-5.5 26.5q-10 48 -47 103t-72 75q24 -20 57 -83q87 -162 54 -278q-11 -40 -50 -42q-31 -4 -38.5 18.5t-8 83.5t-11.5 107q-9 39 -19.5 69t-19.5 45.5t-15.5 24.5t-13 15t-7.5 7 q-14 62 -31 103t-29.5 56t-23.5 33t-15 40q-4 21 6 53.5t4.5 49.5t-44.5 25q-15 3 -44.5 18t-35.5 16q-8 1 -11 26t8 51t36 27q37 3 51 -30t4 -58q-11 -19 -2 -26.5t30 -0.5q13 4 13 36v37q-5 30 -13.5 50t-21 30.5t-23.5 15t-27 7.5q-107 -8 -89 -134q0 -15 -1 -15 q-9 9 -29.5 10.5t-33 -0.5t-15.5 5q1 57 -16 90t-45 34q-27 1 -41.5 -27.5t-16.5 -59.5q-1 -15 3.5 -37t13 -37.5t15.5 -13.5q10 3 16 14q4 9 -7 8q-7 0 -15.5 14.5t-9.5 33.5q-1 22 9 37t34 14q17 0 27 -21t9.5 -39t-1.5 -22q-22 -15 -31 -29q-8 -12 -27.5 -23.5 t-20.5 -12.5q-13 -14 -15.5 -27t7.5 -18q14 -8 25 -19.5t16 -19t18.5 -13t35.5 -6.5q47 -2 102 15q2 1 23 7t34.5 10.5t29.5 13t21 17.5q9 14 20 8q5 -3 6.5 -8.5t-3 -12t-16.5 -9.5q-20 -6 -56.5 -21.5t-45.5 -19.5q-44 -19 -70 -23q-25 -5 -79 2q-10 2 -9 -2t17 -19 q25 -23 67 -22q17 1 36 7t36 14t33.5 17.5t30 17t24.5 12t17.5 2.5t8.5 -11q0 -2 -1 -4.5t-4 -5t-6 -4.5t-8.5 -5t-9 -4.5t-10 -5t-9.5 -4.5q-28 -14 -67.5 -44t-66.5 -43t-49 -1q-21 11 -63 73q-22 31 -25 22q-1 -3 -1 -10q0 -25 -15 -56.5t-29.5 -55.5t-21 -58t11.5 -63 q-23 -6 -62.5 -90t-47.5 -141q-2 -18 -1.5 -69t-5.5 -59q-8 -24 -29 -3q-32 31 -36 94q-2 28 4 56q4 19 -1 18l-4 -5q-36 -65 10 -166q5 -12 25 -28t24 -20q20 -23 104 -90.5t93 -76.5q16 -15 17.5 -38t-14 -43t-45.5 -23q8 -15 29 -44.5t28 -54t7 -70.5q46 24 7 92 q-4 8 -10.5 16t-9.5 12t-2 6q3 5 13 9.5t20 -2.5q46 -52 166 -36q133 15 177 87q23 38 34 30q12 -6 10 -52q-1 -25 -23 -92q-9 -23 -6 -37.5t24 -15.5q3 19 14.5 77t13.5 90q2 21 -6.5 73.5t-7.5 97t23 70.5q15 18 51 18q1 37 34.5 53t72.5 10.5t60 -22.5zM626 1152 q3 17 -2.5 30t-11.5 15q-9 2 -9 -7q2 -5 5 -6q10 0 7 -15q-3 -20 8 -20q3 0 3 3zM1045 955q-2 8 -6.5 11.5t-13 5t-14.5 5.5q-5 3 -9.5 8t-7 8t-5.5 6.5t-4 4t-4 -1.5q-14 -16 7 -43.5t39 -31.5q9 -1 14.5 8t3.5 20zM867 1168q0 11 -5 19.5t-11 12.5t-9 3q-14 -1 -7 -7l4 -2 q14 -4 18 -31q0 -3 8 2zM921 1401q0 2 -2.5 5t-9 7t-9.5 6q-15 15 -24 15q-9 -1 -11.5 -7.5t-1 -13t-0.5 -12.5q-1 -4 -6 -10.5t-6 -9t3 -8.5q4 -3 8 0t11 9t15 9q1 1 9 1t15 2t9 7zM1486 60q20 -12 31 -24.5t12 -24t-2.5 -22.5t-15.5 -22t-23.5 -19.5t-30 -18.5 t-31.5 -16.5t-32 -15.5t-27 -13q-38 -19 -85.5 -56t-75.5 -64q-17 -16 -68 -19.5t-89 14.5q-18 9 -29.5 23.5t-16.5 25.5t-22 19.5t-47 9.5q-44 1 -130 1q-19 0 -57 -1.5t-58 -2.5q-44 -1 -79.5 -15t-53.5 -30t-43.5 -28.5t-53.5 -11.5q-29 1 -111 31t-146 43q-19 4 -51 9.5 t-50 9t-39.5 9.5t-33.5 14.5t-17 19.5q-10 23 7 66.5t18 54.5q1 16 -4 40t-10 42.5t-4.5 36.5t10.5 27q14 12 57 14t60 12q30 18 42 35t12 51q21 -73 -32 -106q-32 -20 -83 -15q-34 3 -43 -10q-13 -15 5 -57q2 -6 8 -18t8.5 -18t4.5 -17t1 -22q0 -15 -17 -49t-14 -48 q3 -17 37 -26q20 -6 84.5 -18.5t99.5 -20.5q24 -6 74 -22t82.5 -23t55.5 -4q43 6 64.5 28t23 48t-7.5 58.5t-19 52t-20 36.5q-121 190 -169 242q-68 74 -113 40q-11 -9 -15 15q-3 16 -2 38q1 29 10 52t24 47t22 42q8 21 26.5 72t29.5 78t30 61t39 54q110 143 124 195 q-12 112 -16 310q-2 90 24 151.5t106 104.5q39 21 104 21q53 1 106 -13.5t89 -41.5q57 -42 91.5 -121.5t29.5 -147.5q-5 -95 30 -214q34 -113 133 -218q55 -59 99.5 -163t59.5 -191q8 -49 5 -84.5t-12 -55.5t-20 -22q-10 -2 -23.5 -19t-27 -35.5t-40.5 -33.5t-61 -14 q-18 1 -31.5 5t-22.5 13.5t-13.5 15.5t-11.5 20.5t-9 19.5q-22 37 -41 30t-28 -49t7 -97q20 -70 1 -195q-10 -65 18 -100.5t73 -33t85 35.5q59 49 89.5 66.5t103.5 42.5q53 18 77 36.5t18.5 34.5t-25 28.5t-51.5 23.5q-33 11 -49.5 48t-15 72.5t15.5 47.5q1 -31 8 -56.5 t14.5 -40.5t20.5 -28.5t21 -19t21.5 -13t16.5 -9.5z" /> +<glyph unicode="" d="M1024 36q-42 241 -140 498h-2l-2 -1q-16 -6 -43 -16.5t-101 -49t-137 -82t-131 -114.5t-103 -148l-15 11q184 -150 418 -150q132 0 256 52zM839 643q-21 49 -53 111q-311 -93 -673 -93q-1 -7 -1 -21q0 -124 44 -236.5t124 -201.5q50 89 123.5 166.5t142.5 124.5t130.5 81 t99.5 48l37 13q4 1 13 3.5t13 4.5zM732 855q-120 213 -244 378q-138 -65 -234 -186t-128 -272q302 0 606 80zM1416 536q-210 60 -409 29q87 -239 128 -469q111 75 185 189.5t96 250.5zM611 1277q-1 0 -2 -1q1 1 2 1zM1201 1132q-185 164 -433 164q-76 0 -155 -19 q131 -170 246 -382q69 26 130 60.5t96.5 61.5t65.5 57t37.5 40.5zM1424 647q-3 232 -149 410l-1 -1q-9 -12 -19 -24.5t-43.5 -44.5t-71 -60.5t-100 -65t-131.5 -64.5q25 -53 44 -95q2 -6 6.5 -17.5t7.5 -16.5q36 5 74.5 7t73.5 2t69 -1.5t64 -4t56.5 -5.5t48 -6.5t36.5 -6 t25 -4.5zM1536 640q0 -209 -103 -385.5t-279.5 -279.5t-385.5 -103t-385.5 103t-279.5 279.5t-103 385.5t103 385.5t279.5 279.5t385.5 103t385.5 -103t279.5 -279.5t103 -385.5z" /> +<glyph unicode="" d="M1173 473q0 50 -19.5 91.5t-48.5 68.5t-73 49t-82.5 34t-87.5 23l-104 24q-30 7 -44 10.5t-35 11.5t-30 16t-16.5 21t-7.5 30q0 77 144 77q43 0 77 -12t54 -28.5t38 -33.5t40 -29t48 -12q47 0 75.5 32t28.5 77q0 55 -56 99.5t-142 67.5t-182 23q-68 0 -132 -15.5 t-119.5 -47t-89 -87t-33.5 -128.5q0 -61 19 -106.5t56 -75.5t80 -48.5t103 -32.5l146 -36q90 -22 112 -36q32 -20 32 -60q0 -39 -40 -64.5t-105 -25.5q-51 0 -91.5 16t-65 38.5t-45.5 45t-46 38.5t-54 16q-50 0 -75.5 -30t-25.5 -75q0 -92 122 -157.5t291 -65.5 q73 0 140 18.5t122.5 53.5t88.5 93.5t33 131.5zM1536 256q0 -159 -112.5 -271.5t-271.5 -112.5q-130 0 -234 80q-77 -16 -150 -16q-143 0 -273.5 55.5t-225 150t-150 225t-55.5 273.5q0 73 16 150q-80 104 -80 234q0 159 112.5 271.5t271.5 112.5q130 0 234 -80 q77 16 150 16q143 0 273.5 -55.5t225 -150t150 -225t55.5 -273.5q0 -73 -16 -150q80 -104 80 -234z" /> +<glyph unicode="" horiz-adv-x="1280" d="M1000 1102l37 194q5 23 -9 40t-35 17h-712q-23 0 -38.5 -17t-15.5 -37v-1101q0 -7 6 -1l291 352q23 26 38 33.5t48 7.5h239q22 0 37 14.5t18 29.5q24 130 37 191q4 21 -11.5 40t-36.5 19h-294q-29 0 -48 19t-19 48v42q0 29 19 47.5t48 18.5h346q18 0 35 13.5t20 29.5z M1227 1324q-15 -73 -53.5 -266.5t-69.5 -350t-35 -173.5q-6 -22 -9 -32.5t-14 -32.5t-24.5 -33t-38.5 -21t-58 -10h-271q-13 0 -22 -10q-8 -9 -426 -494q-22 -25 -58.5 -28.5t-48.5 5.5q-55 22 -55 98v1410q0 55 38 102.5t120 47.5h888q95 0 127 -53t10 -159zM1227 1324 l-158 -790q4 17 35 173.5t69.5 350t53.5 266.5z" /> +<glyph unicode="" d="M704 192v1024q0 14 -9 23t-23 9h-480q-14 0 -23 -9t-9 -23v-1024q0 -14 9 -23t23 -9h480q14 0 23 9t9 23zM1376 576v640q0 14 -9 23t-23 9h-480q-14 0 -23 -9t-9 -23v-640q0 -14 9 -23t23 -9h480q14 0 23 9t9 23zM1536 1344v-1408q0 -26 -19 -45t-45 -19h-1408 q-26 0 -45 19t-19 45v1408q0 26 19 45t45 19h1408q26 0 45 -19t19 -45z" /> +<glyph unicode="" horiz-adv-x="1280" d="M1280 480q0 -40 -28 -68t-68 -28q-51 0 -80 43l-227 341h-45v-132l247 -411q9 -15 9 -33q0 -26 -19 -45t-45 -19h-192v-272q0 -46 -33 -79t-79 -33h-160q-46 0 -79 33t-33 79v272h-192q-26 0 -45 19t-19 45q0 18 9 33l247 411v132h-45l-227 -341q-29 -43 -80 -43 q-40 0 -68 28t-28 68q0 29 16 53l256 384q73 107 176 107h384q103 0 176 -107l256 -384q16 -24 16 -53zM864 1280q0 -93 -65.5 -158.5t-158.5 -65.5t-158.5 65.5t-65.5 158.5t65.5 158.5t158.5 65.5t158.5 -65.5t65.5 -158.5z" /> +<glyph unicode="" horiz-adv-x="1024" d="M1024 832v-416q0 -40 -28 -68t-68 -28t-68 28t-28 68v352h-64v-912q0 -46 -33 -79t-79 -33t-79 33t-33 79v464h-64v-464q0 -46 -33 -79t-79 -33t-79 33t-33 79v912h-64v-352q0 -40 -28 -68t-68 -28t-68 28t-28 68v416q0 80 56 136t136 56h640q80 0 136 -56t56 -136z M736 1280q0 -93 -65.5 -158.5t-158.5 -65.5t-158.5 65.5t-65.5 158.5t65.5 158.5t158.5 65.5t158.5 -65.5t65.5 -158.5z" /> +<glyph unicode="" d="M773 234l350 473q16 22 24.5 59t-6 85t-61.5 79q-40 26 -83 25.5t-73.5 -17.5t-54.5 -45q-36 -40 -96 -40q-59 0 -95 40q-24 28 -54.5 45t-73.5 17.5t-84 -25.5q-46 -31 -60.5 -79t-6 -85t24.5 -59zM1536 640q0 -209 -103 -385.5t-279.5 -279.5t-385.5 -103t-385.5 103 t-279.5 279.5t-103 385.5t103 385.5t279.5 279.5t385.5 103t385.5 -103t279.5 -279.5t103 -385.5z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1472 640q0 117 -45.5 223.5t-123 184t-184 123t-223.5 45.5t-223.5 -45.5t-184 -123t-123 -184t-45.5 -223.5t45.5 -223.5t123 -184t184 -123t223.5 -45.5t223.5 45.5t184 123t123 184t45.5 223.5zM1748 363q-4 -15 -20 -20l-292 -96v-306q0 -16 -13 -26q-15 -10 -29 -4 l-292 94l-180 -248q-10 -13 -26 -13t-26 13l-180 248l-292 -94q-14 -6 -29 4q-13 10 -13 26v306l-292 96q-16 5 -20 20q-5 17 4 29l180 248l-180 248q-9 13 -4 29q4 15 20 20l292 96v306q0 16 13 26q15 10 29 4l292 -94l180 248q9 12 26 12t26 -12l180 -248l292 94 q14 6 29 -4q13 -10 13 -26v-306l292 -96q16 -5 20 -20q5 -16 -4 -29l-180 -248l180 -248q9 -12 4 -29z" /> +<glyph unicode="" d="M1262 233q-54 -9 -110 -9q-182 0 -337 90t-245 245t-90 337q0 192 104 357q-201 -60 -328.5 -229t-127.5 -384q0 -130 51 -248.5t136.5 -204t204 -136.5t248.5 -51q144 0 273.5 61.5t220.5 171.5zM1465 318q-94 -203 -283.5 -324.5t-413.5 -121.5q-156 0 -298 61 t-245 164t-164 245t-61 298q0 153 57.5 292.5t156 241.5t235.5 164.5t290 68.5q44 2 61 -39q18 -41 -15 -72q-86 -78 -131.5 -181.5t-45.5 -218.5q0 -148 73 -273t198 -198t273 -73q118 0 228 51q41 18 72 -13q14 -14 17.5 -34t-4.5 -38z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1088 704q0 26 -19 45t-45 19h-256q-26 0 -45 -19t-19 -45t19 -45t45 -19h256q26 0 45 19t19 45zM1664 896v-960q0 -26 -19 -45t-45 -19h-1408q-26 0 -45 19t-19 45v960q0 26 19 45t45 19h1408q26 0 45 -19t19 -45zM1728 1344v-256q0 -26 -19 -45t-45 -19h-1536 q-26 0 -45 19t-19 45v256q0 26 19 45t45 19h1536q26 0 45 -19t19 -45z" /> +<glyph unicode="" horiz-adv-x="1664" d="M1632 576q0 -26 -19 -45t-45 -19h-224q0 -171 -67 -290l208 -209q19 -19 19 -45t-19 -45q-18 -19 -45 -19t-45 19l-198 197q-5 -5 -15 -13t-42 -28.5t-65 -36.5t-82 -29t-97 -13v896h-128v-896q-51 0 -101.5 13.5t-87 33t-66 39t-43.5 32.5l-15 14l-183 -207 q-20 -21 -48 -21q-24 0 -43 16q-19 18 -20.5 44.5t15.5 46.5l202 227q-58 114 -58 274h-224q-26 0 -45 19t-19 45t19 45t45 19h224v294l-173 173q-19 19 -19 45t19 45t45 19t45 -19l173 -173h844l173 173q19 19 45 19t45 -19t19 -45t-19 -45l-173 -173v-294h224q26 0 45 -19 t19 -45zM1152 1152h-640q0 133 93.5 226.5t226.5 93.5t226.5 -93.5t93.5 -226.5z" /> +<glyph unicode="" horiz-adv-x="1920" d="M1917 1016q23 -64 -150 -294q-24 -32 -65 -85q-78 -100 -90 -131q-17 -41 14 -81q17 -21 81 -82h1l1 -1l1 -1l2 -2q141 -131 191 -221q3 -5 6.5 -12.5t7 -26.5t-0.5 -34t-25 -27.5t-59 -12.5l-256 -4q-24 -5 -56 5t-52 22l-20 12q-30 21 -70 64t-68.5 77.5t-61 58 t-56.5 15.5q-3 -1 -8 -3.5t-17 -14.5t-21.5 -29.5t-17 -52t-6.5 -77.5q0 -15 -3.5 -27.5t-7.5 -18.5l-4 -5q-18 -19 -53 -22h-115q-71 -4 -146 16.5t-131.5 53t-103 66t-70.5 57.5l-25 24q-10 10 -27.5 30t-71.5 91t-106 151t-122.5 211t-130.5 272q-6 16 -6 27t3 16l4 6 q15 19 57 19l274 2q12 -2 23 -6.5t16 -8.5l5 -3q16 -11 24 -32q20 -50 46 -103.5t41 -81.5l16 -29q29 -60 56 -104t48.5 -68.5t41.5 -38.5t34 -14t27 5q2 1 5 5t12 22t13.5 47t9.5 81t0 125q-2 40 -9 73t-14 46l-6 12q-25 34 -85 43q-13 2 5 24q17 19 38 30q53 26 239 24 q82 -1 135 -13q20 -5 33.5 -13.5t20.5 -24t10.5 -32t3.5 -45.5t-1 -55t-2.5 -70.5t-1.5 -82.5q0 -11 -1 -42t-0.5 -48t3.5 -40.5t11.5 -39t22.5 -24.5q8 -2 17 -4t26 11t38 34.5t52 67t68 107.5q60 104 107 225q4 10 10 17.5t11 10.5l4 3l5 2.5t13 3t20 0.5l288 2 q39 5 64 -2.5t31 -16.5z" /> +<glyph unicode="" horiz-adv-x="1792" d="M675 252q21 34 11 69t-45 50q-34 14 -73 1t-60 -46q-22 -34 -13 -68.5t43 -50.5t74.5 -2.5t62.5 47.5zM769 373q8 13 3.5 26.5t-17.5 18.5q-14 5 -28.5 -0.5t-21.5 -18.5q-17 -31 13 -45q14 -5 29 0.5t22 18.5zM943 266q-45 -102 -158 -150t-224 -12 q-107 34 -147.5 126.5t6.5 187.5q47 93 151.5 139t210.5 19q111 -29 158.5 -119.5t2.5 -190.5zM1255 426q-9 96 -89 170t-208.5 109t-274.5 21q-223 -23 -369.5 -141.5t-132.5 -264.5q9 -96 89 -170t208.5 -109t274.5 -21q223 23 369.5 141.5t132.5 264.5zM1563 422 q0 -68 -37 -139.5t-109 -137t-168.5 -117.5t-226 -83t-270.5 -31t-275 33.5t-240.5 93t-171.5 151t-65 199.5q0 115 69.5 245t197.5 258q169 169 341.5 236t246.5 -7q65 -64 20 -209q-4 -14 -1 -20t10 -7t14.5 0.5t13.5 3.5l6 2q139 59 246 59t153 -61q45 -63 0 -178 q-2 -13 -4.5 -20t4.5 -12.5t12 -7.5t17 -6q57 -18 103 -47t80 -81.5t34 -116.5zM1489 1046q42 -47 54.5 -108.5t-6.5 -117.5q-8 -23 -29.5 -34t-44.5 -4q-23 8 -34 29.5t-4 44.5q20 63 -24 111t-107 35q-24 -5 -45 8t-25 37q-5 24 8 44.5t37 25.5q60 13 119 -5.5t101 -65.5z M1670 1209q87 -96 112.5 -222.5t-13.5 -241.5q-9 -27 -34 -40t-52 -4t-40 34t-5 52q28 82 10 172t-80 158q-62 69 -148 95.5t-173 8.5q-28 -6 -52 9.5t-30 43.5t9.5 51.5t43.5 29.5q123 26 244 -11.5t208 -134.5z" /> +<glyph unicode="" d="M1133 -34q-171 -94 -368 -94q-196 0 -367 94q138 87 235.5 211t131.5 268q35 -144 132.5 -268t235.5 -211zM638 1394v-485q0 -252 -126.5 -459.5t-330.5 -306.5q-181 215 -181 495q0 187 83.5 349.5t229.5 269.5t325 137zM1536 638q0 -280 -181 -495 q-204 99 -330.5 306.5t-126.5 459.5v485q179 -30 325 -137t229.5 -269.5t83.5 -349.5z" /> +<glyph unicode="" horiz-adv-x="1408" d="M1402 433q-32 -80 -76 -138t-91 -88.5t-99 -46.5t-101.5 -14.5t-96.5 8.5t-86.5 22t-69.5 27.5t-46 22.5l-17 10q-113 -228 -289.5 -359.5t-384.5 -132.5q-19 0 -32 13t-13 32t13 31.5t32 12.5q173 1 322.5 107.5t251.5 294.5q-36 -14 -72 -23t-83 -13t-91 2.5t-93 28.5 t-92 59t-84.5 100t-74.5 146q114 47 214 57t167.5 -7.5t124.5 -56.5t88.5 -77t56.5 -82q53 131 79 291q-7 -1 -18 -2.5t-46.5 -2.5t-69.5 0.5t-81.5 10t-88.5 23t-84 42.5t-75 65t-54.5 94.5t-28.5 127.5q70 28 133.5 36.5t112.5 -1t92 -30t73.5 -50t56 -61t42 -63t27.5 -56 t16 -39.5l4 -16q12 122 12 195q-8 6 -21.5 16t-49 44.5t-63.5 71.5t-54 93t-33 112.5t12 127t70 138.5q73 -25 127.5 -61.5t84.5 -76.5t48 -85t20.5 -89t-0.5 -85.5t-13 -76.5t-19 -62t-17 -42l-7 -15q1 -5 1 -50.5t-1 -71.5q3 7 10 18.5t30.5 43t50.5 58t71 55.5t91.5 44.5 t112 14.5t132.5 -24q-2 -78 -21.5 -141.5t-50 -104.5t-69.5 -71.5t-81.5 -45.5t-84.5 -24t-80 -9.5t-67.5 1t-46.5 4.5l-17 3q-23 -147 -73 -283q6 7 18 18.5t49.5 41t77.5 52.5t99.5 42t117.5 20t129 -23.5t137 -77.5z" /> +<glyph unicode="" horiz-adv-x="1280" d="M1259 283v-66q0 -85 -57.5 -144.5t-138.5 -59.5h-57l-260 -269v269h-529q-81 0 -138.5 59.5t-57.5 144.5v66h1238zM1259 609v-255h-1238v255h1238zM1259 937v-255h-1238v255h1238zM1259 1077v-67h-1238v67q0 84 57.5 143.5t138.5 59.5h846q81 0 138.5 -59.5t57.5 -143.5z " /> +<glyph unicode="" d="M1152 640q0 -14 -9 -23l-320 -320q-9 -9 -23 -9q-13 0 -22.5 9.5t-9.5 22.5v192h-352q-13 0 -22.5 9.5t-9.5 22.5v192q0 13 9.5 22.5t22.5 9.5h352v192q0 14 9 23t23 9q12 0 24 -10l319 -319q9 -9 9 -23zM1312 640q0 148 -73 273t-198 198t-273 73t-273 -73t-198 -198 t-73 -273t73 -273t198 -198t273 -73t273 73t198 198t73 273zM1536 640q0 -209 -103 -385.5t-279.5 -279.5t-385.5 -103t-385.5 103t-279.5 279.5t-103 385.5t103 385.5t279.5 279.5t385.5 103t385.5 -103t279.5 -279.5t103 -385.5z" /> +<glyph unicode="" d="M1152 736v-192q0 -13 -9.5 -22.5t-22.5 -9.5h-352v-192q0 -14 -9 -23t-23 -9q-12 0 -24 10l-319 319q-9 9 -9 23t9 23l320 320q9 9 23 9q13 0 22.5 -9.5t9.5 -22.5v-192h352q13 0 22.5 -9.5t9.5 -22.5zM1312 640q0 148 -73 273t-198 198t-273 73t-273 -73t-198 -198 t-73 -273t73 -273t198 -198t273 -73t273 73t198 198t73 273zM1536 640q0 -209 -103 -385.5t-279.5 -279.5t-385.5 -103t-385.5 103t-279.5 279.5t-103 385.5t103 385.5t279.5 279.5t385.5 103t385.5 -103t279.5 -279.5t103 -385.5z" /> +<glyph unicode="" d="M1024 960v-640q0 -26 -19 -45t-45 -19q-20 0 -37 12l-448 320q-27 19 -27 52t27 52l448 320q17 12 37 12q26 0 45 -19t19 -45zM1280 160v960q0 13 -9.5 22.5t-22.5 9.5h-960q-13 0 -22.5 -9.5t-9.5 -22.5v-960q0 -13 9.5 -22.5t22.5 -9.5h960q13 0 22.5 9.5t9.5 22.5z M1536 1120v-960q0 -119 -84.5 -203.5t-203.5 -84.5h-960q-119 0 -203.5 84.5t-84.5 203.5v960q0 119 84.5 203.5t203.5 84.5h960q119 0 203.5 -84.5t84.5 -203.5z" /> +<glyph unicode="" d="M1024 640q0 -106 -75 -181t-181 -75t-181 75t-75 181t75 181t181 75t181 -75t75 -181zM768 1184q-148 0 -273 -73t-198 -198t-73 -273t73 -273t198 -198t273 -73t273 73t198 198t73 273t-73 273t-198 198t-273 73zM1536 640q0 -209 -103 -385.5t-279.5 -279.5 t-385.5 -103t-385.5 103t-279.5 279.5t-103 385.5t103 385.5t279.5 279.5t385.5 103t385.5 -103t279.5 -279.5t103 -385.5z" /> +<glyph unicode="" horiz-adv-x="1664" d="M1023 349l102 -204q-58 -179 -210 -290t-339 -111q-156 0 -288.5 77.5t-210 210t-77.5 288.5q0 181 104.5 330t274.5 211l17 -131q-122 -54 -195 -165.5t-73 -244.5q0 -185 131.5 -316.5t316.5 -131.5q126 0 232.5 65t165 175.5t49.5 236.5zM1571 249l58 -114l-256 -128 q-13 -7 -29 -7q-40 0 -57 35l-239 477h-472q-24 0 -42.5 16.5t-21.5 40.5l-96 779q-2 16 6 42q14 51 57 82.5t97 31.5q66 0 113 -47t47 -113q0 -69 -52 -117.5t-120 -41.5l37 -289h423v-128h-407l16 -128h455q40 0 57 -35l228 -455z" /> +<glyph unicode="" d="M1292 898q10 216 -161 222q-231 8 -312 -261q44 19 82 19q85 0 74 -96q-4 -57 -74 -167t-105 -110q-43 0 -82 169q-13 54 -45 255q-30 189 -160 177q-59 -7 -164 -100l-81 -72l-81 -72l52 -67q76 52 87 52q57 0 107 -179q15 -55 45 -164.5t45 -164.5q68 -179 164 -179 q157 0 383 294q220 283 226 444zM1536 1120v-960q0 -119 -84.5 -203.5t-203.5 -84.5h-960q-119 0 -203.5 84.5t-84.5 203.5v960q0 119 84.5 203.5t203.5 84.5h960q119 0 203.5 -84.5t84.5 -203.5z" /> +<glyph unicode="" horiz-adv-x="1152" d="M1152 704q0 -191 -94.5 -353t-256.5 -256.5t-353 -94.5h-160q-14 0 -23 9t-9 23v611l-215 -66q-3 -1 -9 -1q-10 0 -19 6q-13 10 -13 26v128q0 23 23 31l233 71v93l-215 -66q-3 -1 -9 -1q-10 0 -19 6q-13 10 -13 26v128q0 23 23 31l233 71v250q0 14 9 23t23 9h160 q14 0 23 -9t9 -23v-181l375 116q15 5 28 -5t13 -26v-128q0 -23 -23 -31l-393 -121v-93l375 116q15 5 28 -5t13 -26v-128q0 -23 -23 -31l-393 -121v-487q188 13 318 151t130 328q0 14 9 23t23 9h160q14 0 23 -9t9 -23z" /> +<glyph unicode="" horiz-adv-x="1408" d="M1152 736v-64q0 -14 -9 -23t-23 -9h-352v-352q0 -14 -9 -23t-23 -9h-64q-14 0 -23 9t-9 23v352h-352q-14 0 -23 9t-9 23v64q0 14 9 23t23 9h352v352q0 14 9 23t23 9h64q14 0 23 -9t9 -23v-352h352q14 0 23 -9t9 -23zM1280 288v832q0 66 -47 113t-113 47h-832 q-66 0 -113 -47t-47 -113v-832q0 -66 47 -113t113 -47h832q66 0 113 47t47 113zM1408 1120v-832q0 -119 -84.5 -203.5t-203.5 -84.5h-832q-119 0 -203.5 84.5t-84.5 203.5v832q0 119 84.5 203.5t203.5 84.5h832q119 0 203.5 -84.5t84.5 -203.5z" /> +<glyph unicode="" horiz-adv-x="2176" d="M620 416q-110 -64 -268 -64h-128v64h-64q-13 0 -22.5 23.5t-9.5 56.5q0 24 7 49q-58 2 -96.5 10.5t-38.5 20.5t38.5 20.5t96.5 10.5q-7 25 -7 49q0 33 9.5 56.5t22.5 23.5h64v64h128q158 0 268 -64h1113q42 -7 106.5 -18t80.5 -14q89 -15 150 -40.5t83.5 -47.5t22.5 -40 t-22.5 -40t-83.5 -47.5t-150 -40.5q-16 -3 -80.5 -14t-106.5 -18h-1113zM1739 668q53 -36 53 -92t-53 -92l81 -30q68 48 68 122t-68 122zM625 400h1015q-217 -38 -456 -80q-57 0 -113 -24t-83 -48l-28 -24l-288 -288q-26 -26 -70.5 -45t-89.5 -19h-96l-93 464h29 q157 0 273 64zM352 816h-29l93 464h96q46 0 90 -19t70 -45l288 -288q4 -4 11 -10.5t30.5 -23t48.5 -29t61.5 -23t72.5 -10.5l456 -80h-1015q-116 64 -273 64z" /> +<glyph unicode="" horiz-adv-x="1664" d="M1519 760q62 0 103.5 -40.5t41.5 -101.5q0 -97 -93 -130l-172 -59l56 -167q7 -21 7 -47q0 -59 -42 -102t-101 -43q-47 0 -85.5 27t-53.5 72l-55 165l-310 -106l55 -164q8 -24 8 -47q0 -59 -42 -102t-102 -43q-47 0 -85 27t-53 72l-55 163l-153 -53q-29 -9 -50 -9 q-61 0 -101.5 40t-40.5 101q0 47 27.5 85t71.5 53l156 53l-105 313l-156 -54q-26 -8 -48 -8q-60 0 -101 40.5t-41 100.5q0 47 27.5 85t71.5 53l157 53l-53 159q-8 24 -8 47q0 60 42 102.5t102 42.5q47 0 85 -27t53 -72l54 -160l310 105l-54 160q-8 24 -8 47q0 59 42.5 102 t101.5 43q47 0 85.5 -27.5t53.5 -71.5l53 -161l162 55q21 6 43 6q60 0 102.5 -39.5t42.5 -98.5q0 -45 -30 -81.5t-74 -51.5l-157 -54l105 -316l164 56q24 8 46 8zM725 498l310 105l-105 315l-310 -107z" /> +<glyph unicode="" d="M1248 1408q119 0 203.5 -84.5t84.5 -203.5v-960q0 -119 -84.5 -203.5t-203.5 -84.5h-960q-119 0 -203.5 84.5t-84.5 203.5v960q0 119 84.5 203.5t203.5 84.5h960zM1280 352v436q-31 -35 -64 -55q-34 -22 -132.5 -85t-151.5 -99q-98 -69 -164 -69v0v0q-66 0 -164 69 q-46 32 -141.5 92.5t-142.5 92.5q-12 8 -33 27t-31 27v-436q0 -40 28 -68t68 -28h832q40 0 68 28t28 68zM1280 925q0 41 -27.5 70t-68.5 29h-832q-40 0 -68 -28t-28 -68q0 -37 30.5 -76.5t67.5 -64.5q47 -32 137.5 -89t129.5 -83q3 -2 17 -11.5t21 -14t21 -13t23.5 -13 t21.5 -9.5t22.5 -7.5t20.5 -2.5t20.5 2.5t22.5 7.5t21.5 9.5t23.5 13t21 13t21 14t17 11.5l267 174q35 23 66.5 62.5t31.5 73.5z" /> +<glyph unicode="" horiz-adv-x="1792" d="M127 640q0 163 67 313l367 -1005q-196 95 -315 281t-119 411zM1415 679q0 -19 -2.5 -38.5t-10 -49.5t-11.5 -44t-17.5 -59t-17.5 -58l-76 -256l-278 826q46 3 88 8q19 2 26 18.5t-2.5 31t-28.5 13.5l-205 -10q-75 1 -202 10q-12 1 -20.5 -5t-11.5 -15t-1.5 -18.5t9 -16.5 t19.5 -8l80 -8l120 -328l-168 -504l-280 832q46 3 88 8q19 2 26 18.5t-2.5 31t-28.5 13.5l-205 -10q-7 0 -23 0.5t-26 0.5q105 160 274.5 253.5t367.5 93.5q147 0 280.5 -53t238.5 -149h-10q-55 0 -92 -40.5t-37 -95.5q0 -12 2 -24t4 -21.5t8 -23t9 -21t12 -22.5t12.5 -21 t14.5 -24t14 -23q63 -107 63 -212zM909 573l237 -647q1 -6 5 -11q-126 -44 -255 -44q-112 0 -217 32zM1570 1009q95 -174 95 -369q0 -209 -104 -385.5t-279 -278.5l235 678q59 169 59 276q0 42 -6 79zM896 1536q182 0 348 -71t286 -191t191 -286t71 -348t-71 -348t-191 -286 t-286 -191t-348 -71t-348 71t-286 191t-191 286t-71 348t71 348t191 286t286 191t348 71zM896 -215q173 0 331.5 68t273 182.5t182.5 273t68 331.5t-68 331.5t-182.5 273t-273 182.5t-331.5 68t-331.5 -68t-273 -182.5t-182.5 -273t-68 -331.5t68 -331.5t182.5 -273 t273 -182.5t331.5 -68z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1086 1536v-1536l-272 -128q-228 20 -414 102t-293 208.5t-107 272.5q0 140 100.5 263.5t275 205.5t391.5 108v-172q-217 -38 -356.5 -150t-139.5 -255q0 -152 154.5 -267t388.5 -145v1360zM1755 954l37 -390l-525 114l147 83q-119 70 -280 99v172q277 -33 481 -157z" /> +<glyph unicode="" horiz-adv-x="2048" d="M960 1536l960 -384v-128h-128q0 -26 -20.5 -45t-48.5 -19h-1526q-28 0 -48.5 19t-20.5 45h-128v128zM256 896h256v-768h128v768h256v-768h128v768h256v-768h128v768h256v-768h59q28 0 48.5 -19t20.5 -45v-64h-1664v64q0 26 20.5 45t48.5 19h59v768zM1851 -64 q28 0 48.5 -19t20.5 -45v-128h-1920v128q0 26 20.5 45t48.5 19h1782z" /> +<glyph unicode="" horiz-adv-x="2304" d="M1774 700l18 -316q4 -69 -82 -128t-235 -93.5t-323 -34.5t-323 34.5t-235 93.5t-82 128l18 316l574 -181q22 -7 48 -7t48 7zM2304 1024q0 -23 -22 -31l-1120 -352q-4 -1 -10 -1t-10 1l-652 206q-43 -34 -71 -111.5t-34 -178.5q63 -36 63 -109q0 -69 -58 -107l58 -433 q2 -14 -8 -25q-9 -11 -24 -11h-192q-15 0 -24 11q-10 11 -8 25l58 433q-58 38 -58 107q0 73 65 111q11 207 98 330l-333 104q-22 8 -22 31t22 31l1120 352q4 1 10 1t10 -1l1120 -352q22 -8 22 -31z" /> +<glyph unicode="" d="M859 579l13 -707q-62 11 -105 11q-41 0 -105 -11l13 707q-40 69 -168.5 295.5t-216.5 374.5t-181 287q58 -15 108 -15q43 0 111 15q63 -111 133.5 -229.5t167 -276.5t138.5 -227q37 61 109.5 177.5t117.5 190t105 176t107 189.5q54 -14 107 -14q56 0 114 14v0 q-28 -39 -60 -88.5t-49.5 -78.5t-56.5 -96t-49 -84q-146 -248 -353 -610z" /> +<glyph unicode="" d="M768 750h725q12 -67 12 -128q0 -217 -91 -387.5t-259.5 -266.5t-386.5 -96q-157 0 -299 60.5t-245 163.5t-163.5 245t-60.5 299t60.5 299t163.5 245t245 163.5t299 60.5q300 0 515 -201l-209 -201q-123 119 -306 119q-129 0 -238.5 -65t-173.5 -176.5t-64 -243.5 t64 -243.5t173.5 -176.5t238.5 -65q87 0 160 24t120 60t82 82t51.5 87t22.5 78h-436v264z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1095 369q16 -16 0 -31q-62 -62 -199 -62t-199 62q-16 15 0 31q6 6 15 6t15 -6q48 -49 169 -49q120 0 169 49q6 6 15 6t15 -6zM788 550q0 -37 -26 -63t-63 -26t-63.5 26t-26.5 63q0 38 26.5 64t63.5 26t63 -26.5t26 -63.5zM1183 550q0 -37 -26.5 -63t-63.5 -26t-63 26 t-26 63t26 63.5t63 26.5t63.5 -26t26.5 -64zM1434 670q0 49 -35 84t-85 35t-86 -36q-130 90 -311 96l63 283l200 -45q0 -37 26 -63t63 -26t63.5 26.5t26.5 63.5t-26.5 63.5t-63.5 26.5q-54 0 -80 -50l-221 49q-19 5 -25 -16l-69 -312q-180 -7 -309 -97q-35 37 -87 37 q-50 0 -85 -35t-35 -84q0 -35 18.5 -64t49.5 -44q-6 -27 -6 -56q0 -142 140 -243t337 -101q198 0 338 101t140 243q0 32 -7 57q30 15 48 43.5t18 63.5zM1792 640q0 -182 -71 -348t-191 -286t-286 -191t-348 -71t-348 71t-286 191t-191 286t-71 348t71 348t191 286t286 191 t348 71t348 -71t286 -191t191 -286t71 -348z" /> +<glyph unicode="" d="M939 407q13 -13 0 -26q-53 -53 -171 -53t-171 53q-13 13 0 26q5 6 13 6t13 -6q42 -42 145 -42t145 42q5 6 13 6t13 -6zM676 563q0 -31 -23 -54t-54 -23t-54 23t-23 54q0 32 22.5 54.5t54.5 22.5t54.5 -22.5t22.5 -54.5zM1014 563q0 -31 -23 -54t-54 -23t-54 23t-23 54 q0 32 22.5 54.5t54.5 22.5t54.5 -22.5t22.5 -54.5zM1229 666q0 42 -30 72t-73 30q-42 0 -73 -31q-113 78 -267 82l54 243l171 -39q1 -32 23.5 -54t53.5 -22q32 0 54.5 22.5t22.5 54.5t-22.5 54.5t-54.5 22.5q-48 0 -69 -43l-189 42q-17 5 -21 -13l-60 -268q-154 -6 -265 -83 q-30 32 -74 32q-43 0 -73 -30t-30 -72q0 -30 16 -55t42 -38q-5 -25 -5 -48q0 -122 120 -208.5t289 -86.5q170 0 290 86.5t120 208.5q0 25 -6 49q25 13 40.5 37.5t15.5 54.5zM1536 1120v-960q0 -119 -84.5 -203.5t-203.5 -84.5h-960q-119 0 -203.5 84.5t-84.5 203.5v960 q0 119 84.5 203.5t203.5 84.5h960q119 0 203.5 -84.5t84.5 -203.5z" /> +<glyph unicode="" d="M866 697l90 27v62q0 79 -58 135t-138 56t-138 -55.5t-58 -134.5v-283q0 -20 -14 -33.5t-33 -13.5t-32.5 13.5t-13.5 33.5v120h-151v-122q0 -82 57.5 -139t139.5 -57q81 0 138.5 56.5t57.5 136.5v280q0 19 13.5 33t33.5 14q19 0 32.5 -14t13.5 -33v-54zM1199 502v122h-150 v-126q0 -20 -13.5 -33.5t-33.5 -13.5q-19 0 -32.5 14t-13.5 33v123l-90 -26l-60 28v-123q0 -80 58 -137t139 -57t138.5 57t57.5 139zM1536 640q0 -209 -103 -385.5t-279.5 -279.5t-385.5 -103t-385.5 103t-279.5 279.5t-103 385.5t103 385.5t279.5 279.5t385.5 103 t385.5 -103t279.5 -279.5t103 -385.5z" /> +<glyph unicode="" horiz-adv-x="1920" d="M1062 824v118q0 42 -30 72t-72 30t-72 -30t-30 -72v-612q0 -175 -126 -299t-303 -124q-178 0 -303.5 125.5t-125.5 303.5v266h328v-262q0 -43 30 -72.5t72 -29.5t72 29.5t30 72.5v620q0 171 126.5 292t301.5 121q176 0 302 -122t126 -294v-136l-195 -58zM1592 602h328 v-266q0 -178 -125.5 -303.5t-303.5 -125.5q-177 0 -303 124.5t-126 300.5v268l131 -61l195 58v-270q0 -42 30 -71.5t72 -29.5t72 29.5t30 71.5v275z" /> +<glyph unicode="" d="M1472 160v480h-704v704h-480q-93 0 -158.5 -65.5t-65.5 -158.5v-480h704v-704h480q93 0 158.5 65.5t65.5 158.5zM1536 1120v-960q0 -119 -84.5 -203.5t-203.5 -84.5h-960q-119 0 -203.5 84.5t-84.5 203.5v960q0 119 84.5 203.5t203.5 84.5h960q119 0 203.5 -84.5 t84.5 -203.5z" /> +<glyph unicode="" horiz-adv-x="2048" d="M328 1254h204v-983h-532v697h328v286zM328 435v369h-123v-369h123zM614 968v-697h205v697h-205zM614 1254v-204h205v204h-205zM901 968h533v-942h-533v163h328v82h-328v697zM1229 435v369h-123v-369h123zM1516 968h532v-942h-532v163h327v82h-327v697zM1843 435v369h-123 v-369h123z" /> +<glyph unicode="" d="M1046 516q0 -64 -38 -109t-91 -45q-43 0 -70 15v277q28 17 70 17q53 0 91 -45.5t38 -109.5zM703 944q0 -64 -38 -109.5t-91 -45.5q-43 0 -70 15v277q28 17 70 17q53 0 91 -45t38 -109zM1265 513q0 134 -88 229t-213 95q-20 0 -39 -3q-23 -78 -78 -136q-87 -95 -211 -101 v-636l211 41v206q51 -19 117 -19q125 0 213 95t88 229zM922 940q0 134 -88.5 229t-213.5 95q-74 0 -141 -36h-186v-840l211 41v206q55 -19 116 -19q125 0 213.5 95t88.5 229zM1536 1120v-960q0 -119 -84.5 -203.5t-203.5 -84.5h-960q-119 0 -203.5 84.5t-84.5 203.5v960 q0 119 84.5 203.5t203.5 84.5h960q119 0 203.5 -84.5t84.5 -203.5z" /> +<glyph unicode="" horiz-adv-x="2038" d="M1222 607q75 3 143.5 -20.5t118 -58.5t101 -94.5t84 -108t75.5 -120.5q33 -56 78.5 -109t75.5 -80.5t99 -88.5q-48 -30 -108.5 -57.5t-138.5 -59t-114 -47.5q-44 37 -74 115t-43.5 164.5t-33 180.5t-42.5 168.5t-72.5 123t-122.5 48.5l-10 -2l-6 -4q4 -5 13 -14 q6 -5 28 -23.5t25.5 -22t19 -18t18 -20.5t11.5 -21t10.5 -27.5t4.5 -31t4 -40.5l1 -33q1 -26 -2.5 -57.5t-7.5 -52t-12.5 -58.5t-11.5 -53q-35 1 -101 -9.5t-98 -10.5q-39 0 -72 10q-2 16 -2 47q0 74 3 96q2 13 31.5 41.5t57 59t26.5 51.5q-24 2 -43 -24 q-36 -53 -111.5 -99.5t-136.5 -46.5q-25 0 -75.5 63t-106.5 139.5t-84 96.5q-6 4 -27 30q-482 -112 -513 -112q-16 0 -28 11t-12 27q0 15 8.5 26.5t22.5 14.5l486 106q-8 14 -8 25t5.5 17.5t16 11.5t20 7t23 4.5t18.5 4.5q4 1 15.5 7.5t17.5 6.5q15 0 28 -16t20 -33 q163 37 172 37q17 0 29.5 -11t12.5 -28q0 -15 -8.5 -26t-23.5 -14l-182 -40l-1 -16q-1 -26 81.5 -117.5t104.5 -91.5q47 0 119 80t72 129q0 36 -23.5 53t-51 18.5t-51 11.5t-23.5 34q0 16 10 34l-68 19q43 44 43 117q0 26 -5 58q82 16 144 16q44 0 71.5 -1.5t48.5 -8.5 t31 -13.5t20.5 -24.5t15.5 -33.5t17 -47.5t24 -60l50 25q-3 -40 -23 -60t-42.5 -21t-40 -6.5t-16.5 -20.5zM1282 842q-5 5 -13.5 15.5t-12 14.5t-10.5 11.5t-10 10.5l-8 8t-8.5 7.5t-8 5t-8.5 4.5q-7 3 -14.5 5t-20.5 2.5t-22 0.5h-32.5h-37.5q-126 0 -217 -43 q16 30 36 46.5t54 29.5t65.5 36t46 36.5t50 55t43.5 50.5q12 -9 28 -31.5t32 -36.5t38 -13l12 1v-76l22 -1q247 95 371 190q28 21 50 39t42.5 37.5t33 31t29.5 34t24 31t24.5 37t23 38t27 47.5t29.5 53l7 9q-2 -53 -43 -139q-79 -165 -205 -264t-306 -142q-14 -3 -42 -7.5 t-50 -9.5t-39 -14q3 -19 24.5 -46t21.5 -34q0 -11 -26 -30zM1061 -79q39 26 131.5 47.5t146.5 21.5q9 0 22.5 -15.5t28 -42.5t26 -50t24 -51t14.5 -33q-121 -45 -244 -45q-61 0 -125 11zM822 568l48 12l109 -177l-73 -48zM1323 51q3 -15 3 -16q0 -7 -17.5 -14.5t-46 -13 t-54 -9.5t-53.5 -7.5t-32 -4.5l-7 43q21 2 60.5 8.5t72 10t60.5 3.5h14zM866 679l-96 -20l-6 17q10 1 32.5 7t34.5 6q19 0 35 -10zM1061 45h31l10 -83l-41 -12v95zM1950 1535v1v-1zM1950 1535l-1 -5l-2 -2l1 3zM1950 1535l1 1z" /> +<glyph unicode="" d="M1167 -50q-5 19 -24 5q-30 -22 -87 -39t-131 -17q-129 0 -193 49q-5 4 -13 4q-11 0 -26 -12q-7 -6 -7.5 -16t7.5 -20q34 -32 87.5 -46t102.5 -12.5t99 4.5q41 4 84.5 20.5t65 30t28.5 20.5q12 12 7 29zM1128 65q-19 47 -39 61q-23 15 -76 15q-47 0 -71 -10 q-29 -12 -78 -56q-26 -24 -12 -44q9 -8 17.5 -4.5t31.5 23.5q3 2 10.5 8.5t10.5 8.5t10 7t11.5 7t12.5 5t15 4.5t16.5 2.5t20.5 1q27 0 44.5 -7.5t23 -14.5t13.5 -22q10 -17 12.5 -20t12.5 1q23 12 14 34zM1483 346q0 22 -5 44.5t-16.5 45t-34 36.5t-52.5 14 q-33 0 -97 -41.5t-129 -83.5t-101 -42q-27 -1 -63.5 19t-76 49t-83.5 58t-100 49t-111 19q-115 -1 -197 -78.5t-84 -178.5q-2 -112 74 -164q29 -20 62.5 -28.5t103.5 -8.5q57 0 132 32.5t134 71t120 70.5t93 31q26 -1 65 -31.5t71.5 -67t68 -67.5t55.5 -32q35 -3 58.5 14 t55.5 63q28 41 42.5 101t14.5 106zM1536 506q0 -164 -62 -304.5t-166 -236t-242.5 -149.5t-290.5 -54t-293 57.5t-247.5 157t-170.5 241.5t-64 302q0 89 19.5 172.5t49 145.5t70.5 118.5t78.5 94t78.5 69.5t64.5 46.5t42.5 24.5q14 8 51 26.5t54.5 28.5t48 30t60.5 44 q36 28 58 72.5t30 125.5q129 -155 186 -193q44 -29 130 -68t129 -66q21 -13 39 -25t60.5 -46.5t76 -70.5t75 -95t69 -122t47 -148.5t19.5 -177.5z" /> +<glyph unicode="" d="M1070 463l-160 -160l-151 -152l-30 -30q-65 -64 -151.5 -87t-171.5 -2q-16 -70 -72 -115t-129 -45q-85 0 -145 60.5t-60 145.5q0 72 44.5 128t113.5 72q-22 86 1 173t88 152l12 12l151 -152l-11 -11q-37 -37 -37 -89t37 -90q37 -37 89 -37t89 37l30 30l151 152l161 160z M729 1145l12 -12l-152 -152l-12 12q-37 37 -89 37t-89 -37t-37 -89.5t37 -89.5l29 -29l152 -152l160 -160l-151 -152l-161 160l-151 152l-30 30q-68 67 -90 159.5t5 179.5q-70 15 -115 71t-45 129q0 85 60 145.5t145 60.5q76 0 133.5 -49t69.5 -123q84 20 169.5 -3.5 t149.5 -87.5zM1536 78q0 -85 -60 -145.5t-145 -60.5q-74 0 -131 47t-71 118q-86 -28 -179.5 -6t-161.5 90l-11 12l151 152l12 -12q37 -37 89 -37t89 37t37 89t-37 89l-30 30l-152 152l-160 160l152 152l160 -160l152 -152l29 -30q64 -64 87.5 -150.5t2.5 -171.5 q76 -11 126.5 -68.5t50.5 -134.5zM1534 1202q0 -77 -51 -135t-127 -69q26 -85 3 -176.5t-90 -158.5l-12 -12l-151 152l12 12q37 37 37 89t-37 89t-89 37t-89 -37l-30 -30l-152 -152l-160 -160l-152 152l161 160l152 152l29 30q67 67 159 89.5t178 -3.5q11 75 68.5 126 t135.5 51q85 0 145 -60.5t60 -145.5z" /> +<glyph unicode="" d="M654 458q-1 -3 -12.5 0.5t-31.5 11.5l-20 9q-44 20 -87 49q-7 5 -41 31.5t-38 28.5q-67 -103 -134 -181q-81 -95 -105 -110q-4 -2 -19.5 -4t-18.5 0q6 4 82 92q21 24 85.5 115t78.5 118q17 30 51 98.5t36 77.5q-8 1 -110 -33q-8 -2 -27.5 -7.5t-34.5 -9.5t-17 -5 q-2 -2 -2 -10.5t-1 -9.5q-5 -10 -31 -15q-23 -7 -47 0q-18 4 -28 21q-4 6 -5 23q6 2 24.5 5t29.5 6q58 16 105 32q100 35 102 35q10 2 43 19.5t44 21.5q9 3 21.5 8t14.5 5.5t6 -0.5q2 -12 -1 -33q0 -2 -12.5 -27t-26.5 -53.5t-17 -33.5q-25 -50 -77 -131l64 -28 q12 -6 74.5 -32t67.5 -28q4 -1 10.5 -25.5t4.5 -30.5zM449 944q3 -15 -4 -28q-12 -23 -50 -38q-30 -12 -60 -12q-26 3 -49 26q-14 15 -18 41l1 3q3 -3 19.5 -5t26.5 0t58 16q36 12 55 14q17 0 21 -17zM1147 815l63 -227l-139 42zM39 15l694 232v1032l-694 -233v-1031z M1280 332l102 -31l-181 657l-100 31l-216 -536l102 -31l45 110l211 -65zM777 1294l573 -184v380zM1088 -29l158 -13l-54 -160l-40 66q-130 -83 -276 -108q-58 -12 -91 -12h-84q-79 0 -199.5 39t-183.5 85q-8 7 -8 16q0 8 5 13.5t13 5.5q4 0 18 -7.5t30.5 -16.5t20.5 -11 q73 -37 159.5 -61.5t157.5 -24.5q95 0 167 14.5t157 50.5q15 7 30.5 15.5t34 19t28.5 16.5zM1536 1050v-1079l-774 246q-14 -6 -375 -127.5t-368 -121.5q-13 0 -18 13q0 1 -1 3v1078q3 9 4 10q5 6 20 11q106 35 149 50v384l558 -198q2 0 160.5 55t316 108.5t161.5 53.5 q20 0 20 -21v-418z" /> +<glyph unicode="" horiz-adv-x="1792" d="M288 1152q66 0 113 -47t47 -113v-1088q0 -66 -47 -113t-113 -47h-128q-66 0 -113 47t-47 113v1088q0 66 47 113t113 47h128zM1664 989q58 -34 93 -93t35 -128v-768q0 -106 -75 -181t-181 -75h-864q-66 0 -113 47t-47 113v1536q0 40 28 68t68 28h672q40 0 88 -20t76 -48 l152 -152q28 -28 48 -76t20 -88v-163zM928 0v128q0 14 -9 23t-23 9h-128q-14 0 -23 -9t-9 -23v-128q0 -14 9 -23t23 -9h128q14 0 23 9t9 23zM928 256v128q0 14 -9 23t-23 9h-128q-14 0 -23 -9t-9 -23v-128q0 -14 9 -23t23 -9h128q14 0 23 9t9 23zM928 512v128q0 14 -9 23 t-23 9h-128q-14 0 -23 -9t-9 -23v-128q0 -14 9 -23t23 -9h128q14 0 23 9t9 23zM1184 0v128q0 14 -9 23t-23 9h-128q-14 0 -23 -9t-9 -23v-128q0 -14 9 -23t23 -9h128q14 0 23 9t9 23zM1184 256v128q0 14 -9 23t-23 9h-128q-14 0 -23 -9t-9 -23v-128q0 -14 9 -23t23 -9h128 q14 0 23 9t9 23zM1184 512v128q0 14 -9 23t-23 9h-128q-14 0 -23 -9t-9 -23v-128q0 -14 9 -23t23 -9h128q14 0 23 9t9 23zM1440 0v128q0 14 -9 23t-23 9h-128q-14 0 -23 -9t-9 -23v-128q0 -14 9 -23t23 -9h128q14 0 23 9t9 23zM1440 256v128q0 14 -9 23t-23 9h-128 q-14 0 -23 -9t-9 -23v-128q0 -14 9 -23t23 -9h128q14 0 23 9t9 23zM1440 512v128q0 14 -9 23t-23 9h-128q-14 0 -23 -9t-9 -23v-128q0 -14 9 -23t23 -9h128q14 0 23 9t9 23zM1536 896v256h-160q-40 0 -68 28t-28 68v160h-640v-512h896z" /> +<glyph unicode="" d="M1344 1536q26 0 45 -19t19 -45v-1664q0 -26 -19 -45t-45 -19h-1280q-26 0 -45 19t-19 45v1664q0 26 19 45t45 19h1280zM512 1248v-64q0 -14 9 -23t23 -9h64q14 0 23 9t9 23v64q0 14 -9 23t-23 9h-64q-14 0 -23 -9t-9 -23zM512 992v-64q0 -14 9 -23t23 -9h64q14 0 23 9 t9 23v64q0 14 -9 23t-23 9h-64q-14 0 -23 -9t-9 -23zM512 736v-64q0 -14 9 -23t23 -9h64q14 0 23 9t9 23v64q0 14 -9 23t-23 9h-64q-14 0 -23 -9t-9 -23zM512 480v-64q0 -14 9 -23t23 -9h64q14 0 23 9t9 23v64q0 14 -9 23t-23 9h-64q-14 0 -23 -9t-9 -23zM384 160v64 q0 14 -9 23t-23 9h-64q-14 0 -23 -9t-9 -23v-64q0 -14 9 -23t23 -9h64q14 0 23 9t9 23zM384 416v64q0 14 -9 23t-23 9h-64q-14 0 -23 -9t-9 -23v-64q0 -14 9 -23t23 -9h64q14 0 23 9t9 23zM384 672v64q0 14 -9 23t-23 9h-64q-14 0 -23 -9t-9 -23v-64q0 -14 9 -23t23 -9h64 q14 0 23 9t9 23zM384 928v64q0 14 -9 23t-23 9h-64q-14 0 -23 -9t-9 -23v-64q0 -14 9 -23t23 -9h64q14 0 23 9t9 23zM384 1184v64q0 14 -9 23t-23 9h-64q-14 0 -23 -9t-9 -23v-64q0 -14 9 -23t23 -9h64q14 0 23 9t9 23zM896 -96v192q0 14 -9 23t-23 9h-320q-14 0 -23 -9 t-9 -23v-192q0 -14 9 -23t23 -9h320q14 0 23 9t9 23zM896 416v64q0 14 -9 23t-23 9h-64q-14 0 -23 -9t-9 -23v-64q0 -14 9 -23t23 -9h64q14 0 23 9t9 23zM896 672v64q0 14 -9 23t-23 9h-64q-14 0 -23 -9t-9 -23v-64q0 -14 9 -23t23 -9h64q14 0 23 9t9 23zM896 928v64 q0 14 -9 23t-23 9h-64q-14 0 -23 -9t-9 -23v-64q0 -14 9 -23t23 -9h64q14 0 23 9t9 23zM896 1184v64q0 14 -9 23t-23 9h-64q-14 0 -23 -9t-9 -23v-64q0 -14 9 -23t23 -9h64q14 0 23 9t9 23zM1152 160v64q0 14 -9 23t-23 9h-64q-14 0 -23 -9t-9 -23v-64q0 -14 9 -23t23 -9h64 q14 0 23 9t9 23zM1152 416v64q0 14 -9 23t-23 9h-64q-14 0 -23 -9t-9 -23v-64q0 -14 9 -23t23 -9h64q14 0 23 9t9 23zM1152 672v64q0 14 -9 23t-23 9h-64q-14 0 -23 -9t-9 -23v-64q0 -14 9 -23t23 -9h64q14 0 23 9t9 23zM1152 928v64q0 14 -9 23t-23 9h-64q-14 0 -23 -9 t-9 -23v-64q0 -14 9 -23t23 -9h64q14 0 23 9t9 23zM1152 1184v64q0 14 -9 23t-23 9h-64q-14 0 -23 -9t-9 -23v-64q0 -14 9 -23t23 -9h64q14 0 23 9t9 23z" /> +<glyph unicode="" horiz-adv-x="1280" d="M1188 988l-292 -292v-824q0 -46 -33 -79t-79 -33t-79 33t-33 79v384h-64v-384q0 -46 -33 -79t-79 -33t-79 33t-33 79v824l-292 292q-28 28 -28 68t28 68t68 28t68 -28l228 -228h368l228 228q28 28 68 28t68 -28t28 -68t-28 -68zM864 1152q0 -93 -65.5 -158.5 t-158.5 -65.5t-158.5 65.5t-65.5 158.5t65.5 158.5t158.5 65.5t158.5 -65.5t65.5 -158.5z" /> +<glyph unicode="" horiz-adv-x="1664" d="M780 1064q0 -60 -19 -113.5t-63 -92.5t-105 -39q-76 0 -138 57.5t-92 135.5t-30 151q0 60 19 113.5t63 92.5t105 39q77 0 138.5 -57.5t91.5 -135t30 -151.5zM438 581q0 -80 -42 -139t-119 -59q-76 0 -141.5 55.5t-100.5 133.5t-35 152q0 80 42 139.5t119 59.5 q76 0 141.5 -55.5t100.5 -134t35 -152.5zM832 608q118 0 255 -97.5t229 -237t92 -254.5q0 -46 -17 -76.5t-48.5 -45t-64.5 -20t-76 -5.5q-68 0 -187.5 45t-182.5 45q-66 0 -192.5 -44.5t-200.5 -44.5q-183 0 -183 146q0 86 56 191.5t139.5 192.5t187.5 146t193 59zM1071 819 q-61 0 -105 39t-63 92.5t-19 113.5q0 74 30 151.5t91.5 135t138.5 57.5q61 0 105 -39t63 -92.5t19 -113.5q0 -73 -30 -151t-92 -135.5t-138 -57.5zM1503 923q77 0 119 -59.5t42 -139.5q0 -74 -35 -152t-100.5 -133.5t-141.5 -55.5q-77 0 -119 59t-42 139q0 74 35 152.5 t100.5 134t141.5 55.5z" /> +<glyph unicode="" horiz-adv-x="768" d="M704 1008q0 -145 -57 -243.5t-152 -135.5l45 -821q2 -26 -16 -45t-44 -19h-192q-26 0 -44 19t-16 45l45 821q-95 37 -152 135.5t-57 243.5q0 128 42.5 249.5t117.5 200t160 78.5t160 -78.5t117.5 -200t42.5 -249.5z" /> +<glyph unicode="" horiz-adv-x="1792" d="M896 -93l640 349v636l-640 -233v-752zM832 772l698 254l-698 254l-698 -254zM1664 1024v-768q0 -35 -18 -65t-49 -47l-704 -384q-28 -16 -61 -16t-61 16l-704 384q-31 17 -49 47t-18 65v768q0 40 23 73t61 47l704 256q22 8 44 8t44 -8l704 -256q38 -14 61 -47t23 -73z " /> +<glyph unicode="" horiz-adv-x="2304" d="M640 -96l384 192v314l-384 -164v-342zM576 358l404 173l-404 173l-404 -173zM1664 -96l384 192v314l-384 -164v-342zM1600 358l404 173l-404 173l-404 -173zM1152 651l384 165v266l-384 -164v-267zM1088 1030l441 189l-441 189l-441 -189zM2176 512v-416q0 -36 -19 -67 t-52 -47l-448 -224q-25 -14 -57 -14t-57 14l-448 224q-5 2 -7 4q-2 -2 -7 -4l-448 -224q-25 -14 -57 -14t-57 14l-448 224q-33 16 -52 47t-19 67v416q0 38 21.5 70t56.5 48l434 186v400q0 38 21.5 70t56.5 48l448 192q23 10 50 10t50 -10l448 -192q35 -16 56.5 -48t21.5 -70 v-400l434 -186q36 -16 57 -48t21 -70z" /> +<glyph unicode="" horiz-adv-x="2048" d="M1848 1197h-511v-124h511v124zM1596 771q-90 0 -146 -52.5t-62 -142.5h408q-18 195 -200 195zM1612 186q63 0 122 32t76 87h221q-100 -307 -427 -307q-214 0 -340.5 132t-126.5 347q0 208 130.5 345.5t336.5 137.5q138 0 240.5 -68t153 -179t50.5 -248q0 -17 -2 -47h-658 q0 -111 57.5 -171.5t166.5 -60.5zM277 236h296q205 0 205 167q0 180 -199 180h-302v-347zM277 773h281q78 0 123.5 36.5t45.5 113.5q0 144 -190 144h-260v-294zM0 1282h594q87 0 155 -14t126.5 -47.5t90 -96.5t31.5 -154q0 -181 -172 -263q114 -32 172 -115t58 -204 q0 -75 -24.5 -136.5t-66 -103.5t-98.5 -71t-121 -42t-134 -13h-611v1260z" /> +<glyph unicode="" d="M1248 1408q119 0 203.5 -84.5t84.5 -203.5v-960q0 -119 -84.5 -203.5t-203.5 -84.5h-960q-119 0 -203.5 84.5t-84.5 203.5v960q0 119 84.5 203.5t203.5 84.5h960zM499 1041h-371v-787h382q117 0 197 57.5t80 170.5q0 158 -143 200q107 52 107 164q0 57 -19.5 96.5 t-56.5 60.5t-79 29.5t-97 8.5zM477 723h-176v184h163q119 0 119 -90q0 -94 -106 -94zM486 388h-185v217h189q124 0 124 -113q0 -104 -128 -104zM1136 356q-68 0 -104 38t-36 107h411q1 10 1 30q0 132 -74.5 220.5t-203.5 88.5q-128 0 -210 -86t-82 -216q0 -135 79 -217 t213 -82q205 0 267 191h-138q-11 -34 -47.5 -54t-75.5 -20zM1126 722q113 0 124 -122h-254q4 56 39 89t91 33zM964 988h319v-77h-319v77z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1582 954q0 -101 -71.5 -172.5t-172.5 -71.5t-172.5 71.5t-71.5 172.5t71.5 172.5t172.5 71.5t172.5 -71.5t71.5 -172.5zM812 212q0 104 -73 177t-177 73q-27 0 -54 -6l104 -42q77 -31 109.5 -106.5t1.5 -151.5q-31 -77 -107 -109t-152 -1q-21 8 -62 24.5t-61 24.5 q32 -60 91 -96.5t130 -36.5q104 0 177 73t73 177zM1642 953q0 126 -89.5 215.5t-215.5 89.5q-127 0 -216.5 -89.5t-89.5 -215.5q0 -127 89.5 -216t216.5 -89q126 0 215.5 89t89.5 216zM1792 953q0 -189 -133.5 -322t-321.5 -133l-437 -319q-12 -129 -109 -218t-229 -89 q-121 0 -214 76t-118 192l-230 92v429l389 -157q79 48 173 48q13 0 35 -2l284 407q2 187 135.5 319t320.5 132q188 0 321.5 -133.5t133.5 -321.5z" /> +<glyph unicode="" d="M1242 889q0 80 -57 136.5t-137 56.5t-136.5 -57t-56.5 -136q0 -80 56.5 -136.5t136.5 -56.5t137 56.5t57 136.5zM632 301q0 -83 -58 -140.5t-140 -57.5q-56 0 -103 29t-72 77q52 -20 98 -40q60 -24 120 1.5t85 86.5q24 60 -1.5 120t-86.5 84l-82 33q22 5 42 5 q82 0 140 -57.5t58 -140.5zM1536 1120v-960q0 -119 -84.5 -203.5t-203.5 -84.5h-960q-119 0 -203.5 84.5t-84.5 203.5v153l172 -69q20 -92 93.5 -152t168.5 -60q104 0 181 70t87 173l345 252q150 0 255.5 105.5t105.5 254.5q0 150 -105.5 255.5t-255.5 105.5 q-148 0 -253 -104.5t-107 -252.5l-225 -322q-9 1 -28 1q-75 0 -137 -37l-297 119v468q0 119 84.5 203.5t203.5 84.5h960q119 0 203.5 -84.5t84.5 -203.5zM1289 887q0 -100 -71 -170.5t-171 -70.5t-170.5 70.5t-70.5 170.5t70.5 171t170.5 71q101 0 171.5 -70.5t70.5 -171.5z " /> +<glyph unicode="" horiz-adv-x="1792" d="M836 367l-15 -368l-2 -22l-420 29q-36 3 -67 31.5t-47 65.5q-11 27 -14.5 55t4 65t12 55t21.5 64t19 53q78 -12 509 -28zM449 953l180 -379l-147 92q-63 -72 -111.5 -144.5t-72.5 -125t-39.5 -94.5t-18.5 -63l-4 -21l-190 357q-17 26 -18 56t6 47l8 18q35 63 114 188 l-140 86zM1680 436l-188 -359q-12 -29 -36.5 -46.5t-43.5 -20.5l-18 -4q-71 -7 -219 -12l8 -164l-230 367l211 362l7 -173q170 -16 283 -5t170 33zM895 1360q-47 -63 -265 -435l-317 187l-19 12l225 356q20 31 60 45t80 10q24 -2 48.5 -12t42 -21t41.5 -33t36 -34.5 t36 -39.5t32 -35zM1550 1053l212 -363q18 -37 12.5 -76t-27.5 -74q-13 -20 -33 -37t-38 -28t-48.5 -22t-47 -16t-51.5 -14t-46 -12q-34 72 -265 436l313 195zM1407 1279l142 83l-220 -373l-419 20l151 86q-34 89 -75 166t-75.5 123.5t-64.5 80t-47 46.5l-17 13l405 -1 q31 3 58 -10.5t39 -28.5l11 -15q39 -61 112 -190z" /> +<glyph unicode="" horiz-adv-x="2048" d="M480 448q0 66 -47 113t-113 47t-113 -47t-47 -113t47 -113t113 -47t113 47t47 113zM516 768h1016l-89 357q-2 8 -14 17.5t-21 9.5h-768q-9 0 -21 -9.5t-14 -17.5zM1888 448q0 66 -47 113t-113 47t-113 -47t-47 -113t47 -113t113 -47t113 47t47 113zM2048 544v-384 q0 -14 -9 -23t-23 -9h-96v-128q0 -80 -56 -136t-136 -56t-136 56t-56 136v128h-1024v-128q0 -80 -56 -136t-136 -56t-136 56t-56 136v128h-96q-14 0 -23 9t-9 23v384q0 93 65.5 158.5t158.5 65.5h28l105 419q23 94 104 157.5t179 63.5h768q98 0 179 -63.5t104 -157.5 l105 -419h28q93 0 158.5 -65.5t65.5 -158.5z" /> +<glyph unicode="" horiz-adv-x="2048" d="M1824 640q93 0 158.5 -65.5t65.5 -158.5v-384q0 -14 -9 -23t-23 -9h-96v-64q0 -80 -56 -136t-136 -56t-136 56t-56 136v64h-1024v-64q0 -80 -56 -136t-136 -56t-136 56t-56 136v64h-96q-14 0 -23 9t-9 23v384q0 93 65.5 158.5t158.5 65.5h28l105 419q23 94 104 157.5 t179 63.5h128v224q0 14 9 23t23 9h448q14 0 23 -9t9 -23v-224h128q98 0 179 -63.5t104 -157.5l105 -419h28zM320 160q66 0 113 47t47 113t-47 113t-113 47t-113 -47t-47 -113t47 -113t113 -47zM516 640h1016l-89 357q-2 8 -14 17.5t-21 9.5h-768q-9 0 -21 -9.5t-14 -17.5z M1728 160q66 0 113 47t47 113t-47 113t-113 47t-113 -47t-47 -113t47 -113t113 -47z" /> +<glyph unicode="" d="M1504 64q0 -26 -19 -45t-45 -19h-462q1 -17 6 -87.5t5 -108.5q0 -25 -18 -42.5t-43 -17.5h-320q-25 0 -43 17.5t-18 42.5q0 38 5 108.5t6 87.5h-462q-26 0 -45 19t-19 45t19 45l402 403h-229q-26 0 -45 19t-19 45t19 45l402 403h-197q-26 0 -45 19t-19 45t19 45l384 384 q19 19 45 19t45 -19l384 -384q19 -19 19 -45t-19 -45t-45 -19h-197l402 -403q19 -19 19 -45t-19 -45t-45 -19h-229l402 -403q19 -19 19 -45z" /> +<glyph unicode="" d="M1127 326q0 32 -30 51q-193 115 -447 115q-133 0 -287 -34q-42 -9 -42 -52q0 -20 13.5 -34.5t35.5 -14.5q5 0 37 8q132 27 243 27q226 0 397 -103q19 -11 33 -11q19 0 33 13.5t14 34.5zM1223 541q0 40 -35 61q-237 141 -548 141q-153 0 -303 -42q-48 -13 -48 -64 q0 -25 17.5 -42.5t42.5 -17.5q7 0 37 8q122 33 251 33q279 0 488 -124q24 -13 38 -13q25 0 42.5 17.5t17.5 42.5zM1331 789q0 47 -40 70q-126 73 -293 110.5t-343 37.5q-204 0 -364 -47q-23 -7 -38.5 -25.5t-15.5 -48.5q0 -31 20.5 -52t51.5 -21q11 0 40 8q133 37 307 37 q159 0 309.5 -34t253.5 -95q21 -12 40 -12q29 0 50.5 20.5t21.5 51.5zM1536 640q0 -209 -103 -385.5t-279.5 -279.5t-385.5 -103t-385.5 103t-279.5 279.5t-103 385.5t103 385.5t279.5 279.5t385.5 103t385.5 -103t279.5 -279.5t103 -385.5z" /> +<glyph unicode="" horiz-adv-x="1024" d="M1024 1233l-303 -582l24 -31h279v-415h-507l-44 -30l-142 -273l-30 -30h-301v303l303 583l-24 30h-279v415h507l44 30l142 273l30 30h301v-303z" /> +<glyph unicode="" horiz-adv-x="2304" d="M784 164l16 241l-16 523q-1 10 -7.5 17t-16.5 7q-9 0 -16 -7t-7 -17l-14 -523l14 -241q1 -10 7.5 -16.5t15.5 -6.5q22 0 24 23zM1080 193l11 211l-12 586q0 16 -13 24q-8 5 -16 5t-16 -5q-13 -8 -13 -24l-1 -6l-10 -579q0 -1 11 -236v-1q0 -10 6 -17q9 -11 23 -11 q11 0 20 9q9 7 9 20zM35 533l20 -128l-20 -126q-2 -9 -9 -9t-9 9l-17 126l17 128q2 9 9 9t9 -9zM121 612l26 -207l-26 -203q-2 -9 -10 -9q-9 0 -9 10l-23 202l23 207q0 9 9 9q8 0 10 -9zM401 159zM213 650l25 -245l-25 -237q0 -11 -11 -11q-10 0 -12 11l-21 237l21 245 q2 12 12 12q11 0 11 -12zM307 657l23 -252l-23 -244q-2 -13 -14 -13q-13 0 -13 13l-21 244l21 252q0 13 13 13q12 0 14 -13zM401 639l21 -234l-21 -246q-2 -16 -16 -16q-6 0 -10.5 4.5t-4.5 11.5l-20 246l20 234q0 6 4.5 10.5t10.5 4.5q14 0 16 -15zM784 164zM495 785 l21 -380l-21 -246q0 -7 -5 -12.5t-12 -5.5q-16 0 -18 18l-18 246l18 380q2 18 18 18q7 0 12 -5.5t5 -12.5zM589 871l19 -468l-19 -244q0 -8 -5.5 -13.5t-13.5 -5.5q-18 0 -20 19l-16 244l16 468q2 19 20 19q8 0 13.5 -5.5t5.5 -13.5zM687 911l18 -506l-18 -242 q-2 -21 -22 -21q-19 0 -21 21l-16 242l16 506q0 9 6.5 15.5t14.5 6.5q9 0 15 -6.5t7 -15.5zM1079 169v0v0zM881 915l15 -510l-15 -239q0 -10 -7.5 -17.5t-17.5 -7.5t-17 7t-8 18l-14 239l14 510q0 11 7.5 18t17.5 7t17.5 -7t7.5 -18zM980 896l14 -492l-14 -236q0 -11 -8 -19 t-19 -8t-19 8t-9 19l-12 236l12 492q1 12 9 20t19 8t18.5 -8t8.5 -20zM1192 404l-14 -231v0q0 -13 -9 -22t-22 -9t-22 9t-10 22l-6 114l-6 117l12 636v3q2 15 12 24q9 7 20 7q8 0 15 -5q14 -8 16 -26zM2304 423q0 -117 -83 -199.5t-200 -82.5h-786q-13 2 -22 11t-9 22v899 q0 23 28 33q85 34 181 34q195 0 338 -131.5t160 -323.5q53 22 110 22q117 0 200 -83t83 -201z" /> +<glyph unicode="" d="M768 768q237 0 443 43t325 127v-170q0 -69 -103 -128t-280 -93.5t-385 -34.5t-385 34.5t-280 93.5t-103 128v170q119 -84 325 -127t443 -43zM768 0q237 0 443 43t325 127v-170q0 -69 -103 -128t-280 -93.5t-385 -34.5t-385 34.5t-280 93.5t-103 128v170q119 -84 325 -127 t443 -43zM768 384q237 0 443 43t325 127v-170q0 -69 -103 -128t-280 -93.5t-385 -34.5t-385 34.5t-280 93.5t-103 128v170q119 -84 325 -127t443 -43zM768 1536q208 0 385 -34.5t280 -93.5t103 -128v-128q0 -69 -103 -128t-280 -93.5t-385 -34.5t-385 34.5t-280 93.5 t-103 128v128q0 69 103 128t280 93.5t385 34.5z" /> +<glyph unicode="" d="M1468 1156q28 -28 48 -76t20 -88v-1152q0 -40 -28 -68t-68 -28h-1344q-40 0 -68 28t-28 68v1600q0 40 28 68t68 28h896q40 0 88 -20t76 -48zM1024 1400v-376h376q-10 29 -22 41l-313 313q-12 12 -41 22zM1408 -128v1024h-416q-40 0 -68 28t-28 68v416h-768v-1536h1280z M894 465q33 -26 84 -56q59 7 117 7q147 0 177 -49q16 -22 2 -52q0 -1 -1 -2l-2 -2v-1q-6 -38 -71 -38q-48 0 -115 20t-130 53q-221 -24 -392 -83q-153 -262 -242 -262q-15 0 -28 7l-24 12q-1 1 -6 5q-10 10 -6 36q9 40 56 91.5t132 96.5q14 9 23 -6q2 -2 2 -4q52 85 107 197 q68 136 104 262q-24 82 -30.5 159.5t6.5 127.5q11 40 42 40h21h1q23 0 35 -15q18 -21 9 -68q-2 -6 -4 -8q1 -3 1 -8v-30q-2 -123 -14 -192q55 -164 146 -238zM318 54q52 24 137 158q-51 -40 -87.5 -84t-49.5 -74zM716 974q-15 -42 -2 -132q1 7 7 44q0 3 7 43q1 4 4 8 q-1 1 -1 2t-0.5 1.5t-0.5 1.5q-1 22 -13 36q0 -1 -1 -2v-2zM592 313q135 54 284 81q-2 1 -13 9.5t-16 13.5q-76 67 -127 176q-27 -86 -83 -197q-30 -56 -45 -83zM1238 329q-24 24 -140 24q76 -28 124 -28q14 0 18 1q0 1 -2 3z" /> +<glyph unicode="" d="M1468 1156q28 -28 48 -76t20 -88v-1152q0 -40 -28 -68t-68 -28h-1344q-40 0 -68 28t-28 68v1600q0 40 28 68t68 28h896q40 0 88 -20t76 -48zM1024 1400v-376h376q-10 29 -22 41l-313 313q-12 12 -41 22zM1408 -128v1024h-416q-40 0 -68 28t-28 68v416h-768v-1536h1280z M233 768v-107h70l164 -661h159l128 485q7 20 10 46q2 16 2 24h4l3 -24q1 -3 3.5 -20t5.5 -26l128 -485h159l164 661h70v107h-300v-107h90l-99 -438q-5 -20 -7 -46l-2 -21h-4l-3 21q-1 5 -4 21t-5 25l-144 545h-114l-144 -545q-2 -9 -4.5 -24.5t-3.5 -21.5l-4 -21h-4l-2 21 q-2 26 -7 46l-99 438h90v107h-300z" /> +<glyph unicode="" d="M1468 1156q28 -28 48 -76t20 -88v-1152q0 -40 -28 -68t-68 -28h-1344q-40 0 -68 28t-28 68v1600q0 40 28 68t68 28h896q40 0 88 -20t76 -48zM1024 1400v-376h376q-10 29 -22 41l-313 313q-12 12 -41 22zM1408 -128v1024h-416q-40 0 -68 28t-28 68v416h-768v-1536h1280z M429 106v-106h281v106h-75l103 161q5 7 10 16.5t7.5 13.5t3.5 4h2q1 -4 5 -10q2 -4 4.5 -7.5t6 -8t6.5 -8.5l107 -161h-76v-106h291v106h-68l-192 273l195 282h67v107h-279v-107h74l-103 -159q-4 -7 -10 -16.5t-9 -13.5l-2 -3h-2q-1 4 -5 10q-6 11 -17 23l-106 159h76v107 h-290v-107h68l189 -272l-194 -283h-68z" /> +<glyph unicode="" d="M1468 1156q28 -28 48 -76t20 -88v-1152q0 -40 -28 -68t-68 -28h-1344q-40 0 -68 28t-28 68v1600q0 40 28 68t68 28h896q40 0 88 -20t76 -48zM1024 1400v-376h376q-10 29 -22 41l-313 313q-12 12 -41 22zM1408 -128v1024h-416q-40 0 -68 28t-28 68v416h-768v-1536h1280z M416 106v-106h327v106h-93v167h137q76 0 118 15q67 23 106.5 87t39.5 146q0 81 -37 141t-100 87q-48 19 -130 19h-368v-107h92v-555h-92zM769 386h-119v268h120q52 0 83 -18q56 -33 56 -115q0 -89 -62 -120q-31 -15 -78 -15z" /> +<glyph unicode="" d="M1468 1156q28 -28 48 -76t20 -88v-1152q0 -40 -28 -68t-68 -28h-1344q-40 0 -68 28t-28 68v1600q0 40 28 68t68 28h896q40 0 88 -20t76 -48zM1024 1400v-376h376q-10 29 -22 41l-313 313q-12 12 -41 22zM1408 -128v1024h-416q-40 0 -68 28t-28 68v416h-768v-1536h1280z M1280 320v-320h-1024v192l192 192l128 -128l384 384zM448 512q-80 0 -136 56t-56 136t56 136t136 56t136 -56t56 -136t-56 -136t-136 -56z" /> +<glyph unicode="" d="M640 1152v128h-128v-128h128zM768 1024v128h-128v-128h128zM640 896v128h-128v-128h128zM768 768v128h-128v-128h128zM1468 1156q28 -28 48 -76t20 -88v-1152q0 -40 -28 -68t-68 -28h-1344q-40 0 -68 28t-28 68v1600q0 40 28 68t68 28h896q40 0 88 -20t76 -48zM1024 1400 v-376h376q-10 29 -22 41l-313 313q-12 12 -41 22zM1408 -128v1024h-416q-40 0 -68 28t-28 68v416h-128v-128h-128v128h-512v-1536h1280zM781 593l107 -349q8 -27 8 -52q0 -83 -72.5 -137.5t-183.5 -54.5t-183.5 54.5t-72.5 137.5q0 25 8 52q21 63 120 396v128h128v-128h79 q22 0 39 -13t23 -34zM640 128q53 0 90.5 19t37.5 45t-37.5 45t-90.5 19t-90.5 -19t-37.5 -45t37.5 -45t90.5 -19z" /> +<glyph unicode="" d="M1468 1156q28 -28 48 -76t20 -88v-1152q0 -40 -28 -68t-68 -28h-1344q-40 0 -68 28t-28 68v1600q0 40 28 68t68 28h896q40 0 88 -20t76 -48zM1024 1400v-376h376q-10 29 -22 41l-313 313q-12 12 -41 22zM1408 -128v1024h-416q-40 0 -68 28t-28 68v416h-768v-1536h1280z M620 686q20 -8 20 -30v-544q0 -22 -20 -30q-8 -2 -12 -2q-12 0 -23 9l-166 167h-131q-14 0 -23 9t-9 23v192q0 14 9 23t23 9h131l166 167q16 15 35 7zM1037 -3q31 0 50 24q129 159 129 363t-129 363q-16 21 -43 24t-47 -14q-21 -17 -23.5 -43.5t14.5 -47.5 q100 -123 100 -282t-100 -282q-17 -21 -14.5 -47.5t23.5 -42.5q18 -15 40 -15zM826 145q27 0 47 20q87 93 87 219t-87 219q-18 19 -45 20t-46 -17t-20 -44.5t18 -46.5q52 -57 52 -131t-52 -131q-19 -20 -18 -46.5t20 -44.5q20 -17 44 -17z" /> +<glyph unicode="" d="M1468 1156q28 -28 48 -76t20 -88v-1152q0 -40 -28 -68t-68 -28h-1344q-40 0 -68 28t-28 68v1600q0 40 28 68t68 28h896q40 0 88 -20t76 -48zM1024 1400v-376h376q-10 29 -22 41l-313 313q-12 12 -41 22zM1408 -128v1024h-416q-40 0 -68 28t-28 68v416h-768v-1536h1280z M768 768q52 0 90 -38t38 -90v-384q0 -52 -38 -90t-90 -38h-384q-52 0 -90 38t-38 90v384q0 52 38 90t90 38h384zM1260 766q20 -8 20 -30v-576q0 -22 -20 -30q-8 -2 -12 -2q-14 0 -23 9l-265 266v90l265 266q9 9 23 9q4 0 12 -2z" /> +<glyph unicode="" d="M1468 1156q28 -28 48 -76t20 -88v-1152q0 -40 -28 -68t-68 -28h-1344q-40 0 -68 28t-28 68v1600q0 40 28 68t68 28h896q40 0 88 -20t76 -48zM1024 1400v-376h376q-10 29 -22 41l-313 313q-12 12 -41 22zM1408 -128v1024h-416q-40 0 -68 28t-28 68v416h-768v-1536h1280z M480 768q8 11 21 12.5t24 -6.5l51 -38q11 -8 12.5 -21t-6.5 -24l-182 -243l182 -243q8 -11 6.5 -24t-12.5 -21l-51 -38q-11 -8 -24 -6.5t-21 12.5l-226 301q-14 19 0 38zM1282 467q14 -19 0 -38l-226 -301q-8 -11 -21 -12.5t-24 6.5l-51 38q-11 8 -12.5 21t6.5 24l182 243 l-182 243q-8 11 -6.5 24t12.5 21l51 38q11 8 24 6.5t21 -12.5zM662 6q-13 2 -20.5 13t-5.5 24l138 831q2 13 13 20.5t24 5.5l63 -10q13 -2 20.5 -13t5.5 -24l-138 -831q-2 -13 -13 -20.5t-24 -5.5z" /> +<glyph unicode="" d="M1497 709v-198q-101 -23 -198 -23q-65 -136 -165.5 -271t-181.5 -215.5t-128 -106.5q-80 -45 -162 3q-28 17 -60.5 43.5t-85 83.5t-102.5 128.5t-107.5 184t-105.5 244t-91.5 314.5t-70.5 390h283q26 -218 70 -398.5t104.5 -317t121.5 -235.5t140 -195q169 169 287 406 q-142 72 -223 220t-81 333q0 192 104 314.5t284 122.5q178 0 273 -105.5t95 -297.5q0 -159 -58 -286q-7 -1 -19.5 -3t-46 -2t-63 6t-62 25.5t-50.5 51.5q31 103 31 184q0 87 -29 132t-79 45q-53 0 -85 -49.5t-32 -140.5q0 -186 105 -293.5t267 -107.5q62 0 121 14z" /> +<glyph unicode="" horiz-adv-x="1792" d="M216 367l603 -402v359l-334 223zM154 511l193 129l-193 129v-258zM973 -35l603 402l-269 180l-334 -223v-359zM896 458l272 182l-272 182l-272 -182zM485 733l334 223v359l-603 -402zM1445 640l193 -129v258zM1307 733l269 180l-603 402v-359zM1792 913v-546 q0 -41 -34 -64l-819 -546q-21 -13 -43 -13t-43 13l-819 546q-34 23 -34 64v546q0 41 34 64l819 546q21 13 43 13t43 -13l819 -546q34 -23 34 -64z" /> +<glyph unicode="" horiz-adv-x="2048" d="M1800 764q111 -46 179.5 -145.5t68.5 -221.5q0 -164 -118 -280.5t-285 -116.5q-4 0 -11.5 0.5t-10.5 0.5h-1209h-1h-2h-5q-170 10 -288 125.5t-118 280.5q0 110 55 203t147 147q-12 39 -12 82q0 115 82 196t199 81q95 0 172 -58q75 154 222.5 248t326.5 94 q166 0 306 -80.5t221.5 -218.5t81.5 -301q0 -6 -0.5 -18t-0.5 -18zM468 498q0 -122 84 -193t208 -71q137 0 240 99q-16 20 -47.5 56.5t-43.5 50.5q-67 -65 -144 -65q-55 0 -93.5 33.5t-38.5 87.5q0 53 38.5 87t91.5 34q44 0 84.5 -21t73 -55t65 -75t69 -82t77 -75t97 -55 t121.5 -21q121 0 204.5 71.5t83.5 190.5q0 121 -84 192t-207 71q-143 0 -241 -97q14 -16 29.5 -34t34.5 -40t29 -34q66 64 142 64q52 0 92 -33t40 -84q0 -57 -37 -91.5t-94 -34.5q-43 0 -82.5 21t-72 55t-65.5 75t-69.5 82t-77.5 75t-96.5 55t-118.5 21q-122 0 -207 -70.5 t-85 -189.5z" /> +<glyph unicode="" horiz-adv-x="1792" d="M896 1536q182 0 348 -71t286 -191t191 -286t71 -348t-71 -348t-191 -286t-286 -191t-348 -71t-348 71t-286 191t-191 286t-71 348t71 348t191 286t286 191t348 71zM896 1408q-190 0 -361 -90l194 -194q82 28 167 28t167 -28l194 194q-171 90 -361 90zM218 279l194 194 q-28 82 -28 167t28 167l-194 194q-90 -171 -90 -361t90 -361zM896 -128q190 0 361 90l-194 194q-82 -28 -167 -28t-167 28l-194 -194q171 -90 361 -90zM896 256q159 0 271.5 112.5t112.5 271.5t-112.5 271.5t-271.5 112.5t-271.5 -112.5t-112.5 -271.5t112.5 -271.5 t271.5 -112.5zM1380 473l194 -194q90 171 90 361t-90 361l-194 -194q28 -82 28 -167t-28 -167z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1760 640q0 -176 -68.5 -336t-184 -275.5t-275.5 -184t-336 -68.5t-336 68.5t-275.5 184t-184 275.5t-68.5 336q0 213 97 398.5t265 305.5t374 151v-228q-221 -45 -366.5 -221t-145.5 -406q0 -130 51 -248.5t136.5 -204t204 -136.5t248.5 -51t248.5 51t204 136.5 t136.5 204t51 248.5q0 230 -145.5 406t-366.5 221v228q206 -31 374 -151t265 -305.5t97 -398.5z" /> +<glyph unicode="" horiz-adv-x="1792" d="M19 662q8 217 116 406t305 318h5q0 -1 -1 -3q-8 -8 -28 -33.5t-52 -76.5t-60 -110.5t-44.5 -135.5t-14 -150.5t39 -157.5t108.5 -154q50 -50 102 -69.5t90.5 -11.5t69.5 23.5t47 32.5l16 16q39 51 53 116.5t6.5 122.5t-21 107t-26.5 80l-14 29q-10 25 -30.5 49.5t-43 41 t-43.5 29.5t-35 19l-13 6l104 115q39 -17 78 -52t59 -61l19 -27q1 48 -18.5 103.5t-40.5 87.5l-20 31l161 183l160 -181q-33 -46 -52.5 -102.5t-22.5 -90.5l-4 -33q22 37 61.5 72.5t67.5 52.5l28 17l103 -115q-44 -14 -85 -50t-60 -65l-19 -29q-31 -56 -48 -133.5t-7 -170 t57 -156.5q33 -45 77.5 -60.5t85 -5.5t76 26.5t57.5 33.5l21 16q60 53 96.5 115t48.5 121.5t10 121.5t-18 118t-37 107.5t-45.5 93t-45 72t-34.5 47.5l-13 17q-14 13 -7 13l10 -3q40 -29 62.5 -46t62 -50t64 -58t58.5 -65t55.5 -77t45.5 -88t38 -103t23.5 -117t10.5 -136 q3 -259 -108 -465t-312 -321t-456 -115q-185 0 -351 74t-283.5 198t-184 293t-60.5 353z" /> +<glyph unicode="" horiz-adv-x="1792" d="M874 -102v-66q-208 6 -385 109.5t-283 275.5l58 34q29 -49 73 -99l65 57q148 -168 368 -212l-17 -86q65 -12 121 -13zM276 428l-83 -28q22 -60 49 -112l-57 -33q-98 180 -98 385t98 385l57 -33q-30 -56 -49 -112l82 -28q-35 -100 -35 -212q0 -109 36 -212zM1528 251 l58 -34q-106 -172 -283 -275.5t-385 -109.5v66q56 1 121 13l-17 86q220 44 368 212l65 -57q44 50 73 99zM1377 805l-233 -80q14 -42 14 -85t-14 -85l232 -80q-31 -92 -98 -169l-185 162q-57 -67 -147 -85l48 -241q-52 -10 -98 -10t-98 10l48 241q-90 18 -147 85l-185 -162 q-67 77 -98 169l232 80q-14 42 -14 85t14 85l-233 80q33 93 99 169l185 -162q59 68 147 86l-48 240q44 10 98 10t98 -10l-48 -240q88 -18 147 -86l185 162q66 -76 99 -169zM874 1448v-66q-65 -2 -121 -13l17 -86q-220 -42 -368 -211l-65 56q-38 -42 -73 -98l-57 33 q106 172 282 275.5t385 109.5zM1705 640q0 -205 -98 -385l-57 33q27 52 49 112l-83 28q36 103 36 212q0 112 -35 212l82 28q-19 56 -49 112l57 33q98 -180 98 -385zM1585 1063l-57 -33q-35 56 -73 98l-65 -56q-148 169 -368 211l17 86q-56 11 -121 13v66q209 -6 385 -109.5 t282 -275.5zM1748 640q0 173 -67.5 331t-181.5 272t-272 181.5t-331 67.5t-331 -67.5t-272 -181.5t-181.5 -272t-67.5 -331t67.5 -331t181.5 -272t272 -181.5t331 -67.5t331 67.5t272 181.5t181.5 272t67.5 331zM1792 640q0 -182 -71 -348t-191 -286t-286 -191t-348 -71 t-348 71t-286 191t-191 286t-71 348t71 348t191 286t286 191t348 71t348 -71t286 -191t191 -286t71 -348z" /> +<glyph unicode="" d="M582 228q0 -66 -93 -66q-107 0 -107 63q0 64 98 64q102 0 102 -61zM546 694q0 -85 -74 -85q-77 0 -77 84q0 90 77 90q36 0 55 -25.5t19 -63.5zM712 769v125q-78 -29 -135 -29q-50 29 -110 29q-86 0 -145 -57t-59 -143q0 -50 29.5 -102t73.5 -67v-3q-38 -17 -38 -85 q0 -53 41 -77v-3q-113 -37 -113 -139q0 -45 20 -78.5t54 -51t72 -25.5t81 -8q224 0 224 188q0 67 -48 99t-126 46q-27 5 -51.5 20.5t-24.5 39.5q0 44 49 52q77 15 122 70t45 134q0 24 -10 52q37 9 49 13zM771 350h137q-2 27 -2 82v387q0 46 2 69h-137q3 -23 3 -71v-392 q0 -50 -3 -75zM1280 366v121q-30 -21 -68 -21q-53 0 -53 82v225h52q9 0 26.5 -1t26.5 -1v117h-105q0 82 3 102h-140q4 -24 4 -55v-47h-60v-117q36 3 37 3q3 0 11 -0.5t12 -0.5v-2h-2v-217q0 -37 2.5 -64t11.5 -56.5t24.5 -48.5t43.5 -31t66 -12q64 0 108 24zM924 1072 q0 36 -24 63.5t-60 27.5t-60.5 -27t-24.5 -64q0 -36 25 -62.5t60 -26.5t59.5 27t24.5 62zM1536 1120v-960q0 -119 -84.5 -203.5t-203.5 -84.5h-960q-119 0 -203.5 84.5t-84.5 203.5v960q0 119 84.5 203.5t203.5 84.5h960q119 0 203.5 -84.5t84.5 -203.5z" /> +<glyph unicode="" horiz-adv-x="1792" d="M595 22q0 100 -165 100q-158 0 -158 -104q0 -101 172 -101q151 0 151 105zM536 777q0 61 -30 102t-89 41q-124 0 -124 -145q0 -135 124 -135q119 0 119 137zM805 1101v-202q-36 -12 -79 -22q16 -43 16 -84q0 -127 -73 -216.5t-197 -112.5q-40 -8 -59.5 -27t-19.5 -58 q0 -31 22.5 -51.5t58 -32t78.5 -22t86 -25.5t78.5 -37.5t58 -64t22.5 -98.5q0 -304 -363 -304q-69 0 -130 12.5t-116 41t-87.5 82t-32.5 127.5q0 165 182 225v4q-67 41 -67 126q0 109 63 137v4q-72 24 -119.5 108.5t-47.5 165.5q0 139 95 231.5t235 92.5q96 0 178 -47 q98 0 218 47zM1123 220h-222q4 45 4 134v609q0 94 -4 128h222q-4 -33 -4 -124v-613q0 -89 4 -134zM1724 442v-196q-71 -39 -174 -39q-62 0 -107 20t-70 50t-39.5 78t-18.5 92t-4 103v351h2v4q-7 0 -19 1t-18 1q-21 0 -59 -6v190h96v76q0 54 -6 89h227q-6 -41 -6 -165h171 v-190q-15 0 -43.5 2t-42.5 2h-85v-365q0 -131 87 -131q61 0 109 33zM1148 1389q0 -58 -39 -101.5t-96 -43.5q-58 0 -98 43.5t-40 101.5q0 59 39.5 103t98.5 44q58 0 96.5 -44.5t38.5 -102.5z" /> +<glyph unicode="" d="M809 532l266 499h-112l-157 -312q-24 -48 -44 -92l-42 92l-155 312h-120l263 -493v-324h101v318zM1536 1120v-960q0 -119 -84.5 -203.5t-203.5 -84.5h-960q-119 0 -203.5 84.5t-84.5 203.5v960q0 119 84.5 203.5t203.5 84.5h960q119 0 203.5 -84.5t84.5 -203.5z" /> +<glyph unicode="" horiz-adv-x="1280" d="M842 964q0 -80 -57 -136.5t-136 -56.5q-60 0 -111 35q-62 -67 -115 -146q-247 -371 -202 -859q1 -22 -12.5 -38.5t-34.5 -18.5h-5q-20 0 -35 13.5t-17 33.5q-14 126 -3.5 247.5t29.5 217t54 186t69 155.5t74 125q61 90 132 165q-16 35 -16 77q0 80 56.5 136.5t136.5 56.5 t136.5 -56.5t56.5 -136.5zM1223 953q0 -158 -78 -292t-212.5 -212t-292.5 -78q-64 0 -131 14q-21 5 -32.5 23.5t-6.5 39.5q5 20 23 31.5t39 7.5q51 -13 108 -13q97 0 186 38t153 102t102 153t38 186t-38 186t-102 153t-153 102t-186 38t-186 -38t-153 -102t-102 -153 t-38 -186q0 -114 52 -218q10 -20 3.5 -40t-25.5 -30t-39.5 -3t-30.5 26q-64 123 -64 265q0 119 46.5 227t124.5 186t186 124t226 46q158 0 292.5 -78t212.5 -212.5t78 -292.5z" /> +<glyph unicode="" horiz-adv-x="1792" d="M270 730q-8 19 -8 52q0 20 11 49t24 45q-1 22 7.5 53t22.5 43q0 139 92.5 288.5t217.5 209.5q139 66 324 66q133 0 266 -55q49 -21 90 -48t71 -56t55 -68t42 -74t32.5 -84.5t25.5 -89.5t22 -98l1 -5q55 -83 55 -150q0 -14 -9 -40t-9 -38q0 -1 1.5 -3.5t3.5 -5t2 -3.5 q77 -114 120.5 -214.5t43.5 -208.5q0 -43 -19.5 -100t-55.5 -57q-9 0 -19.5 7.5t-19 17.5t-19 26t-16 26.5t-13.5 26t-9 17.5q-1 1 -3 1l-5 -4q-59 -154 -132 -223q20 -20 61.5 -38.5t69 -41.5t35.5 -65q-2 -4 -4 -16t-7 -18q-64 -97 -302 -97q-53 0 -110.5 9t-98 20 t-104.5 30q-15 5 -23 7q-14 4 -46 4.5t-40 1.5q-41 -45 -127.5 -65t-168.5 -20q-35 0 -69 1.5t-93 9t-101 20.5t-74.5 40t-32.5 64q0 40 10 59.5t41 48.5q11 2 40.5 13t49.5 12q4 0 14 2q2 2 2 4l-2 3q-48 11 -108 105.5t-73 156.5l-5 3q-4 0 -12 -20q-18 -41 -54.5 -74.5 t-77.5 -37.5h-1q-4 0 -6 4.5t-5 5.5q-23 54 -23 100q0 275 252 466z" /> +<glyph unicode="" horiz-adv-x="2048" d="M580 1075q0 41 -25 66t-66 25q-43 0 -76 -25.5t-33 -65.5q0 -39 33 -64.5t76 -25.5q41 0 66 24.5t25 65.5zM1323 568q0 28 -25.5 50t-65.5 22q-27 0 -49.5 -22.5t-22.5 -49.5q0 -28 22.5 -50.5t49.5 -22.5q40 0 65.5 22t25.5 51zM1087 1075q0 41 -24.5 66t-65.5 25 q-43 0 -76 -25.5t-33 -65.5q0 -39 33 -64.5t76 -25.5q41 0 65.5 24.5t24.5 65.5zM1722 568q0 28 -26 50t-65 22q-27 0 -49.5 -22.5t-22.5 -49.5q0 -28 22.5 -50.5t49.5 -22.5q39 0 65 22t26 51zM1456 965q-31 4 -70 4q-169 0 -311 -77t-223.5 -208.5t-81.5 -287.5 q0 -78 23 -152q-35 -3 -68 -3q-26 0 -50 1.5t-55 6.5t-44.5 7t-54.5 10.5t-50 10.5l-253 -127l72 218q-290 203 -290 490q0 169 97.5 311t264 223.5t363.5 81.5q176 0 332.5 -66t262 -182.5t136.5 -260.5zM2048 404q0 -117 -68.5 -223.5t-185.5 -193.5l55 -181l-199 109 q-150 -37 -218 -37q-169 0 -311 70.5t-223.5 191.5t-81.5 264t81.5 264t223.5 191.5t311 70.5q161 0 303 -70.5t227.5 -192t85.5 -263.5z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1764 1525q33 -24 27 -64l-256 -1536q-5 -29 -32 -45q-14 -8 -31 -8q-11 0 -24 5l-453 185l-242 -295q-18 -23 -49 -23q-13 0 -22 4q-19 7 -30.5 23.5t-11.5 36.5v349l864 1059l-1069 -925l-395 162q-37 14 -40 55q-2 40 32 59l1664 960q15 9 32 9q20 0 36 -11z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1764 1525q33 -24 27 -64l-256 -1536q-5 -29 -32 -45q-14 -8 -31 -8q-11 0 -24 5l-527 215l-298 -327q-18 -21 -47 -21q-14 0 -23 4q-19 7 -30 23.5t-11 36.5v452l-472 193q-37 14 -40 55q-3 39 32 59l1664 960q35 21 68 -2zM1422 26l221 1323l-1434 -827l336 -137 l863 639l-478 -797z" /> +<glyph unicode="" d="M1536 640q0 -156 -61 -298t-164 -245t-245 -164t-298 -61q-172 0 -327 72.5t-264 204.5q-7 10 -6.5 22.5t8.5 20.5l137 138q10 9 25 9q16 -2 23 -12q73 -95 179 -147t225 -52q104 0 198.5 40.5t163.5 109.5t109.5 163.5t40.5 198.5t-40.5 198.5t-109.5 163.5 t-163.5 109.5t-198.5 40.5q-98 0 -188 -35.5t-160 -101.5l137 -138q31 -30 14 -69q-17 -40 -59 -40h-448q-26 0 -45 19t-19 45v448q0 42 40 59q39 17 69 -14l130 -129q107 101 244.5 156.5t284.5 55.5q156 0 298 -61t245 -164t164 -245t61 -298zM896 928v-448q0 -14 -9 -23 t-23 -9h-320q-14 0 -23 9t-9 23v64q0 14 9 23t23 9h224v352q0 14 9 23t23 9h64q14 0 23 -9t9 -23z" /> +<glyph unicode="" d="M768 1280q-130 0 -248.5 -51t-204 -136.5t-136.5 -204t-51 -248.5t51 -248.5t136.5 -204t204 -136.5t248.5 -51t248.5 51t204 136.5t136.5 204t51 248.5t-51 248.5t-136.5 204t-204 136.5t-248.5 51zM1536 640q0 -209 -103 -385.5t-279.5 -279.5t-385.5 -103t-385.5 103 t-279.5 279.5t-103 385.5t103 385.5t279.5 279.5t385.5 103t385.5 -103t279.5 -279.5t103 -385.5z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1682 -128q-44 0 -132.5 3.5t-133.5 3.5q-44 0 -132 -3.5t-132 -3.5q-24 0 -37 20.5t-13 45.5q0 31 17 46t39 17t51 7t45 15q33 21 33 140l-1 391q0 21 -1 31q-13 4 -50 4h-675q-38 0 -51 -4q-1 -10 -1 -31l-1 -371q0 -142 37 -164q16 -10 48 -13t57 -3.5t45 -15 t20 -45.5q0 -26 -12.5 -48t-36.5 -22q-47 0 -139.5 3.5t-138.5 3.5q-43 0 -128 -3.5t-127 -3.5q-23 0 -35.5 21t-12.5 45q0 30 15.5 45t36 17.5t47.5 7.5t42 15q33 23 33 143l-1 57v813q0 3 0.5 26t0 36.5t-1.5 38.5t-3.5 42t-6.5 36.5t-11 31.5t-16 18q-15 10 -45 12t-53 2 t-41 14t-18 45q0 26 12 48t36 22q46 0 138.5 -3.5t138.5 -3.5q42 0 126.5 3.5t126.5 3.5q25 0 37.5 -22t12.5 -48q0 -30 -17 -43.5t-38.5 -14.5t-49.5 -4t-43 -13q-35 -21 -35 -160l1 -320q0 -21 1 -32q13 -3 39 -3h699q25 0 38 3q1 11 1 32l1 320q0 139 -35 160 q-18 11 -58.5 12.5t-66 13t-25.5 49.5q0 26 12.5 48t37.5 22q44 0 132 -3.5t132 -3.5q43 0 129 3.5t129 3.5q25 0 37.5 -22t12.5 -48q0 -30 -17.5 -44t-40 -14.5t-51.5 -3t-44 -12.5q-35 -23 -35 -161l1 -943q0 -119 34 -140q16 -10 46 -13.5t53.5 -4.5t41.5 -15.5t18 -44.5 q0 -26 -12 -48t-36 -22z" /> +<glyph unicode="" horiz-adv-x="1280" d="M1278 1347v-73q0 -29 -18.5 -61t-42.5 -32q-50 0 -54 -1q-26 -6 -32 -31q-3 -11 -3 -64v-1152q0 -25 -18 -43t-43 -18h-108q-25 0 -43 18t-18 43v1218h-143v-1218q0 -25 -17.5 -43t-43.5 -18h-108q-26 0 -43.5 18t-17.5 43v496q-147 12 -245 59q-126 58 -192 179 q-64 117 -64 259q0 166 88 286q88 118 209 159q111 37 417 37h479q25 0 43 -18t18 -43z" /> +<glyph unicode="" d="M352 128v-128h-352v128h352zM704 256q26 0 45 -19t19 -45v-256q0 -26 -19 -45t-45 -19h-256q-26 0 -45 19t-19 45v256q0 26 19 45t45 19h256zM864 640v-128h-864v128h864zM224 1152v-128h-224v128h224zM1536 128v-128h-736v128h736zM576 1280q26 0 45 -19t19 -45v-256 q0 -26 -19 -45t-45 -19h-256q-26 0 -45 19t-19 45v256q0 26 19 45t45 19h256zM1216 768q26 0 45 -19t19 -45v-256q0 -26 -19 -45t-45 -19h-256q-26 0 -45 19t-19 45v256q0 26 19 45t45 19h256zM1536 640v-128h-224v128h224zM1536 1152v-128h-864v128h864z" /> +<glyph unicode="" d="M1216 512q133 0 226.5 -93.5t93.5 -226.5t-93.5 -226.5t-226.5 -93.5t-226.5 93.5t-93.5 226.5q0 12 2 34l-360 180q-92 -86 -218 -86q-133 0 -226.5 93.5t-93.5 226.5t93.5 226.5t226.5 93.5q126 0 218 -86l360 180q-2 22 -2 34q0 133 93.5 226.5t226.5 93.5 t226.5 -93.5t93.5 -226.5t-93.5 -226.5t-226.5 -93.5q-126 0 -218 86l-360 -180q2 -22 2 -34t-2 -34l360 -180q92 86 218 86z" /> +<glyph unicode="" d="M1280 341q0 88 -62.5 151t-150.5 63q-84 0 -145 -58l-241 120q2 16 2 23t-2 23l241 120q61 -58 145 -58q88 0 150.5 63t62.5 151t-62.5 150.5t-150.5 62.5t-151 -62.5t-63 -150.5q0 -7 2 -23l-241 -120q-62 57 -145 57q-88 0 -150.5 -62.5t-62.5 -150.5t62.5 -150.5 t150.5 -62.5q83 0 145 57l241 -120q-2 -16 -2 -23q0 -88 63 -150.5t151 -62.5t150.5 62.5t62.5 150.5zM1536 1120v-960q0 -119 -84.5 -203.5t-203.5 -84.5h-960q-119 0 -203.5 84.5t-84.5 203.5v960q0 119 84.5 203.5t203.5 84.5h960q119 0 203.5 -84.5t84.5 -203.5z" /> +<glyph unicode="" horiz-adv-x="1792" d="M571 947q-10 25 -34 35t-49 0q-108 -44 -191 -127t-127 -191q-10 -25 0 -49t35 -34q13 -5 24 -5q42 0 60 40q34 84 98.5 148.5t148.5 98.5q25 11 35 35t0 49zM1513 1303l46 -46l-244 -243l68 -68q19 -19 19 -45.5t-19 -45.5l-64 -64q89 -161 89 -343q0 -143 -55.5 -273.5 t-150 -225t-225 -150t-273.5 -55.5t-273.5 55.5t-225 150t-150 225t-55.5 273.5t55.5 273.5t150 225t225 150t273.5 55.5q182 0 343 -89l64 64q19 19 45.5 19t45.5 -19l68 -68zM1521 1359q-10 -10 -22 -10q-13 0 -23 10l-91 90q-9 10 -9 23t9 23q10 9 23 9t23 -9l90 -91 q10 -9 10 -22.5t-10 -22.5zM1751 1129q-11 -9 -23 -9t-23 9l-90 91q-10 9 -10 22.5t10 22.5q9 10 22.5 10t22.5 -10l91 -90q9 -10 9 -23t-9 -23zM1792 1312q0 -14 -9 -23t-23 -9h-96q-14 0 -23 9t-9 23t9 23t23 9h96q14 0 23 -9t9 -23zM1600 1504v-96q0 -14 -9 -23t-23 -9 t-23 9t-9 23v96q0 14 9 23t23 9t23 -9t9 -23zM1751 1449l-91 -90q-10 -10 -22 -10q-13 0 -23 10q-10 9 -10 22.5t10 22.5l90 91q10 9 23 9t23 -9q9 -10 9 -23t-9 -23z" /> +<glyph unicode="" horiz-adv-x="1792" d="M609 720l287 208l287 -208l-109 -336h-355zM896 1536q182 0 348 -71t286 -191t191 -286t71 -348t-71 -348t-191 -286t-286 -191t-348 -71t-348 71t-286 191t-191 286t-71 348t71 348t191 286t286 191t348 71zM1515 186q149 203 149 454v3l-102 -89l-240 224l63 323 l134 -12q-150 206 -389 282l53 -124l-287 -159l-287 159l53 124q-239 -76 -389 -282l135 12l62 -323l-240 -224l-102 89v-3q0 -251 149 -454l30 132l326 -40l139 -298l-116 -69q117 -39 240 -39t240 39l-116 69l139 298l326 40z" /> +<glyph unicode="" horiz-adv-x="1792" d="M448 224v-192q0 -14 -9 -23t-23 -9h-192q-14 0 -23 9t-9 23v192q0 14 9 23t23 9h192q14 0 23 -9t9 -23zM256 608v-192q0 -14 -9 -23t-23 -9h-192q-14 0 -23 9t-9 23v192q0 14 9 23t23 9h192q14 0 23 -9t9 -23zM832 224v-192q0 -14 -9 -23t-23 -9h-192q-14 0 -23 9t-9 23 v192q0 14 9 23t23 9h192q14 0 23 -9t9 -23zM640 608v-192q0 -14 -9 -23t-23 -9h-192q-14 0 -23 9t-9 23v192q0 14 9 23t23 9h192q14 0 23 -9t9 -23zM66 768q-28 0 -47 19t-19 46v129h514v-129q0 -27 -19 -46t-46 -19h-383zM1216 224v-192q0 -14 -9 -23t-23 -9h-192 q-14 0 -23 9t-9 23v192q0 14 9 23t23 9h192q14 0 23 -9t9 -23zM1024 608v-192q0 -14 -9 -23t-23 -9h-192q-14 0 -23 9t-9 23v192q0 14 9 23t23 9h192q14 0 23 -9t9 -23zM1600 224v-192q0 -14 -9 -23t-23 -9h-192q-14 0 -23 9t-9 23v192q0 14 9 23t23 9h192q14 0 23 -9t9 -23 zM1408 608v-192q0 -14 -9 -23t-23 -9h-192q-14 0 -23 9t-9 23v192q0 14 9 23t23 9h192q14 0 23 -9t9 -23zM1792 1016v-13h-514v10q0 104 -382 102q-382 -1 -382 -102v-10h-514v13q0 17 8.5 43t34 64t65.5 75.5t110.5 76t160 67.5t224 47.5t293.5 18.5t293 -18.5t224 -47.5 t160.5 -67.5t110.5 -76t65.5 -75.5t34 -64t8.5 -43zM1792 608v-192q0 -14 -9 -23t-23 -9h-192q-14 0 -23 9t-9 23v192q0 14 9 23t23 9h192q14 0 23 -9t9 -23zM1792 962v-129q0 -27 -19 -46t-46 -19h-384q-27 0 -46 19t-19 46v129h514z" /> +<glyph unicode="" horiz-adv-x="1792" d="M704 1216v-768q0 -26 -19 -45t-45 -19v-576q0 -26 -19 -45t-45 -19h-512q-26 0 -45 19t-19 45v512l249 873q7 23 31 23h424zM1024 1216v-704h-256v704h256zM1792 320v-512q0 -26 -19 -45t-45 -19h-512q-26 0 -45 19t-19 45v576q-26 0 -45 19t-19 45v768h424q24 0 31 -23z M736 1504v-224h-352v224q0 14 9 23t23 9h288q14 0 23 -9t9 -23zM1408 1504v-224h-352v224q0 14 9 23t23 9h288q14 0 23 -9t9 -23z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1755 1083q37 -37 37 -90t-37 -91l-401 -400l150 -150l-160 -160q-163 -163 -389.5 -186.5t-411.5 100.5l-362 -362h-181v181l362 362q-124 185 -100.5 411.5t186.5 389.5l160 160l150 -150l400 401q38 37 91 37t90 -37t37 -90.5t-37 -90.5l-400 -401l234 -234l401 400 q38 37 91 37t90 -37z" /> +<glyph unicode="" horiz-adv-x="1792" d="M873 796q0 -83 -63.5 -142.5t-152.5 -59.5t-152.5 59.5t-63.5 142.5q0 84 63.5 143t152.5 59t152.5 -59t63.5 -143zM1375 796q0 -83 -63 -142.5t-153 -59.5q-89 0 -152.5 59.5t-63.5 142.5q0 84 63.5 143t152.5 59q90 0 153 -59t63 -143zM1600 616v667q0 87 -32 123.5 t-111 36.5h-1112q-83 0 -112.5 -34t-29.5 -126v-673q43 -23 88.5 -40t81 -28t81 -18.5t71 -11t70 -4t58.5 -0.5t56.5 2t44.5 2q68 1 95 -27q6 -6 10 -9q26 -25 61 -51q7 91 118 87q5 0 36.5 -1.5t43 -2t45.5 -1t53 1t54.5 4.5t61 8.5t62 13.5t67 19.5t67.5 27t72 34.5z M1763 621q-121 -149 -372 -252q84 -285 -23 -465q-66 -113 -183 -148q-104 -32 -182 15q-86 51 -82 164l-1 326v1q-8 2 -24.5 6t-23.5 5l-1 -338q4 -114 -83 -164q-79 -47 -183 -15q-117 36 -182 150q-105 180 -22 463q-251 103 -372 252q-25 37 -4 63t60 -1q3 -2 11 -7 t11 -8v694q0 72 47 123t114 51h1257q67 0 114 -51t47 -123v-694l21 15q39 27 60 1t-4 -63z" /> +<glyph unicode="" horiz-adv-x="1792" d="M896 1102v-434h-145v434h145zM1294 1102v-434h-145v434h145zM1294 342l253 254v795h-1194v-1049h326v-217l217 217h398zM1692 1536v-1013l-434 -434h-326l-217 -217h-217v217h-398v1158l109 289h1483z" /> +<glyph unicode="" d="M773 217v-127q-1 -292 -6 -305q-12 -32 -51 -40q-54 -9 -181.5 38t-162.5 89q-13 15 -17 36q-1 12 4 26q4 10 34 47t181 216q1 0 60 70q15 19 39.5 24.5t49.5 -3.5q24 -10 37.5 -29t12.5 -42zM624 468q-3 -55 -52 -70l-120 -39q-275 -88 -292 -88q-35 2 -54 36 q-12 25 -17 75q-8 76 1 166.5t30 124.5t56 32q13 0 202 -77q70 -29 115 -47l84 -34q23 -9 35.5 -30.5t11.5 -48.5zM1450 171q-7 -54 -91.5 -161t-135.5 -127q-37 -14 -63 7q-14 10 -184 287l-47 77q-14 21 -11.5 46t19.5 46q35 43 83 26q1 -1 119 -40q203 -66 242 -79.5 t47 -20.5q28 -22 22 -61zM778 803q5 -102 -54 -122q-58 -17 -114 71l-378 598q-8 35 19 62q41 43 207.5 89.5t224.5 31.5q40 -10 49 -45q3 -18 22 -305.5t24 -379.5zM1440 695q3 -39 -26 -59q-15 -10 -329 -86q-67 -15 -91 -23l1 2q-23 -6 -46 4t-37 32q-30 47 0 87 q1 1 75 102q125 171 150 204t34 39q28 19 65 2q48 -23 123 -133.5t81 -167.5v-3z" /> +<glyph unicode="" horiz-adv-x="2048" d="M1024 1024h-384v-384h384v384zM1152 384v-128h-640v128h640zM1152 1152v-640h-640v640h640zM1792 384v-128h-512v128h512zM1792 640v-128h-512v128h512zM1792 896v-128h-512v128h512zM1792 1152v-128h-512v128h512zM256 192v960h-128v-960q0 -26 19 -45t45 -19t45 19 t19 45zM1920 192v1088h-1536v-1088q0 -33 -11 -64h1483q26 0 45 19t19 45zM2048 1408v-1216q0 -80 -56 -136t-136 -56h-1664q-80 0 -136 56t-56 136v1088h256v128h1792z" /> +<glyph unicode="" horiz-adv-x="2048" d="M1024 13q-20 0 -93 73.5t-73 93.5q0 32 62.5 54t103.5 22t103.5 -22t62.5 -54q0 -20 -73 -93.5t-93 -73.5zM1294 284q-2 0 -40 25t-101.5 50t-128.5 25t-128.5 -25t-101 -50t-40.5 -25q-18 0 -93.5 75t-75.5 93q0 13 10 23q78 77 196 121t233 44t233 -44t196 -121 q10 -10 10 -23q0 -18 -75.5 -93t-93.5 -75zM1567 556q-11 0 -23 8q-136 105 -252 154.5t-268 49.5q-85 0 -170.5 -22t-149 -53t-113.5 -62t-79 -53t-31 -22q-17 0 -92 75t-75 93q0 12 10 22q132 132 320 205t380 73t380 -73t320 -205q10 -10 10 -22q0 -18 -75 -93t-92 -75z M1838 827q-11 0 -22 9q-179 157 -371.5 236.5t-420.5 79.5t-420.5 -79.5t-371.5 -236.5q-11 -9 -22 -9q-17 0 -92.5 75t-75.5 93q0 13 10 23q187 186 445 288t527 102t527 -102t445 -288q10 -10 10 -23q0 -18 -75.5 -93t-92.5 -75z" /> +<glyph unicode="" horiz-adv-x="1792" d="M384 0q0 53 -37.5 90.5t-90.5 37.5t-90.5 -37.5t-37.5 -90.5t37.5 -90.5t90.5 -37.5t90.5 37.5t37.5 90.5zM768 0q0 53 -37.5 90.5t-90.5 37.5t-90.5 -37.5t-37.5 -90.5t37.5 -90.5t90.5 -37.5t90.5 37.5t37.5 90.5zM384 384q0 53 -37.5 90.5t-90.5 37.5t-90.5 -37.5 t-37.5 -90.5t37.5 -90.5t90.5 -37.5t90.5 37.5t37.5 90.5zM1152 0q0 53 -37.5 90.5t-90.5 37.5t-90.5 -37.5t-37.5 -90.5t37.5 -90.5t90.5 -37.5t90.5 37.5t37.5 90.5zM768 384q0 53 -37.5 90.5t-90.5 37.5t-90.5 -37.5t-37.5 -90.5t37.5 -90.5t90.5 -37.5t90.5 37.5 t37.5 90.5zM384 768q0 53 -37.5 90.5t-90.5 37.5t-90.5 -37.5t-37.5 -90.5t37.5 -90.5t90.5 -37.5t90.5 37.5t37.5 90.5zM1152 384q0 53 -37.5 90.5t-90.5 37.5t-90.5 -37.5t-37.5 -90.5t37.5 -90.5t90.5 -37.5t90.5 37.5t37.5 90.5zM768 768q0 53 -37.5 90.5t-90.5 37.5 t-90.5 -37.5t-37.5 -90.5t37.5 -90.5t90.5 -37.5t90.5 37.5t37.5 90.5zM1536 0v384q0 52 -38 90t-90 38t-90 -38t-38 -90v-384q0 -52 38 -90t90 -38t90 38t38 90zM1152 768q0 53 -37.5 90.5t-90.5 37.5t-90.5 -37.5t-37.5 -90.5t37.5 -90.5t90.5 -37.5t90.5 37.5t37.5 90.5z M1536 1088v256q0 26 -19 45t-45 19h-1280q-26 0 -45 -19t-19 -45v-256q0 -26 19 -45t45 -19h1280q26 0 45 19t19 45zM1536 768q0 53 -37.5 90.5t-90.5 37.5t-90.5 -37.5t-37.5 -90.5t37.5 -90.5t90.5 -37.5t90.5 37.5t37.5 90.5zM1664 1408v-1536q0 -52 -38 -90t-90 -38 h-1408q-52 0 -90 38t-38 90v1536q0 52 38 90t90 38h1408q52 0 90 -38t38 -90z" /> +<glyph unicode="" d="M1519 890q18 -84 -4 -204q-87 -444 -565 -444h-44q-25 0 -44 -16.5t-24 -42.5l-4 -19l-55 -346l-2 -15q-5 -26 -24.5 -42.5t-44.5 -16.5h-251q-21 0 -33 15t-9 36q9 56 26.5 168t26.5 168t27 167.5t27 167.5q5 37 43 37h131q133 -2 236 21q175 39 287 144q102 95 155 246 q24 70 35 133q1 6 2.5 7.5t3.5 1t6 -3.5q79 -59 98 -162zM1347 1172q0 -107 -46 -236q-80 -233 -302 -315q-113 -40 -252 -42q0 -1 -90 -1l-90 1q-100 0 -118 -96q-2 -8 -85 -530q-1 -10 -12 -10h-295q-22 0 -36.5 16.5t-11.5 38.5l232 1471q5 29 27.5 48t51.5 19h598 q34 0 97.5 -13t111.5 -32q107 -41 163.5 -123t56.5 -196z" /> +<glyph unicode="" horiz-adv-x="1792" d="M441 864q32 0 52 -26q266 -364 362 -774h-446q-127 441 -367 749q-12 16 -3 33.5t29 17.5h373zM1000 507q-49 -199 -125 -393q-79 310 -256 594q40 221 44 449q211 -340 337 -650zM1099 1216q235 -324 384.5 -698.5t184.5 -773.5h-451q-41 665 -553 1472h435zM1792 640 q0 -424 -101 -812q-67 560 -359 1083q-25 301 -106 584q-4 16 5.5 28.5t25.5 12.5h359q21 0 38.5 -13t22.5 -33q115 -409 115 -850z" /> +<glyph unicode="" horiz-adv-x="2304" d="M1975 546h-138q14 37 66 179l3 9q4 10 10 26t9 26l12 -55zM531 611l-58 295q-11 54 -75 54h-268l-2 -13q311 -79 403 -336zM710 960l-162 -438l-17 89q-26 70 -85 129.5t-131 88.5l135 -510h175l261 641h-176zM849 318h166l104 642h-166zM1617 944q-69 27 -149 27 q-123 0 -201 -59t-79 -153q-1 -102 145 -174q48 -23 67 -41t19 -39q0 -30 -30 -46t-69 -16q-86 0 -156 33l-22 11l-23 -144q74 -34 185 -34q130 -1 208.5 59t80.5 160q0 106 -140 174q-49 25 -71 42t-22 38q0 22 24.5 38.5t70.5 16.5q70 1 124 -24l15 -8zM2042 960h-128 q-65 0 -87 -54l-246 -588h174l35 96h212q5 -22 20 -96h154zM2304 1280v-1280q0 -52 -38 -90t-90 -38h-2048q-52 0 -90 38t-38 90v1280q0 52 38 90t90 38h2048q52 0 90 -38t38 -90z" /> +<glyph unicode="" horiz-adv-x="2304" d="M671 603h-13q-47 0 -47 -32q0 -22 20 -22q17 0 28 15t12 39zM1066 639h62v3q1 4 0.5 6.5t-1 7t-2 8t-4.5 6.5t-7.5 5t-11.5 2q-28 0 -36 -38zM1606 603h-12q-48 0 -48 -32q0 -22 20 -22q17 0 28 15t12 39zM1925 629q0 41 -30 41q-19 0 -31 -20t-12 -51q0 -42 28 -42 q20 0 32.5 20t12.5 52zM480 770h87l-44 -262h-56l32 201l-71 -201h-39l-4 200l-34 -200h-53l44 262h81l2 -163zM733 663q0 -6 -4 -42q-16 -101 -17 -113h-47l1 22q-20 -26 -58 -26q-23 0 -37.5 16t-14.5 42q0 39 26 60.5t73 21.5q14 0 23 -1q0 3 0.5 5.5t1 4.5t0.5 3 q0 20 -36 20q-29 0 -59 -10q0 4 7 48q38 11 67 11q74 0 74 -62zM889 721l-8 -49q-22 3 -41 3q-27 0 -27 -17q0 -8 4.5 -12t21.5 -11q40 -19 40 -60q0 -72 -87 -71q-34 0 -58 6q0 2 7 49q29 -8 51 -8q32 0 32 19q0 7 -4.5 11.5t-21.5 12.5q-43 20 -43 59q0 72 84 72 q30 0 50 -4zM977 721h28l-7 -52h-29q-2 -17 -6.5 -40.5t-7 -38.5t-2.5 -18q0 -16 19 -16q8 0 16 2l-8 -47q-21 -7 -40 -7q-43 0 -45 47q0 12 8 56q3 20 25 146h55zM1180 648q0 -23 -7 -52h-111q-3 -22 10 -33t38 -11q30 0 58 14l-9 -54q-30 -8 -57 -8q-95 0 -95 95 q0 55 27.5 90.5t69.5 35.5q35 0 55.5 -21t20.5 -56zM1319 722q-13 -23 -22 -62q-22 2 -31 -24t-25 -128h-56l3 14q22 130 29 199h51l-3 -33q14 21 25.5 29.5t28.5 4.5zM1506 763l-9 -57q-28 14 -50 14q-31 0 -51 -27.5t-20 -70.5q0 -30 13.5 -47t38.5 -17q21 0 48 13 l-10 -59q-28 -8 -50 -8q-45 0 -71.5 30.5t-26.5 82.5q0 70 35.5 114.5t91.5 44.5q26 0 61 -13zM1668 663q0 -18 -4 -42q-13 -79 -17 -113h-46l1 22q-20 -26 -59 -26q-23 0 -37 16t-14 42q0 39 25.5 60.5t72.5 21.5q15 0 23 -1q2 7 2 13q0 20 -36 20q-29 0 -59 -10q0 4 8 48 q38 11 67 11q73 0 73 -62zM1809 722q-14 -24 -21 -62q-23 2 -31.5 -23t-25.5 -129h-56l3 14q19 104 29 199h52q0 -11 -4 -33q15 21 26.5 29.5t27.5 4.5zM1950 770h56l-43 -262h-53l3 19q-23 -23 -52 -23q-31 0 -49.5 24t-18.5 64q0 53 27.5 92t64.5 39q31 0 53 -29z M2061 640q0 148 -72.5 273t-198 198t-273.5 73q-181 0 -328 -110q127 -116 171 -284h-50q-44 150 -158 253q-114 -103 -158 -253h-50q44 168 171 284q-147 110 -328 110q-148 0 -273.5 -73t-198 -198t-72.5 -273t72.5 -273t198 -198t273.5 -73q181 0 328 110 q-120 111 -165 264h50q46 -138 152 -233q106 95 152 233h50q-45 -153 -165 -264q147 -110 328 -110q148 0 273.5 73t198 198t72.5 273zM2304 1280v-1280q0 -52 -38 -90t-90 -38h-2048q-52 0 -90 38t-38 90v1280q0 52 38 90t90 38h2048q52 0 90 -38t38 -90z" /> +<glyph unicode="" horiz-adv-x="2304" d="M313 759q0 -51 -36 -84q-29 -26 -89 -26h-17v220h17q61 0 89 -27q36 -31 36 -83zM2089 824q0 -52 -64 -52h-19v101h20q63 0 63 -49zM380 759q0 74 -50 120.5t-129 46.5h-95v-333h95q74 0 119 38q60 51 60 128zM410 593h65v333h-65v-333zM730 694q0 40 -20.5 62t-75.5 42 q-29 10 -39.5 19t-10.5 23q0 16 13.5 26.5t34.5 10.5q29 0 53 -27l34 44q-41 37 -98 37q-44 0 -74 -27.5t-30 -67.5q0 -35 18 -55.5t64 -36.5q37 -13 45 -19q19 -12 19 -34q0 -20 -14 -33.5t-36 -13.5q-48 0 -71 44l-42 -40q44 -64 115 -64q51 0 83 30.5t32 79.5zM1008 604 v77q-37 -37 -78 -37q-49 0 -80.5 32.5t-31.5 82.5q0 48 31.5 81.5t77.5 33.5q43 0 81 -38v77q-40 20 -80 20q-74 0 -125.5 -50.5t-51.5 -123.5t51 -123.5t125 -50.5q42 0 81 19zM2240 0v527q-65 -40 -144.5 -84t-237.5 -117t-329.5 -137.5t-417.5 -134.5t-504 -118h1569 q26 0 45 19t19 45zM1389 757q0 75 -53 128t-128 53t-128 -53t-53 -128t53 -128t128 -53t128 53t53 128zM1541 584l144 342h-71l-90 -224l-89 224h-71l142 -342h35zM1714 593h184v56h-119v90h115v56h-115v74h119v57h-184v-333zM2105 593h80l-105 140q76 16 76 94q0 47 -31 73 t-87 26h-97v-333h65v133h9zM2304 1274v-1268q0 -56 -38.5 -95t-93.5 -39h-2040q-55 0 -93.5 39t-38.5 95v1268q0 56 38.5 95t93.5 39h2040q55 0 93.5 -39t38.5 -95z" /> +<glyph unicode="" horiz-adv-x="2304" d="M119 854h89l-45 108zM740 328l74 79l-70 79h-163v-49h142v-55h-142v-54h159zM898 406l99 -110v217zM1186 453q0 33 -40 33h-84v-69h83q41 0 41 36zM1475 457q0 29 -42 29h-82v-61h81q43 0 43 32zM1197 923q0 29 -42 29h-82v-60h81q43 0 43 31zM1656 854h89l-44 108z M699 1009v-271h-66v212l-94 -212h-57l-94 212v-212h-132l-25 60h-135l-25 -60h-70l116 271h96l110 -257v257h106l85 -184l77 184h108zM1255 453q0 -20 -5.5 -35t-14 -25t-22.5 -16.5t-26 -10t-31.5 -4.5t-31.5 -1t-32.5 0.5t-29.5 0.5v-91h-126l-80 90l-83 -90h-256v271h260 l80 -89l82 89h207q109 0 109 -89zM964 794v-56h-217v271h217v-57h-152v-49h148v-55h-148v-54h152zM2304 235v-229q0 -55 -38.5 -94.5t-93.5 -39.5h-2040q-55 0 -93.5 39.5t-38.5 94.5v678h111l25 61h55l25 -61h218v46l19 -46h113l20 47v-47h541v99l10 1q10 0 10 -14v-86h279 v23q23 -12 55 -18t52.5 -6.5t63 0.5t51.5 1l25 61h56l25 -61h227v58l34 -58h182v378h-180v-44l-25 44h-185v-44l-23 44h-249q-69 0 -109 -22v22h-172v-22q-24 22 -73 22h-628l-43 -97l-43 97h-198v-44l-22 44h-169l-78 -179v391q0 55 38.5 94.5t93.5 39.5h2040 q55 0 93.5 -39.5t38.5 -94.5v-678h-120q-51 0 -81 -22v22h-177q-55 0 -78 -22v22h-316v-22q-31 22 -87 22h-209v-22q-23 22 -91 22h-234l-54 -58l-50 58h-349v-378h343l55 59l52 -59h211v89h21q59 0 90 13v-102h174v99h8q8 0 10 -2t2 -10v-87h529q57 0 88 24v-24h168 q60 0 95 17zM1546 469q0 -23 -12 -43t-34 -29q25 -9 34 -26t9 -46v-54h-65v45q0 33 -12 43.5t-46 10.5h-69v-99h-65v271h154q48 0 77 -15t29 -58zM1269 936q0 -24 -12.5 -44t-33.5 -29q26 -9 34.5 -25.5t8.5 -46.5v-53h-65q0 9 0.5 26.5t0 25t-3 18.5t-8.5 16t-17.5 8.5 t-29.5 3.5h-70v-98h-64v271l153 -1q49 0 78 -14.5t29 -57.5zM1798 327v-56h-216v271h216v-56h-151v-49h148v-55h-148v-54zM1372 1009v-271h-66v271h66zM2065 357q0 -86 -102 -86h-126v58h126q34 0 34 25q0 16 -17 21t-41.5 5t-49.5 3.5t-42 22.5t-17 55q0 39 26 60t66 21 h130v-57h-119q-36 0 -36 -25q0 -16 17.5 -20.5t42 -4t49 -2.5t42 -21.5t17.5 -54.5zM2304 407v-101q-24 -35 -88 -35h-125v58h125q33 0 33 25q0 13 -12.5 19t-31 5.5t-40 2t-40 8t-31 24t-12.5 48.5q0 39 26.5 60t66.5 21h129v-57h-118q-36 0 -36 -25q0 -20 29 -22t68.5 -5 t56.5 -26zM2139 1008v-270h-92l-122 203v-203h-132l-26 60h-134l-25 -60h-75q-129 0 -129 133q0 138 133 138h63v-59q-7 0 -28 1t-28.5 0.5t-23 -2t-21.5 -6.5t-14.5 -13.5t-11.5 -23t-3 -33.5q0 -38 13.5 -58t49.5 -20h29l92 213h97l109 -256v256h99l114 -188v188h66z" /> +<glyph unicode="" horiz-adv-x="2304" d="M745 630q0 -37 -25.5 -61.5t-62.5 -24.5q-29 0 -46.5 16t-17.5 44q0 37 25 62.5t62 25.5q28 0 46.5 -16.5t18.5 -45.5zM1530 779q0 -42 -22 -57t-66 -15l-32 -1l17 107q2 11 13 11h18q22 0 35 -2t25 -12.5t12 -30.5zM1881 630q0 -36 -25.5 -61t-61.5 -25q-29 0 -47 16 t-18 44q0 37 25 62.5t62 25.5q28 0 46.5 -16.5t18.5 -45.5zM513 801q0 59 -38.5 85.5t-100.5 26.5h-160q-19 0 -21 -19l-65 -408q-1 -6 3 -11t10 -5h76q20 0 22 19l18 110q1 8 7 13t15 6.5t17 1.5t19 -1t14 -1q86 0 135 48.5t49 134.5zM822 489l41 261q1 6 -3 11t-10 5h-76 q-14 0 -17 -33q-27 40 -95 40q-72 0 -122.5 -54t-50.5 -127q0 -59 34.5 -94t92.5 -35q28 0 58 12t48 32q-4 -12 -4 -21q0 -16 13 -16h69q19 0 22 19zM1269 752q0 5 -4 9.5t-9 4.5h-77q-11 0 -18 -10l-106 -156l-44 150q-5 16 -22 16h-75q-5 0 -9 -4.5t-4 -9.5q0 -2 19.5 -59 t42 -123t23.5 -70q-82 -112 -82 -120q0 -13 13 -13h77q11 0 18 10l255 368q2 2 2 7zM1649 801q0 59 -38.5 85.5t-100.5 26.5h-159q-20 0 -22 -19l-65 -408q-1 -6 3 -11t10 -5h82q12 0 16 13l18 116q1 8 7 13t15 6.5t17 1.5t19 -1t14 -1q86 0 135 48.5t49 134.5zM1958 489 l41 261q1 6 -3 11t-10 5h-76q-14 0 -17 -33q-26 40 -95 40q-72 0 -122.5 -54t-50.5 -127q0 -59 34.5 -94t92.5 -35q29 0 59 12t47 32q0 -1 -2 -9t-2 -12q0 -16 13 -16h69q19 0 22 19zM2176 898v1q0 14 -13 14h-74q-11 0 -13 -11l-65 -416l-1 -2q0 -5 4 -9.5t10 -4.5h66 q19 0 21 19zM392 764q-5 -35 -26 -46t-60 -11l-33 -1l17 107q2 11 13 11h19q40 0 58 -11.5t12 -48.5zM2304 1280v-1280q0 -52 -38 -90t-90 -38h-2048q-52 0 -90 38t-38 90v1280q0 52 38 90t90 38h2048q52 0 90 -38t38 -90z" /> +<glyph unicode="" horiz-adv-x="2304" d="M1597 633q0 -69 -21 -106q-19 -35 -52 -35q-23 0 -41 9v224q29 30 57 30q57 0 57 -122zM2035 669h-110q6 98 56 98q51 0 54 -98zM476 534q0 59 -33 91.5t-101 57.5q-36 13 -52 24t-16 25q0 26 38 26q58 0 124 -33l18 112q-67 32 -149 32q-77 0 -123 -38q-48 -39 -48 -109 q0 -58 32.5 -90.5t99.5 -56.5q39 -14 54.5 -25.5t15.5 -27.5q0 -31 -48 -31q-29 0 -70 12.5t-72 30.5l-18 -113q72 -41 168 -41q81 0 129 37q51 41 51 117zM771 749l19 111h-96v135l-129 -21l-18 -114l-46 -8l-17 -103h62v-219q0 -84 44 -120q38 -30 111 -30q32 0 79 11v118 q-32 -7 -44 -7q-42 0 -42 50v197h77zM1087 724v139q-15 3 -28 3q-32 0 -55.5 -16t-33.5 -46l-10 56h-131v-471h150v306q26 31 82 31q16 0 26 -2zM1124 389h150v471h-150v-471zM1746 638q0 122 -45 179q-40 52 -111 52q-64 0 -117 -56l-8 47h-132v-645l150 25v151 q36 -11 68 -11q83 0 134 56q61 65 61 202zM1278 986q0 33 -23 56t-56 23t-56 -23t-23 -56t23 -56.5t56 -23.5t56 23.5t23 56.5zM2176 629q0 113 -48 176q-50 64 -144 64q-96 0 -151.5 -66t-55.5 -180q0 -128 63 -188q55 -55 161 -55q101 0 160 40l-16 103q-57 -31 -128 -31 q-43 0 -63 19q-23 19 -28 66h248q2 14 2 52zM2304 1280v-1280q0 -52 -38 -90t-90 -38h-2048q-52 0 -90 38t-38 90v1280q0 52 38 90t90 38h2048q52 0 90 -38t38 -90z" /> +<glyph unicode="" horiz-adv-x="2048" d="M1558 684q61 -356 298 -556q0 -52 -38 -90t-90 -38h-448q0 -106 -75 -181t-181 -75t-180.5 74.5t-75.5 180.5zM1024 -176q16 0 16 16t-16 16q-59 0 -101.5 42.5t-42.5 101.5q0 16 -16 16t-16 -16q0 -73 51.5 -124.5t124.5 -51.5zM2026 1424q8 -10 7.5 -23.5t-10.5 -22.5 l-1872 -1622q-10 -8 -23.5 -7t-21.5 11l-84 96q-8 10 -7.5 23.5t10.5 21.5l186 161q-19 32 -19 66q50 42 91 88t85 119.5t74.5 158.5t50 206t19.5 260q0 152 117 282.5t307 158.5q-8 19 -8 39q0 40 28 68t68 28t68 -28t28 -68q0 -20 -8 -39q124 -18 219 -82.5t148 -157.5 l418 363q10 8 23.5 7t21.5 -11z" /> +<glyph unicode="" horiz-adv-x="2048" d="M1040 -160q0 16 -16 16q-59 0 -101.5 42.5t-42.5 101.5q0 16 -16 16t-16 -16q0 -73 51.5 -124.5t124.5 -51.5q16 0 16 16zM503 315l877 760q-42 88 -132.5 146.5t-223.5 58.5q-93 0 -169.5 -31.5t-121.5 -80.5t-69 -103t-24 -105q0 -384 -137 -645zM1856 128 q0 -52 -38 -90t-90 -38h-448q0 -106 -75 -181t-181 -75t-180.5 74.5t-75.5 180.5l149 129h757q-166 187 -227 459l111 97q61 -356 298 -556zM1942 1520l84 -96q8 -10 7.5 -23.5t-10.5 -22.5l-1872 -1622q-10 -8 -23.5 -7t-21.5 11l-84 96q-8 10 -7.5 23.5t10.5 21.5l186 161 q-19 32 -19 66q50 42 91 88t85 119.5t74.5 158.5t50 206t19.5 260q0 152 117 282.5t307 158.5q-8 19 -8 39q0 40 28 68t68 28t68 -28t28 -68q0 -20 -8 -39q124 -18 219 -82.5t148 -157.5l418 363q10 8 23.5 7t21.5 -11z" /> +<glyph unicode="" horiz-adv-x="1408" d="M512 160v704q0 14 -9 23t-23 9h-64q-14 0 -23 -9t-9 -23v-704q0 -14 9 -23t23 -9h64q14 0 23 9t9 23zM768 160v704q0 14 -9 23t-23 9h-64q-14 0 -23 -9t-9 -23v-704q0 -14 9 -23t23 -9h64q14 0 23 9t9 23zM1024 160v704q0 14 -9 23t-23 9h-64q-14 0 -23 -9t-9 -23v-704 q0 -14 9 -23t23 -9h64q14 0 23 9t9 23zM480 1152h448l-48 117q-7 9 -17 11h-317q-10 -2 -17 -11zM1408 1120v-64q0 -14 -9 -23t-23 -9h-96v-948q0 -83 -47 -143.5t-113 -60.5h-832q-66 0 -113 58.5t-47 141.5v952h-96q-14 0 -23 9t-9 23v64q0 14 9 23t23 9h309l70 167 q15 37 54 63t79 26h320q40 0 79 -26t54 -63l70 -167h309q14 0 23 -9t9 -23z" /> +<glyph unicode="" d="M1150 462v-109q0 -50 -36.5 -89t-94 -60.5t-118 -32.5t-117.5 -11q-205 0 -342.5 139t-137.5 346q0 203 136 339t339 136q34 0 75.5 -4.5t93 -18t92.5 -34t69 -56.5t28 -81v-109q0 -16 -16 -16h-118q-16 0 -16 16v70q0 43 -65.5 67.5t-137.5 24.5q-140 0 -228.5 -91.5 t-88.5 -237.5q0 -151 91.5 -249.5t233.5 -98.5q68 0 138 24t70 66v70q0 7 4.5 11.5t10.5 4.5h119q6 0 11 -4.5t5 -11.5zM768 1280q-130 0 -248.5 -51t-204 -136.5t-136.5 -204t-51 -248.5t51 -248.5t136.5 -204t204 -136.5t248.5 -51t248.5 51t204 136.5t136.5 204t51 248.5 t-51 248.5t-136.5 204t-204 136.5t-248.5 51zM1536 640q0 -209 -103 -385.5t-279.5 -279.5t-385.5 -103t-385.5 103t-279.5 279.5t-103 385.5t103 385.5t279.5 279.5t385.5 103t385.5 -103t279.5 -279.5t103 -385.5z" /> +<glyph unicode="" d="M972 761q0 108 -53.5 169t-147.5 61q-63 0 -124 -30.5t-110 -84.5t-79.5 -137t-30.5 -180q0 -112 53.5 -173t150.5 -61q96 0 176 66.5t122.5 166t42.5 203.5zM1536 640q0 -111 -37 -197t-98.5 -135t-131.5 -74.5t-145 -27.5q-6 0 -15.5 -0.5t-16.5 -0.5q-95 0 -142 53 q-28 33 -33 83q-52 -66 -131.5 -110t-173.5 -44q-161 0 -249.5 95.5t-88.5 269.5q0 157 66 290t179 210.5t246 77.5q87 0 155 -35.5t106 -99.5l2 19l11 56q1 6 5.5 12t9.5 6h118q5 0 13 -11q5 -5 3 -16l-120 -614q-5 -24 -5 -48q0 -39 12.5 -52t44.5 -13q28 1 57 5.5t73 24 t77 50t57 89.5t24 137q0 292 -174 466t-466 174q-130 0 -248.5 -51t-204 -136.5t-136.5 -204t-51 -248.5t51 -248.5t136.5 -204t204 -136.5t248.5 -51q228 0 405 144q11 9 24 8t21 -12l41 -49q8 -12 7 -24q-2 -13 -12 -22q-102 -83 -227.5 -128t-258.5 -45q-156 0 -298 61 t-245 164t-164 245t-61 298t61 298t164 245t245 164t298 61q344 0 556 -212t212 -556z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1698 1442q94 -94 94 -226.5t-94 -225.5l-225 -223l104 -104q10 -10 10 -23t-10 -23l-210 -210q-10 -10 -23 -10t-23 10l-105 105l-603 -603q-37 -37 -90 -37h-203l-256 -128l-64 64l128 256v203q0 53 37 90l603 603l-105 105q-10 10 -10 23t10 23l210 210q10 10 23 10 t23 -10l104 -104l223 225q93 94 225.5 94t226.5 -94zM512 64l576 576l-192 192l-576 -576v-192h192z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1615 1536q70 0 122.5 -46.5t52.5 -116.5q0 -63 -45 -151q-332 -629 -465 -752q-97 -91 -218 -91q-126 0 -216.5 92.5t-90.5 219.5q0 128 92 212l638 579q59 54 130 54zM706 502q39 -76 106.5 -130t150.5 -76l1 -71q4 -213 -129.5 -347t-348.5 -134q-123 0 -218 46.5 t-152.5 127.5t-86.5 183t-29 220q7 -5 41 -30t62 -44.5t59 -36.5t46 -17q41 0 55 37q25 66 57.5 112.5t69.5 76t88 47.5t103 25.5t125 10.5z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1792 128v-384h-1792v384q45 0 85 14t59 27.5t47 37.5q30 27 51.5 38t56.5 11t55.5 -11t52.5 -38q29 -25 47 -38t58 -27t86 -14q45 0 85 14.5t58 27t48 37.5q21 19 32.5 27t31 15t43.5 7q35 0 56.5 -11t51.5 -38q28 -24 47 -37.5t59 -27.5t85 -14t85 14t59 27.5t47 37.5 q30 27 51.5 38t56.5 11q34 0 55.5 -11t51.5 -38q28 -24 47 -37.5t59 -27.5t85 -14zM1792 448v-192q-35 0 -55.5 11t-52.5 38q-29 25 -47 38t-58 27t-85 14q-46 0 -86 -14t-58 -27t-47 -38q-22 -19 -33 -27t-31 -15t-44 -7q-35 0 -56.5 11t-51.5 38q-29 25 -47 38t-58 27 t-86 14q-45 0 -85 -14.5t-58 -27t-48 -37.5q-21 -19 -32.5 -27t-31 -15t-43.5 -7q-35 0 -56.5 11t-51.5 38q-28 24 -47 37.5t-59 27.5t-85 14q-46 0 -86 -14t-58 -27t-47 -38q-30 -27 -51.5 -38t-56.5 -11v192q0 80 56 136t136 56h64v448h256v-448h256v448h256v-448h256v448 h256v-448h64q80 0 136 -56t56 -136zM512 1312q0 -77 -36 -118.5t-92 -41.5q-53 0 -90.5 37.5t-37.5 90.5q0 29 9.5 51t23.5 34t31 28t31 31.5t23.5 44.5t9.5 67q38 0 83 -74t45 -150zM1024 1312q0 -77 -36 -118.5t-92 -41.5q-53 0 -90.5 37.5t-37.5 90.5q0 29 9.5 51 t23.5 34t31 28t31 31.5t23.5 44.5t9.5 67q38 0 83 -74t45 -150zM1536 1312q0 -77 -36 -118.5t-92 -41.5q-53 0 -90.5 37.5t-37.5 90.5q0 29 9.5 51t23.5 34t31 28t31 31.5t23.5 44.5t9.5 67q38 0 83 -74t45 -150z" /> +<glyph unicode="" horiz-adv-x="2048" d="M2048 0v-128h-2048v1536h128v-1408h1920zM1664 1024l256 -896h-1664v576l448 576l576 -576z" /> +<glyph unicode="" horiz-adv-x="1792" d="M768 646l546 -546q-106 -108 -247.5 -168t-298.5 -60q-209 0 -385.5 103t-279.5 279.5t-103 385.5t103 385.5t279.5 279.5t385.5 103v-762zM955 640h773q0 -157 -60 -298.5t-168 -247.5zM1664 768h-768v768q209 0 385.5 -103t279.5 -279.5t103 -385.5z" /> +<glyph unicode="" horiz-adv-x="2048" d="M2048 0v-128h-2048v1536h128v-1408h1920zM1920 1248v-435q0 -21 -19.5 -29.5t-35.5 7.5l-121 121l-633 -633q-10 -10 -23 -10t-23 10l-233 233l-416 -416l-192 192l585 585q10 10 23 10t23 -10l233 -233l464 464l-121 121q-16 16 -7.5 35.5t29.5 19.5h435q14 0 23 -9 t9 -23z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1292 832q0 -6 10 -41q10 -29 25 -49.5t41 -34t44 -20t55 -16.5q325 -91 325 -332q0 -146 -105.5 -242.5t-254.5 -96.5q-59 0 -111.5 18.5t-91.5 45.5t-77 74.5t-63 87.5t-53.5 103.5t-43.5 103t-39.5 106.5t-35.5 95q-32 81 -61.5 133.5t-73.5 96.5t-104 64t-142 20 q-96 0 -183 -55.5t-138 -144.5t-51 -185q0 -160 106.5 -279.5t263.5 -119.5q177 0 258 95q56 63 83 116l84 -152q-15 -34 -44 -70l1 -1q-131 -152 -388 -152q-147 0 -269.5 79t-190.5 207.5t-68 274.5q0 105 43.5 206t116 176.5t172 121.5t204.5 46q87 0 159 -19t123.5 -50 t95 -80t72.5 -99t58.5 -117t50.5 -124.5t50 -130.5t55 -127q96 -200 233 -200q81 0 138.5 48.5t57.5 128.5q0 42 -19 72t-50.5 46t-72.5 31.5t-84.5 27t-87.5 34t-81 52t-65 82t-39 122.5q-3 16 -3 33q0 110 87.5 192t198.5 78q78 -3 120.5 -14.5t90.5 -53.5h-1 q12 -11 23 -24.5t26 -36t19 -27.5l-129 -99q-26 49 -54 70v1q-23 21 -97 21q-49 0 -84 -33t-35 -83z" /> +<glyph unicode="" d="M1432 484q0 173 -234 239q-35 10 -53 16.5t-38 25t-29 46.5q0 2 -2 8.5t-3 12t-1 7.5q0 36 24.5 59.5t60.5 23.5q54 0 71 -15h-1q20 -15 39 -51l93 71q-39 54 -49 64q-33 29 -67.5 39t-85.5 10q-80 0 -142 -57.5t-62 -137.5q0 -7 2 -23q16 -96 64.5 -140t148.5 -73 q29 -8 49 -15.5t45 -21.5t38.5 -34.5t13.5 -46.5v-5q1 -58 -40.5 -93t-100.5 -35q-97 0 -167 144q-23 47 -51.5 121.5t-48 125.5t-54 110.5t-74 95.5t-103.5 60.5t-147 24.5q-101 0 -192 -56t-144 -148t-50 -192v-1q4 -108 50.5 -199t133.5 -147.5t196 -56.5q186 0 279 110 q20 27 31 51l-60 109q-42 -80 -99 -116t-146 -36q-115 0 -191 87t-76 204q0 105 82 189t186 84q112 0 170 -53.5t104 -172.5q8 -21 25.5 -68.5t28.5 -76.5t31.5 -74.5t38.5 -74t45.5 -62.5t55.5 -53.5t66 -33t80 -13.5q107 0 183 69.5t76 174.5zM1536 1120v-960 q0 -119 -84.5 -203.5t-203.5 -84.5h-960q-119 0 -203.5 84.5t-84.5 203.5v960q0 119 84.5 203.5t203.5 84.5h960q119 0 203.5 -84.5t84.5 -203.5z" /> +<glyph unicode="" horiz-adv-x="2048" d="M1152 640q0 104 -40.5 198.5t-109.5 163.5t-163.5 109.5t-198.5 40.5t-198.5 -40.5t-163.5 -109.5t-109.5 -163.5t-40.5 -198.5t40.5 -198.5t109.5 -163.5t163.5 -109.5t198.5 -40.5t198.5 40.5t163.5 109.5t109.5 163.5t40.5 198.5zM1920 640q0 104 -40.5 198.5 t-109.5 163.5t-163.5 109.5t-198.5 40.5h-386q119 -90 188.5 -224t69.5 -288t-69.5 -288t-188.5 -224h386q104 0 198.5 40.5t163.5 109.5t109.5 163.5t40.5 198.5zM2048 640q0 -130 -51 -248.5t-136.5 -204t-204 -136.5t-248.5 -51h-768q-130 0 -248.5 51t-204 136.5 t-136.5 204t-51 248.5t51 248.5t136.5 204t204 136.5t248.5 51h768q130 0 248.5 -51t204 -136.5t136.5 -204t51 -248.5z" /> +<glyph unicode="" horiz-adv-x="2048" d="M0 640q0 130 51 248.5t136.5 204t204 136.5t248.5 51h768q130 0 248.5 -51t204 -136.5t136.5 -204t51 -248.5t-51 -248.5t-136.5 -204t-204 -136.5t-248.5 -51h-768q-130 0 -248.5 51t-204 136.5t-136.5 204t-51 248.5zM1408 128q104 0 198.5 40.5t163.5 109.5 t109.5 163.5t40.5 198.5t-40.5 198.5t-109.5 163.5t-163.5 109.5t-198.5 40.5t-198.5 -40.5t-163.5 -109.5t-109.5 -163.5t-40.5 -198.5t40.5 -198.5t109.5 -163.5t163.5 -109.5t198.5 -40.5z" /> +<glyph unicode="" horiz-adv-x="2304" d="M762 384h-314q-40 0 -57.5 35t6.5 67l188 251q-65 31 -137 31q-132 0 -226 -94t-94 -226t94 -226t226 -94q115 0 203 72.5t111 183.5zM576 512h186q-18 85 -75 148zM1056 512l288 384h-480l-99 -132q105 -103 126 -252h165zM2176 448q0 132 -94 226t-226 94 q-60 0 -121 -24l174 -260q15 -23 10 -49t-27 -40q-15 -11 -36 -11q-35 0 -53 29l-174 260q-93 -95 -93 -225q0 -132 94 -226t226 -94t226 94t94 226zM2304 448q0 -185 -131.5 -316.5t-316.5 -131.5t-316.5 131.5t-131.5 316.5q0 97 39.5 183.5t109.5 149.5l-65 98l-353 -469 q-18 -26 -51 -26h-197q-23 -164 -149 -274t-294 -110q-185 0 -316.5 131.5t-131.5 316.5t131.5 316.5t316.5 131.5q114 0 215 -55l137 183h-224q-26 0 -45 19t-19 45t19 45t45 19h384v-128h435l-85 128h-222q-26 0 -45 19t-19 45t19 45t45 19h256q33 0 53 -28l267 -400 q91 44 192 44q185 0 316.5 -131.5t131.5 -316.5z" /> +<glyph unicode="" d="M384 320q0 53 -37.5 90.5t-90.5 37.5t-90.5 -37.5t-37.5 -90.5t37.5 -90.5t90.5 -37.5t90.5 37.5t37.5 90.5zM1408 320q0 53 -37.5 90.5t-90.5 37.5t-90.5 -37.5t-37.5 -90.5t37.5 -90.5t90.5 -37.5t90.5 37.5t37.5 90.5zM1362 716l-72 384q-5 23 -22.5 37.5t-40.5 14.5 h-918q-23 0 -40.5 -14.5t-22.5 -37.5l-72 -384q-5 -30 14 -53t49 -23h1062q30 0 49 23t14 53zM1136 1328q0 20 -14 34t-34 14h-640q-20 0 -34 -14t-14 -34t14 -34t34 -14h640q20 0 34 14t14 34zM1536 603v-603h-128v-128q0 -53 -37.5 -90.5t-90.5 -37.5t-90.5 37.5 t-37.5 90.5v128h-768v-128q0 -53 -37.5 -90.5t-90.5 -37.5t-90.5 37.5t-37.5 90.5v128h-128v603q0 112 25 223l103 454q9 78 97.5 137t230 89t312.5 30t312.5 -30t230 -89t97.5 -137l105 -454q23 -102 23 -223z" /> +<glyph unicode="" horiz-adv-x="2048" d="M1463 704q0 -35 -25 -60.5t-61 -25.5h-702q-36 0 -61 25.5t-25 60.5t25 60.5t61 25.5h702q36 0 61 -25.5t25 -60.5zM1677 704q0 86 -23 170h-982q-36 0 -61 25t-25 60q0 36 25 61t61 25h908q-88 143 -235 227t-320 84q-177 0 -327.5 -87.5t-238 -237.5t-87.5 -327 q0 -86 23 -170h982q36 0 61 -25t25 -60q0 -36 -25 -61t-61 -25h-908q88 -143 235.5 -227t320.5 -84q132 0 253 51.5t208 139t139 208t52 253.5zM2048 959q0 -35 -25 -60t-61 -25h-131q17 -85 17 -170q0 -167 -65.5 -319.5t-175.5 -263t-262.5 -176t-319.5 -65.5 q-246 0 -448.5 133t-301.5 350h-189q-36 0 -61 25t-25 61q0 35 25 60t61 25h132q-17 85 -17 170q0 167 65.5 319.5t175.5 263t262.5 176t320.5 65.5q245 0 447.5 -133t301.5 -350h188q36 0 61 -25t25 -61z" /> +<glyph unicode="" horiz-adv-x="1280" d="M953 1158l-114 -328l117 -21q165 451 165 518q0 56 -38 56q-57 0 -130 -225zM654 471l33 -88q37 42 71 67l-33 5.5t-38.5 7t-32.5 8.5zM362 1367q0 -98 159 -521q18 10 49 10q15 0 75 -5l-121 351q-75 220 -123 220q-19 0 -29 -17.5t-10 -37.5zM283 608q0 -36 51.5 -119 t117.5 -153t100 -70q14 0 25.5 13t11.5 27q0 24 -32 102q-13 32 -32 72t-47.5 89t-61.5 81t-62 32q-20 0 -45.5 -27t-25.5 -47zM125 273q0 -41 25 -104q59 -145 183.5 -227t281.5 -82q227 0 382 170q152 169 152 427q0 43 -1 67t-11.5 62t-30.5 56q-56 49 -211.5 75.5 t-270.5 26.5q-37 0 -49 -11q-12 -5 -12 -35q0 -34 21.5 -60t55.5 -40t77.5 -23.5t87.5 -11.5t85 -4t70 0h23q24 0 40 -19q15 -19 19 -55q-28 -28 -96 -54q-61 -22 -93 -46q-64 -46 -108.5 -114t-44.5 -137q0 -31 18.5 -88.5t18.5 -87.5l-3 -12q-4 -12 -4 -14 q-137 10 -146 216q-8 -2 -41 -2q2 -7 2 -21q0 -53 -40.5 -89.5t-94.5 -36.5q-82 0 -166.5 78t-84.5 159q0 34 33 67q52 -64 60 -76q77 -104 133 -104q12 0 26.5 8.5t14.5 20.5q0 34 -87.5 145t-116.5 111q-43 0 -70 -44.5t-27 -90.5zM11 264q0 101 42.5 163t136.5 88 q-28 74 -28 104q0 62 61 123t122 61q29 0 70 -15q-163 462 -163 567q0 80 41 130.5t119 50.5q131 0 325 -581q6 -17 8 -23q6 16 29 79.5t43.5 118.5t54 127.5t64.5 123t70.5 86.5t76.5 36q71 0 112 -49t41 -122q0 -108 -159 -550q61 -15 100.5 -46t58.5 -78t26 -93.5 t7 -110.5q0 -150 -47 -280t-132 -225t-211 -150t-278 -55q-111 0 -223 42q-149 57 -258 191.5t-109 286.5z" /> +<glyph unicode="" horiz-adv-x="2048" d="M785 528h207q-14 -158 -98.5 -248.5t-214.5 -90.5q-162 0 -254.5 116t-92.5 316q0 194 93 311.5t233 117.5q148 0 232 -87t97 -247h-203q-5 64 -35.5 99t-81.5 35q-57 0 -88.5 -60.5t-31.5 -177.5q0 -48 5 -84t18 -69.5t40 -51.5t66 -18q95 0 109 139zM1497 528h206 q-14 -158 -98 -248.5t-214 -90.5q-162 0 -254.5 116t-92.5 316q0 194 93 311.5t233 117.5q148 0 232 -87t97 -247h-204q-4 64 -35 99t-81 35q-57 0 -88.5 -60.5t-31.5 -177.5q0 -48 5 -84t18 -69.5t39.5 -51.5t65.5 -18q49 0 76.5 38t33.5 101zM1856 647q0 207 -15.5 307 t-60.5 161q-6 8 -13.5 14t-21.5 15t-16 11q-86 63 -697 63q-625 0 -710 -63q-5 -4 -17.5 -11.5t-21 -14t-14.5 -14.5q-45 -60 -60 -159.5t-15 -308.5q0 -208 15 -307.5t60 -160.5q6 -8 15 -15t20.5 -14t17.5 -12q44 -33 239.5 -49t470.5 -16q610 0 697 65q5 4 17 11t20.5 14 t13.5 16q46 60 61 159t15 309zM2048 1408v-1536h-2048v1536h2048z" /> +<glyph unicode="" d="M992 912v-496q0 -14 -9 -23t-23 -9h-160q-14 0 -23 9t-9 23v496q0 112 -80 192t-192 80h-272v-1152q0 -14 -9 -23t-23 -9h-160q-14 0 -23 9t-9 23v1344q0 14 9 23t23 9h464q135 0 249 -66.5t180.5 -180.5t66.5 -249zM1376 1376v-880q0 -135 -66.5 -249t-180.5 -180.5 t-249 -66.5h-464q-14 0 -23 9t-9 23v960q0 14 9 23t23 9h160q14 0 23 -9t9 -23v-768h272q112 0 192 80t80 192v880q0 14 9 23t23 9h160q14 0 23 -9t9 -23z" /> +<glyph unicode="" d="M1311 694v-114q0 -24 -13.5 -38t-37.5 -14h-202q-24 0 -38 14t-14 38v114q0 24 14 38t38 14h202q24 0 37.5 -14t13.5 -38zM821 464v250q0 53 -32.5 85.5t-85.5 32.5h-133q-68 0 -96 -52q-28 52 -96 52h-130q-53 0 -85.5 -32.5t-32.5 -85.5v-250q0 -22 21 -22h55 q22 0 22 22v230q0 24 13.5 38t38.5 14h94q24 0 38 -14t14 -38v-230q0 -22 21 -22h54q22 0 22 22v230q0 24 14 38t38 14h97q24 0 37.5 -14t13.5 -38v-230q0 -22 22 -22h55q21 0 21 22zM1410 560v154q0 53 -33 85.5t-86 32.5h-264q-53 0 -86 -32.5t-33 -85.5v-410 q0 -21 22 -21h55q21 0 21 21v180q31 -42 94 -42h191q53 0 86 32.5t33 85.5zM1536 1176v-1072q0 -96 -68 -164t-164 -68h-1072q-96 0 -164 68t-68 164v1072q0 96 68 164t164 68h1072q96 0 164 -68t68 -164z" /> +<glyph unicode="" d="M915 450h-294l147 551zM1001 128h311l-324 1024h-440l-324 -1024h311l383 314zM1536 1120v-960q0 -118 -85 -203t-203 -85h-960q-118 0 -203 85t-85 203v960q0 118 85 203t203 85h960q118 0 203 -85t85 -203z" /> +<glyph unicode="" horiz-adv-x="2048" d="M2048 641q0 -21 -13 -36.5t-33 -19.5l-205 -356q3 -9 3 -18q0 -20 -12.5 -35.5t-32.5 -19.5l-193 -337q3 -8 3 -16q0 -23 -16.5 -40t-40.5 -17q-25 0 -41 18h-400q-17 -20 -43 -20t-43 20h-399q-17 -20 -43 -20q-23 0 -40 16.5t-17 40.5q0 8 4 20l-193 335 q-20 4 -32.5 19.5t-12.5 35.5q0 9 3 18l-206 356q-20 5 -32.5 20.5t-12.5 35.5q0 21 13.5 36.5t33.5 19.5l199 344q0 1 -0.5 3t-0.5 3q0 36 34 51l209 363q-4 10 -4 18q0 24 17 40.5t40 16.5q26 0 44 -21h396q16 21 43 21t43 -21h398q18 21 44 21q23 0 40 -16.5t17 -40.5 q0 -6 -4 -18l207 -358q23 -1 39 -17.5t16 -38.5q0 -13 -7 -27l187 -324q19 -4 31.5 -19.5t12.5 -35.5zM1063 -158h389l-342 354h-143l-342 -354h360q18 16 39 16t39 -16zM112 654q1 -4 1 -13q0 -10 -2 -15l208 -360q2 0 4.5 -1t5.5 -2.5l5 -2.5l188 199v347l-187 194 q-13 -8 -29 -10zM986 1438h-388l190 -200l554 200h-280q-16 -16 -38 -16t-38 16zM1689 226q1 6 5 11l-64 68l-17 -79h76zM1583 226l22 105l-252 266l-296 -307l63 -64h463zM1495 -142l16 28l65 310h-427l333 -343q8 4 13 5zM578 -158h5l342 354h-373v-335l4 -6q14 -5 22 -13 zM552 226h402l64 66l-309 321l-157 -166v-221zM359 226h163v189l-168 -177q4 -8 5 -12zM358 1051q0 -1 0.5 -2t0.5 -2q0 -16 -8 -29l171 -177v269zM552 1121v-311l153 -157l297 314l-223 236zM556 1425l-4 -8v-264l205 74l-191 201q-6 -2 -10 -3zM1447 1438h-16l-621 -224 l213 -225zM1023 946l-297 -315l311 -319l296 307zM688 634l-136 141v-284zM1038 270l-42 -44h85zM1374 618l238 -251l132 624l-3 5l-1 1zM1718 1018q-8 13 -8 29v2l-216 376q-5 1 -13 5l-437 -463l310 -327zM522 1142v223l-163 -282zM522 196h-163l163 -283v283zM1607 196 l-48 -227l130 227h-82zM1729 266l207 361q-2 10 -2 14q0 1 3 16l-171 296l-129 -612l77 -82q5 3 15 7z" /> +<glyph unicode="" d="M0 856q0 131 91.5 226.5t222.5 95.5h742l352 358v-1470q0 -132 -91.5 -227t-222.5 -95h-780q-131 0 -222.5 95t-91.5 227v790zM1232 102l-176 180v425q0 46 -32 79t-78 33h-484q-46 0 -78 -33t-32 -79v-492q0 -46 32.5 -79.5t77.5 -33.5h770z" /> +<glyph unicode="" d="M934 1386q-317 -121 -556 -362.5t-358 -560.5q-20 89 -20 176q0 208 102.5 384.5t278.5 279t384 102.5q82 0 169 -19zM1203 1267q93 -65 164 -155q-389 -113 -674.5 -400.5t-396.5 -676.5q-93 72 -155 162q112 386 395 671t667 399zM470 -67q115 356 379.5 622t619.5 384 q40 -92 54 -195q-292 -120 -516 -345t-343 -518q-103 14 -194 52zM1536 -125q-193 50 -367 115q-135 -84 -290 -107q109 205 274 370.5t369 275.5q-21 -152 -101 -284q65 -175 115 -370z" /> +<glyph unicode="" horiz-adv-x="2048" d="M1893 1144l155 -1272q-131 0 -257 57q-200 91 -393 91q-226 0 -374 -148q-148 148 -374 148q-193 0 -393 -91q-128 -57 -252 -57h-5l155 1272q224 127 482 127q233 0 387 -106q154 106 387 106q258 0 482 -127zM1398 157q129 0 232 -28.5t260 -93.5l-124 1021 q-171 78 -368 78q-224 0 -374 -141q-150 141 -374 141q-197 0 -368 -78l-124 -1021q105 43 165.5 65t148.5 39.5t178 17.5q202 0 374 -108q172 108 374 108zM1438 191l-55 907q-211 -4 -359 -155q-152 155 -374 155q-176 0 -336 -66l-114 -941q124 51 228.5 76t221.5 25 q209 0 374 -102q172 107 374 102z" /> +<glyph unicode="" horiz-adv-x="2048" d="M1500 165v733q0 21 -15 36t-35 15h-93q-20 0 -35 -15t-15 -36v-733q0 -20 15 -35t35 -15h93q20 0 35 15t15 35zM1216 165v531q0 20 -15 35t-35 15h-101q-20 0 -35 -15t-15 -35v-531q0 -20 15 -35t35 -15h101q20 0 35 15t15 35zM924 165v429q0 20 -15 35t-35 15h-101 q-20 0 -35 -15t-15 -35v-429q0 -20 15 -35t35 -15h101q20 0 35 15t15 35zM632 165v362q0 20 -15 35t-35 15h-101q-20 0 -35 -15t-15 -35v-362q0 -20 15 -35t35 -15h101q20 0 35 15t15 35zM2048 311q0 -166 -118 -284t-284 -118h-1244q-166 0 -284 118t-118 284 q0 116 63 214.5t168 148.5q-10 34 -10 73q0 113 80.5 193.5t193.5 80.5q102 0 180 -67q45 183 194 300t338 117q149 0 275 -73.5t199.5 -199.5t73.5 -275q0 -66 -14 -122q135 -33 221 -142.5t86 -247.5z" /> +<glyph unicode="" d="M0 1536h1536v-1392l-776 -338l-760 338v1392zM1436 209v926h-1336v-926l661 -294zM1436 1235v201h-1336v-201h1336zM181 937v-115h-37v115h37zM181 789v-115h-37v115h37zM181 641v-115h-37v115h37zM181 493v-115h-37v115h37zM181 345v-115h-37v115h37zM207 202l15 34 l105 -47l-15 -33zM343 142l15 34l105 -46l-15 -34zM478 82l15 34l105 -46l-15 -34zM614 23l15 33l104 -46l-15 -34zM797 10l105 46l15 -33l-105 -47zM932 70l105 46l15 -34l-105 -46zM1068 130l105 46l15 -34l-105 -46zM1203 189l105 47l15 -34l-105 -46zM259 1389v-36h-114 v36h114zM421 1389v-36h-115v36h115zM583 1389v-36h-115v36h115zM744 1389v-36h-114v36h114zM906 1389v-36h-114v36h114zM1068 1389v-36h-115v36h115zM1230 1389v-36h-115v36h115zM1391 1389v-36h-114v36h114zM181 1049v-79h-37v115h115v-36h-78zM421 1085v-36h-115v36h115z M583 1085v-36h-115v36h115zM744 1085v-36h-114v36h114zM906 1085v-36h-114v36h114zM1068 1085v-36h-115v36h115zM1230 1085v-36h-115v36h115zM1355 970v79h-78v36h115v-115h-37zM1355 822v115h37v-115h-37zM1355 674v115h37v-115h-37zM1355 526v115h37v-115h-37zM1355 378 v115h37v-115h-37zM1355 230v115h37v-115h-37zM760 265q-129 0 -221 91.5t-92 221.5q0 129 92 221t221 92q130 0 221.5 -92t91.5 -221q0 -130 -91.5 -221.5t-221.5 -91.5zM595 646q0 -36 19.5 -56.5t49.5 -25t64 -7t64 -2t49.5 -9t19.5 -30.5q0 -49 -112 -49q-97 0 -123 51 h-3l-31 -63q67 -42 162 -42q29 0 56.5 5t55.5 16t45.5 33t17.5 53q0 46 -27.5 69.5t-67.5 27t-79.5 3t-67 5t-27.5 25.5q0 21 20.5 33t40.5 15t41 3q34 0 70.5 -11t51.5 -34h3l30 58q-3 1 -21 8.5t-22.5 9t-19.5 7t-22 7t-20 4.5t-24 4t-23 1q-29 0 -56.5 -5t-54 -16.5 t-43 -34t-16.5 -53.5z" /> +<glyph unicode="" horiz-adv-x="2048" d="M863 504q0 112 -79.5 191.5t-191.5 79.5t-191 -79.5t-79 -191.5t79 -191t191 -79t191.5 79t79.5 191zM1726 505q0 112 -79 191t-191 79t-191.5 -79t-79.5 -191q0 -113 79.5 -192t191.5 -79t191 79.5t79 191.5zM2048 1314v-1348q0 -44 -31.5 -75.5t-76.5 -31.5h-1832 q-45 0 -76.5 31.5t-31.5 75.5v1348q0 44 31.5 75.5t76.5 31.5h431q44 0 76 -31.5t32 -75.5v-161h754v161q0 44 32 75.5t76 31.5h431q45 0 76.5 -31.5t31.5 -75.5z" /> +<glyph unicode="" horiz-adv-x="2048" d="M1430 953zM1690 749q148 0 253 -98.5t105 -244.5q0 -157 -109 -261.5t-267 -104.5q-85 0 -162 27.5t-138 73.5t-118 106t-109 126.5t-103.5 132.5t-108.5 126t-117 106t-136 73.5t-159 27.5q-154 0 -251.5 -91.5t-97.5 -244.5q0 -157 104 -250t263 -93q100 0 208 37.5 t193 98.5q5 4 21 18.5t30 24t22 9.5q14 0 24.5 -10.5t10.5 -24.5q0 -24 -60 -77q-101 -88 -234.5 -142t-260.5 -54q-133 0 -245.5 58t-180 165t-67.5 241q0 205 141.5 341t347.5 136q120 0 226.5 -43.5t185.5 -113t151.5 -153t139 -167.5t133.5 -153.5t149.5 -113 t172.5 -43.5q102 0 168.5 61.5t66.5 162.5q0 95 -64.5 159t-159.5 64q-30 0 -81.5 -18.5t-68.5 -18.5q-20 0 -35.5 15t-15.5 35q0 18 8.5 57t8.5 59q0 159 -107.5 263t-266.5 104q-58 0 -111.5 -18.5t-84 -40.5t-55.5 -40.5t-33 -18.5q-15 0 -25.5 10.5t-10.5 25.5 q0 19 25 46q59 67 147 103.5t182 36.5q191 0 318 -125.5t127 -315.5q0 -37 -4 -66q57 15 115 15z" /> +<glyph unicode="" horiz-adv-x="1664" d="M1216 832q0 26 -19 45t-45 19h-128v128q0 26 -19 45t-45 19t-45 -19t-19 -45v-128h-128q-26 0 -45 -19t-19 -45t19 -45t45 -19h128v-128q0 -26 19 -45t45 -19t45 19t19 45v128h128q26 0 45 19t19 45zM640 0q0 -53 -37.5 -90.5t-90.5 -37.5t-90.5 37.5t-37.5 90.5 t37.5 90.5t90.5 37.5t90.5 -37.5t37.5 -90.5zM1536 0q0 -53 -37.5 -90.5t-90.5 -37.5t-90.5 37.5t-37.5 90.5t37.5 90.5t90.5 37.5t90.5 -37.5t37.5 -90.5zM1664 1088v-512q0 -24 -16 -42.5t-41 -21.5l-1044 -122q1 -7 4.5 -21.5t6 -26.5t2.5 -22q0 -16 -24 -64h920 q26 0 45 -19t19 -45t-19 -45t-45 -19h-1024q-26 0 -45 19t-19 45q0 14 11 39.5t29.5 59.5t20.5 38l-177 823h-204q-26 0 -45 19t-19 45t19 45t45 19h256q16 0 28.5 -6.5t20 -15.5t13 -24.5t7.5 -26.5t5.5 -29.5t4.5 -25.5h1201q26 0 45 -19t19 -45z" /> +<glyph unicode="" horiz-adv-x="1664" d="M1280 832q0 26 -19 45t-45 19t-45 -19l-147 -146v293q0 26 -19 45t-45 19t-45 -19t-19 -45v-293l-147 146q-19 19 -45 19t-45 -19t-19 -45t19 -45l256 -256q19 -19 45 -19t45 19l256 256q19 19 19 45zM640 0q0 -53 -37.5 -90.5t-90.5 -37.5t-90.5 37.5t-37.5 90.5 t37.5 90.5t90.5 37.5t90.5 -37.5t37.5 -90.5zM1536 0q0 -53 -37.5 -90.5t-90.5 -37.5t-90.5 37.5t-37.5 90.5t37.5 90.5t90.5 37.5t90.5 -37.5t37.5 -90.5zM1664 1088v-512q0 -24 -16 -42.5t-41 -21.5l-1044 -122q1 -7 4.5 -21.5t6 -26.5t2.5 -22q0 -16 -24 -64h920 q26 0 45 -19t19 -45t-19 -45t-45 -19h-1024q-26 0 -45 19t-19 45q0 14 11 39.5t29.5 59.5t20.5 38l-177 823h-204q-26 0 -45 19t-19 45t19 45t45 19h256q16 0 28.5 -6.5t20 -15.5t13 -24.5t7.5 -26.5t5.5 -29.5t4.5 -25.5h1201q26 0 45 -19t19 -45z" /> +<glyph unicode="" horiz-adv-x="2048" d="M212 768l623 -665l-300 665h-323zM1024 -4l349 772h-698zM538 896l204 384h-262l-288 -384h346zM1213 103l623 665h-323zM683 896h682l-204 384h-274zM1510 896h346l-288 384h-262zM1651 1382l384 -512q14 -18 13 -41.5t-17 -40.5l-960 -1024q-18 -20 -47 -20t-47 20 l-960 1024q-16 17 -17 40.5t13 41.5l384 512q18 26 51 26h1152q33 0 51 -26z" /> +<glyph unicode="" horiz-adv-x="2048" d="M1811 -19q19 19 45 19t45 -19l128 -128l-90 -90l-83 83l-83 -83q-18 -19 -45 -19t-45 19l-83 83l-83 -83q-19 -19 -45 -19t-45 19l-83 83l-83 -83q-19 -19 -45 -19t-45 19l-83 83l-83 -83q-19 -19 -45 -19t-45 19l-83 83l-83 -83q-19 -19 -45 -19t-45 19l-83 83l-83 -83 q-19 -19 -45 -19t-45 19l-83 83l-83 -83q-19 -19 -45 -19t-45 19l-128 128l90 90l83 -83l83 83q19 19 45 19t45 -19l83 -83l83 83q19 19 45 19t45 -19l83 -83l83 83q19 19 45 19t45 -19l83 -83l83 83q19 19 45 19t45 -19l83 -83l83 83q19 19 45 19t45 -19l83 -83l83 83 q19 19 45 19t45 -19l83 -83zM237 19q-19 -19 -45 -19t-45 19l-128 128l90 90l83 -82l83 82q19 19 45 19t45 -19l83 -82l64 64v293l-210 314q-17 26 -7 56.5t40 40.5l177 58v299h128v128h256v128h256v-128h256v-128h128v-299l177 -58q30 -10 40 -40.5t-7 -56.5l-210 -314 v-293l19 18q19 19 45 19t45 -19l83 -82l83 82q19 19 45 19t45 -19l128 -128l-90 -90l-83 83l-83 -83q-18 -19 -45 -19t-45 19l-83 83l-83 -83q-19 -19 -45 -19t-45 19l-83 83l-83 -83q-19 -19 -45 -19t-45 19l-83 83l-83 -83q-19 -19 -45 -19t-45 19l-83 83l-83 -83 q-19 -19 -45 -19t-45 19l-83 83l-83 -83q-19 -19 -45 -19t-45 19l-83 83zM640 1152v-128l384 128l384 -128v128h-128v128h-512v-128h-128z" /> +<glyph unicode="" d="M576 0l96 448l-96 128l-128 64zM832 0l128 640l-128 -64l-96 -128zM992 1010q-2 4 -4 6q-10 8 -96 8q-70 0 -167 -19q-7 -2 -21 -2t-21 2q-97 19 -167 19q-86 0 -96 -8q-2 -2 -4 -6q2 -18 4 -27q2 -3 7.5 -6.5t7.5 -10.5q2 -4 7.5 -20.5t7 -20.5t7.5 -17t8.5 -17t9 -14 t12 -13.5t14 -9.5t17.5 -8t20.5 -4t24.5 -2q36 0 59 12.5t32.5 30t14.5 34.5t11.5 29.5t17.5 12.5h12q11 0 17.5 -12.5t11.5 -29.5t14.5 -34.5t32.5 -30t59 -12.5q13 0 24.5 2t20.5 4t17.5 8t14 9.5t12 13.5t9 14t8.5 17t7.5 17t7 20.5t7.5 20.5q2 7 7.5 10.5t7.5 6.5 q2 9 4 27zM1408 131q0 -121 -73 -190t-194 -69h-874q-121 0 -194 69t-73 190q0 61 4.5 118t19 125.5t37.5 123.5t63.5 103.5t93.5 74.5l-90 220h214q-22 64 -22 128q0 12 2 32q-194 40 -194 96q0 57 210 99q17 62 51.5 134t70.5 114q32 37 76 37q30 0 84 -31t84 -31t84 31 t84 31q44 0 76 -37q36 -42 70.5 -114t51.5 -134q210 -42 210 -99q0 -56 -194 -96q7 -81 -20 -160h214l-82 -225q63 -33 107.5 -96.5t65.5 -143.5t29 -151.5t8 -148.5z" /> +<glyph unicode="" horiz-adv-x="2304" d="M2301 500q12 -103 -22 -198.5t-99 -163.5t-158.5 -106t-196.5 -31q-161 11 -279.5 125t-134.5 274q-12 111 27.5 210.5t118.5 170.5l-71 107q-96 -80 -151 -194t-55 -244q0 -27 -18.5 -46.5t-45.5 -19.5h-256h-69q-23 -164 -149 -274t-294 -110q-185 0 -316.5 131.5 t-131.5 316.5t131.5 316.5t316.5 131.5q76 0 152 -27l24 45q-123 110 -304 110h-64q-26 0 -45 19t-19 45t19 45t45 19h128q78 0 145 -13.5t116.5 -38.5t71.5 -39.5t51 -36.5h512h115l-85 128h-222q-30 0 -49 22.5t-14 52.5q4 23 23 38t43 15h253q33 0 53 -28l70 -105 l114 114q19 19 46 19h101q26 0 45 -19t19 -45v-128q0 -26 -19 -45t-45 -19h-179l115 -172q131 63 275 36q143 -26 244 -134.5t118 -253.5zM448 128q115 0 203 72.5t111 183.5h-314q-35 0 -55 31q-18 32 -1 63l147 277q-47 13 -91 13q-132 0 -226 -94t-94 -226t94 -226 t226 -94zM1856 128q132 0 226 94t94 226t-94 226t-226 94q-60 0 -121 -24l174 -260q15 -23 10 -49t-27 -40q-15 -11 -36 -11q-35 0 -53 29l-174 260q-93 -95 -93 -225q0 -132 94 -226t226 -94z" /> +<glyph unicode="" d="M1408 0q0 -63 -61.5 -113.5t-164 -81t-225 -46t-253.5 -15.5t-253.5 15.5t-225 46t-164 81t-61.5 113.5q0 49 33 88.5t91 66.5t118 44.5t131 29.5q26 5 48 -10.5t26 -41.5q5 -26 -10.5 -48t-41.5 -26q-58 -10 -106 -23.5t-76.5 -25.5t-48.5 -23.5t-27.5 -19.5t-8.5 -12 q3 -11 27 -26.5t73 -33t114 -32.5t160.5 -25t201.5 -10t201.5 10t160.5 25t114 33t73 33.5t27 27.5q-1 4 -8.5 11t-27.5 19t-48.5 23.5t-76.5 25t-106 23.5q-26 4 -41.5 26t-10.5 48q4 26 26 41.5t48 10.5q71 -12 131 -29.5t118 -44.5t91 -66.5t33 -88.5zM1024 896v-384 q0 -26 -19 -45t-45 -19h-64v-384q0 -26 -19 -45t-45 -19h-256q-26 0 -45 19t-19 45v384h-64q-26 0 -45 19t-19 45v384q0 53 37.5 90.5t90.5 37.5h384q53 0 90.5 -37.5t37.5 -90.5zM928 1280q0 -93 -65.5 -158.5t-158.5 -65.5t-158.5 65.5t-65.5 158.5t65.5 158.5t158.5 65.5 t158.5 -65.5t65.5 -158.5z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1280 512h305q-5 -6 -10 -10.5t-9 -7.5l-3 -4l-623 -600q-18 -18 -44 -18t-44 18l-624 602q-5 2 -21 20h369q22 0 39.5 13.5t22.5 34.5l70 281l190 -667q6 -20 23 -33t39 -13q21 0 38 13t23 33l146 485l56 -112q18 -35 57 -35zM1792 940q0 -145 -103 -300h-369l-111 221 q-8 17 -25.5 27t-36.5 8q-45 -5 -56 -46l-129 -430l-196 686q-6 20 -23.5 33t-39.5 13t-39 -13.5t-22 -34.5l-116 -464h-423q-103 155 -103 300q0 220 127 344t351 124q62 0 126.5 -21.5t120 -58t95.5 -68.5t76 -68q36 36 76 68t95.5 68.5t120 58t126.5 21.5q224 0 351 -124 t127 -344z" /> +<glyph unicode="" horiz-adv-x="1280" d="M1152 960q0 -221 -147.5 -384.5t-364.5 -187.5v-260h224q14 0 23 -9t9 -23v-64q0 -14 -9 -23t-23 -9h-224v-224q0 -14 -9 -23t-23 -9h-64q-14 0 -23 9t-9 23v224h-224q-14 0 -23 9t-9 23v64q0 14 9 23t23 9h224v260q-150 16 -271.5 103t-186 224t-52.5 292 q11 134 80.5 249t182 188t245.5 88q170 19 319 -54t236 -212t87 -306zM128 960q0 -185 131.5 -316.5t316.5 -131.5t316.5 131.5t131.5 316.5t-131.5 316.5t-316.5 131.5t-316.5 -131.5t-131.5 -316.5z" /> +<glyph unicode="" d="M1472 1408q26 0 45 -19t19 -45v-416q0 -14 -9 -23t-23 -9h-64q-14 0 -23 9t-9 23v262l-382 -383q126 -156 126 -359q0 -117 -45.5 -223.5t-123 -184t-184 -123t-223.5 -45.5t-223.5 45.5t-184 123t-123 184t-45.5 223.5t45.5 223.5t123 184t184 123t223.5 45.5 q203 0 359 -126l382 382h-261q-14 0 -23 9t-9 23v64q0 14 9 23t23 9h416zM576 0q185 0 316.5 131.5t131.5 316.5t-131.5 316.5t-316.5 131.5t-316.5 -131.5t-131.5 -316.5t131.5 -316.5t316.5 -131.5z" /> +<glyph unicode="" horiz-adv-x="1280" d="M830 1220q145 -72 233.5 -210.5t88.5 -305.5q0 -221 -147.5 -384.5t-364.5 -187.5v-132h96q14 0 23 -9t9 -23v-64q0 -14 -9 -23t-23 -9h-96v-96q0 -14 -9 -23t-23 -9h-64q-14 0 -23 9t-9 23v96h-96q-14 0 -23 9t-9 23v64q0 14 9 23t23 9h96v132q-217 24 -364.5 187.5 t-147.5 384.5q0 167 88.5 305.5t233.5 210.5q-165 96 -228 273q-6 16 3.5 29.5t26.5 13.5h69q21 0 29 -20q44 -106 140 -171t214 -65t214 65t140 171q8 20 37 20h61q17 0 26.5 -13.5t3.5 -29.5q-63 -177 -228 -273zM576 256q185 0 316.5 131.5t131.5 316.5t-131.5 316.5 t-316.5 131.5t-316.5 -131.5t-131.5 -316.5t131.5 -316.5t316.5 -131.5z" /> +<glyph unicode="" d="M1024 1504q0 14 9 23t23 9h288q26 0 45 -19t19 -45v-288q0 -14 -9 -23t-23 -9h-64q-14 0 -23 9t-9 23v134l-254 -255q126 -158 126 -359q0 -221 -147.5 -384.5t-364.5 -187.5v-132h96q14 0 23 -9t9 -23v-64q0 -14 -9 -23t-23 -9h-96v-96q0 -14 -9 -23t-23 -9h-64 q-14 0 -23 9t-9 23v96h-96q-14 0 -23 9t-9 23v64q0 14 9 23t23 9h96v132q-149 16 -270.5 103t-186.5 223.5t-53 291.5q16 204 160 353.5t347 172.5q118 14 228 -19t198 -103l255 254h-134q-14 0 -23 9t-9 23v64zM576 256q185 0 316.5 131.5t131.5 316.5t-131.5 316.5 t-316.5 131.5t-316.5 -131.5t-131.5 -316.5t131.5 -316.5t316.5 -131.5z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1280 1504q0 14 9 23t23 9h288q26 0 45 -19t19 -45v-288q0 -14 -9 -23t-23 -9h-64q-14 0 -23 9t-9 23v134l-254 -255q126 -158 126 -359q0 -221 -147.5 -384.5t-364.5 -187.5v-132h96q14 0 23 -9t9 -23v-64q0 -14 -9 -23t-23 -9h-96v-96q0 -14 -9 -23t-23 -9h-64 q-14 0 -23 9t-9 23v96h-96q-14 0 -23 9t-9 23v64q0 14 9 23t23 9h96v132q-217 24 -364.5 187.5t-147.5 384.5q0 201 126 359l-52 53l-101 -111q-9 -10 -22 -10.5t-23 7.5l-48 44q-10 8 -10.5 21.5t8.5 23.5l105 115l-111 112v-134q0 -14 -9 -23t-23 -9h-64q-14 0 -23 9 t-9 23v288q0 26 19 45t45 19h288q14 0 23 -9t9 -23v-64q0 -14 -9 -23t-23 -9h-133l106 -107l86 94q9 10 22 10.5t23 -7.5l48 -44q10 -8 10.5 -21.5t-8.5 -23.5l-90 -99l57 -56q158 126 359 126t359 -126l255 254h-134q-14 0 -23 9t-9 23v64zM832 256q185 0 316.5 131.5 t131.5 316.5t-131.5 316.5t-316.5 131.5t-316.5 -131.5t-131.5 -316.5t131.5 -316.5t316.5 -131.5z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1790 1007q12 -155 -52.5 -292t-186 -224t-271.5 -103v-260h224q14 0 23 -9t9 -23v-64q0 -14 -9 -23t-23 -9h-224v-224q0 -14 -9 -23t-23 -9h-64q-14 0 -23 9t-9 23v224h-512v-224q0 -14 -9 -23t-23 -9h-64q-14 0 -23 9t-9 23v224h-224q-14 0 -23 9t-9 23v64q0 14 9 23 t23 9h224v260q-150 16 -271.5 103t-186 224t-52.5 292q17 206 164.5 356.5t352.5 169.5q206 21 377 -94q171 115 377 94q205 -19 352.5 -169.5t164.5 -356.5zM896 647q128 131 128 313t-128 313q-128 -131 -128 -313t128 -313zM576 512q115 0 218 57q-154 165 -154 391 q0 224 154 391q-103 57 -218 57q-185 0 -316.5 -131.5t-131.5 -316.5t131.5 -316.5t316.5 -131.5zM1152 128v260q-137 15 -256 94q-119 -79 -256 -94v-260h512zM1216 512q185 0 316.5 131.5t131.5 316.5t-131.5 316.5t-316.5 131.5q-115 0 -218 -57q154 -167 154 -391 q0 -226 -154 -391q103 -57 218 -57z" /> +<glyph unicode="" horiz-adv-x="1920" d="M1536 1120q0 14 9 23t23 9h288q26 0 45 -19t19 -45v-288q0 -14 -9 -23t-23 -9h-64q-14 0 -23 9t-9 23v134l-254 -255q76 -95 107.5 -214t9.5 -247q-31 -182 -166 -312t-318 -156q-210 -29 -384.5 80t-241.5 300q-117 6 -221 57.5t-177.5 133t-113.5 192.5t-32 230 q9 135 78 252t182 191.5t248 89.5q118 14 227.5 -19t198.5 -103l255 254h-134q-14 0 -23 9t-9 23v64q0 14 9 23t23 9h288q26 0 45 -19t19 -45v-288q0 -14 -9 -23t-23 -9h-64q-14 0 -23 9t-9 23v134l-254 -255q59 -74 93 -169q182 -9 328 -124l255 254h-134q-14 0 -23 9 t-9 23v64zM1024 704q0 20 -4 58q-162 -25 -271 -150t-109 -292q0 -20 4 -58q162 25 271 150t109 292zM128 704q0 -168 111 -294t276 -149q-3 29 -3 59q0 210 135 369.5t338 196.5q-53 120 -163.5 193t-245.5 73q-185 0 -316.5 -131.5t-131.5 -316.5zM1088 -128 q185 0 316.5 131.5t131.5 316.5q0 168 -111 294t-276 149q3 -29 3 -59q0 -210 -135 -369.5t-338 -196.5q53 -120 163.5 -193t245.5 -73z" /> +<glyph unicode="" horiz-adv-x="2048" d="M1664 1504q0 14 9 23t23 9h288q26 0 45 -19t19 -45v-288q0 -14 -9 -23t-23 -9h-64q-14 0 -23 9t-9 23v134l-254 -255q76 -95 107.5 -214t9.5 -247q-32 -180 -164.5 -310t-313.5 -157q-223 -34 -409 90q-117 -78 -256 -93v-132h96q14 0 23 -9t9 -23v-64q0 -14 -9 -23 t-23 -9h-96v-96q0 -14 -9 -23t-23 -9h-64q-14 0 -23 9t-9 23v96h-96q-14 0 -23 9t-9 23v64q0 14 9 23t23 9h96v132q-155 17 -279.5 109.5t-187 237.5t-39.5 307q25 187 159.5 322.5t320.5 164.5q224 34 410 -90q146 97 320 97q201 0 359 -126l255 254h-134q-14 0 -23 9 t-9 23v64zM896 391q128 131 128 313t-128 313q-128 -131 -128 -313t128 -313zM128 704q0 -185 131.5 -316.5t316.5 -131.5q117 0 218 57q-154 167 -154 391t154 391q-101 57 -218 57q-185 0 -316.5 -131.5t-131.5 -316.5zM1216 256q185 0 316.5 131.5t131.5 316.5 t-131.5 316.5t-316.5 131.5q-117 0 -218 -57q154 -167 154 -391t-154 -391q101 -57 218 -57z" /> +<glyph unicode="" d="M1472 1408q26 0 45 -19t19 -45v-416q0 -14 -9 -23t-23 -9h-64q-14 0 -23 9t-9 23v262l-213 -214l140 -140q9 -10 9 -23t-9 -22l-46 -46q-9 -9 -22 -9t-23 9l-140 141l-78 -79q126 -156 126 -359q0 -117 -45.5 -223.5t-123 -184t-184 -123t-223.5 -45.5t-223.5 45.5 t-184 123t-123 184t-45.5 223.5t45.5 223.5t123 184t184 123t223.5 45.5q203 0 359 -126l78 78l-172 172q-9 10 -9 23t9 22l46 46q9 9 22 9t23 -9l172 -172l213 213h-261q-14 0 -23 9t-9 23v64q0 14 9 23t23 9h416zM576 0q185 0 316.5 131.5t131.5 316.5t-131.5 316.5 t-316.5 131.5t-316.5 -131.5t-131.5 -316.5t131.5 -316.5t316.5 -131.5z" /> +<glyph unicode="" horiz-adv-x="1280" d="M640 892q217 -24 364.5 -187.5t147.5 -384.5q0 -167 -87 -306t-236 -212t-319 -54q-133 15 -245.5 88t-182 188t-80.5 249q-12 155 52.5 292t186 224t271.5 103v132h-160q-14 0 -23 9t-9 23v64q0 14 9 23t23 9h160v165l-92 -92q-10 -9 -23 -9t-22 9l-46 46q-9 9 -9 22 t9 23l202 201q19 19 45 19t45 -19l202 -201q9 -10 9 -23t-9 -22l-46 -46q-9 -9 -22 -9t-23 9l-92 92v-165h160q14 0 23 -9t9 -23v-64q0 -14 -9 -23t-23 -9h-160v-132zM576 -128q185 0 316.5 131.5t131.5 316.5t-131.5 316.5t-316.5 131.5t-316.5 -131.5t-131.5 -316.5 t131.5 -316.5t316.5 -131.5z" /> +<glyph unicode="" horiz-adv-x="2048" d="M1901 621q19 -19 19 -45t-19 -45l-294 -294q-9 -10 -22.5 -10t-22.5 10l-45 45q-10 9 -10 22.5t10 22.5l185 185h-294v-224q0 -14 -9 -23t-23 -9h-64q-14 0 -23 9t-9 23v224h-132q-24 -217 -187.5 -364.5t-384.5 -147.5q-167 0 -306 87t-212 236t-54 319q15 133 88 245.5 t188 182t249 80.5q155 12 292 -52.5t224 -186t103 -271.5h132v224q0 14 9 23t23 9h64q14 0 23 -9t9 -23v-224h294l-185 185q-10 9 -10 22.5t10 22.5l45 45q9 10 22.5 10t22.5 -10zM576 128q185 0 316.5 131.5t131.5 316.5t-131.5 316.5t-316.5 131.5t-316.5 -131.5 t-131.5 -316.5t131.5 -316.5t316.5 -131.5z" /> +<glyph unicode="" horiz-adv-x="1280" d="M1152 960q0 -221 -147.5 -384.5t-364.5 -187.5v-612q0 -14 -9 -23t-23 -9h-64q-14 0 -23 9t-9 23v612q-217 24 -364.5 187.5t-147.5 384.5q0 117 45.5 223.5t123 184t184 123t223.5 45.5t223.5 -45.5t184 -123t123 -184t45.5 -223.5zM576 512q185 0 316.5 131.5 t131.5 316.5t-131.5 316.5t-316.5 131.5t-316.5 -131.5t-131.5 -316.5t131.5 -316.5t316.5 -131.5z" /> +<glyph unicode="" horiz-adv-x="1280" d="M1024 576q0 185 -131.5 316.5t-316.5 131.5t-316.5 -131.5t-131.5 -316.5t131.5 -316.5t316.5 -131.5t316.5 131.5t131.5 316.5zM1152 576q0 -117 -45.5 -223.5t-123 -184t-184 -123t-223.5 -45.5t-223.5 45.5t-184 123t-123 184t-45.5 223.5t45.5 223.5t123 184t184 123 t223.5 45.5t223.5 -45.5t184 -123t123 -184t45.5 -223.5z" /> +<glyph unicode="" horiz-adv-x="1792" /> +<glyph unicode="" horiz-adv-x="1792" /> +<glyph unicode="" d="M1451 1408q35 0 60 -25t25 -60v-1366q0 -35 -25 -60t-60 -25h-391v595h199l30 232h-229v148q0 56 23.5 84t91.5 28l122 1v207q-63 9 -178 9q-136 0 -217.5 -80t-81.5 -226v-171h-200v-232h200v-595h-735q-35 0 -60 25t-25 60v1366q0 35 25 60t60 25h1366z" /> +<glyph unicode="" horiz-adv-x="1280" d="M0 939q0 108 37.5 203.5t103.5 166.5t152 123t185 78t202 26q158 0 294 -66.5t221 -193.5t85 -287q0 -96 -19 -188t-60 -177t-100 -149.5t-145 -103t-189 -38.5q-68 0 -135 32t-96 88q-10 -39 -28 -112.5t-23.5 -95t-20.5 -71t-26 -71t-32 -62.5t-46 -77.5t-62 -86.5 l-14 -5l-9 10q-15 157 -15 188q0 92 21.5 206.5t66.5 287.5t52 203q-32 65 -32 169q0 83 52 156t132 73q61 0 95 -40.5t34 -102.5q0 -66 -44 -191t-44 -187q0 -63 45 -104.5t109 -41.5q55 0 102 25t78.5 68t56 95t38 110.5t20 111t6.5 99.5q0 173 -109.5 269.5t-285.5 96.5 q-200 0 -334 -129.5t-134 -328.5q0 -44 12.5 -85t27 -65t27 -45.5t12.5 -30.5q0 -28 -15 -73t-37 -45q-2 0 -17 3q-51 15 -90.5 56t-61 94.5t-32.5 108t-11 106.5z" /> +<glyph unicode="" d="M985 562q13 0 97.5 -44t89.5 -53q2 -5 2 -15q0 -33 -17 -76q-16 -39 -71 -65.5t-102 -26.5q-57 0 -190 62q-98 45 -170 118t-148 185q-72 107 -71 194v8q3 91 74 158q24 22 52 22q6 0 18 -1.5t19 -1.5q19 0 26.5 -6.5t15.5 -27.5q8 -20 33 -88t25 -75q0 -21 -34.5 -57.5 t-34.5 -46.5q0 -7 5 -15q34 -73 102 -137q56 -53 151 -101q12 -7 22 -7q15 0 54 48.5t52 48.5zM782 32q127 0 243.5 50t200.5 134t134 200.5t50 243.5t-50 243.5t-134 200.5t-200.5 134t-243.5 50t-243.5 -50t-200.5 -134t-134 -200.5t-50 -243.5q0 -203 120 -368l-79 -233 l242 77q158 -104 345 -104zM782 1414q153 0 292.5 -60t240.5 -161t161 -240.5t60 -292.5t-60 -292.5t-161 -240.5t-240.5 -161t-292.5 -60q-195 0 -365 94l-417 -134l136 405q-108 178 -108 389q0 153 60 292.5t161 240.5t240.5 161t292.5 60z" /> +<glyph unicode="" horiz-adv-x="1792" d="M128 128h1024v128h-1024v-128zM128 640h1024v128h-1024v-128zM1696 192q0 40 -28 68t-68 28t-68 -28t-28 -68t28 -68t68 -28t68 28t28 68zM128 1152h1024v128h-1024v-128zM1696 704q0 40 -28 68t-68 28t-68 -28t-28 -68t28 -68t68 -28t68 28t28 68zM1696 1216 q0 40 -28 68t-68 28t-68 -28t-28 -68t28 -68t68 -28t68 28t28 68zM1792 384v-384h-1792v384h1792zM1792 896v-384h-1792v384h1792zM1792 1408v-384h-1792v384h1792z" /> +<glyph unicode="" horiz-adv-x="2048" d="M704 640q-159 0 -271.5 112.5t-112.5 271.5t112.5 271.5t271.5 112.5t271.5 -112.5t112.5 -271.5t-112.5 -271.5t-271.5 -112.5zM1664 512h352q13 0 22.5 -9.5t9.5 -22.5v-192q0 -13 -9.5 -22.5t-22.5 -9.5h-352v-352q0 -13 -9.5 -22.5t-22.5 -9.5h-192q-13 0 -22.5 9.5 t-9.5 22.5v352h-352q-13 0 -22.5 9.5t-9.5 22.5v192q0 13 9.5 22.5t22.5 9.5h352v352q0 13 9.5 22.5t22.5 9.5h192q13 0 22.5 -9.5t9.5 -22.5v-352zM928 288q0 -52 38 -90t90 -38h256v-238q-68 -50 -171 -50h-874q-121 0 -194 69t-73 190q0 53 3.5 103.5t14 109t26.5 108.5 t43 97.5t62 81t85.5 53.5t111.5 20q19 0 39 -17q79 -61 154.5 -91.5t164.5 -30.5t164.5 30.5t154.5 91.5q20 17 39 17q132 0 217 -96h-223q-52 0 -90 -38t-38 -90v-192z" /> +<glyph unicode="" horiz-adv-x="2048" d="M704 640q-159 0 -271.5 112.5t-112.5 271.5t112.5 271.5t271.5 112.5t271.5 -112.5t112.5 -271.5t-112.5 -271.5t-271.5 -112.5zM1781 320l249 -249q9 -9 9 -23q0 -13 -9 -22l-136 -136q-9 -9 -22 -9q-14 0 -23 9l-249 249l-249 -249q-9 -9 -23 -9q-13 0 -22 9l-136 136 q-9 9 -9 22q0 14 9 23l249 249l-249 249q-9 9 -9 23q0 13 9 22l136 136q9 9 22 9q14 0 23 -9l249 -249l249 249q9 9 23 9q13 0 22 -9l136 -136q9 -9 9 -22q0 -14 -9 -23zM1283 320l-181 -181q-37 -37 -37 -91q0 -53 37 -90l83 -83q-21 -3 -44 -3h-874q-121 0 -194 69 t-73 190q0 53 3.5 103.5t14 109t26.5 108.5t43 97.5t62 81t85.5 53.5t111.5 20q19 0 39 -17q154 -122 319 -122t319 122q20 17 39 17q28 0 57 -6q-28 -27 -41 -50t-13 -56q0 -54 37 -91z" /> +<glyph unicode="" horiz-adv-x="2048" d="M256 512h1728q26 0 45 -19t19 -45v-448h-256v256h-1536v-256h-256v1216q0 26 19 45t45 19h128q26 0 45 -19t19 -45v-704zM832 832q0 106 -75 181t-181 75t-181 -75t-75 -181t75 -181t181 -75t181 75t75 181zM2048 576v64q0 159 -112.5 271.5t-271.5 112.5h-704 q-26 0 -45 -19t-19 -45v-384h1152z" /> +<glyph unicode="" d="M1536 1536l-192 -448h192v-192h-274l-55 -128h329v-192h-411l-357 -832l-357 832h-411v192h329l-55 128h-274v192h192l-192 448h256l323 -768h378l323 768h256zM768 320l108 256h-216z" /> +<glyph unicode="" d="M1088 1536q185 0 316.5 -93.5t131.5 -226.5v-896q0 -130 -125.5 -222t-305.5 -97l213 -202q16 -15 8 -35t-30 -20h-1056q-22 0 -30 20t8 35l213 202q-180 5 -305.5 97t-125.5 222v896q0 133 131.5 226.5t316.5 93.5h640zM768 192q80 0 136 56t56 136t-56 136t-136 56 t-136 -56t-56 -136t56 -136t136 -56zM1344 768v512h-1152v-512h1152z" /> +<glyph unicode="" d="M1088 1536q185 0 316.5 -93.5t131.5 -226.5v-896q0 -130 -125.5 -222t-305.5 -97l213 -202q16 -15 8 -35t-30 -20h-1056q-22 0 -30 20t8 35l213 202q-180 5 -305.5 97t-125.5 222v896q0 133 131.5 226.5t316.5 93.5h640zM288 224q66 0 113 47t47 113t-47 113t-113 47 t-113 -47t-47 -113t47 -113t113 -47zM704 768v512h-544v-512h544zM1248 224q66 0 113 47t47 113t-47 113t-113 47t-113 -47t-47 -113t47 -113t113 -47zM1408 768v512h-576v-512h576z" /> +<glyph unicode="" horiz-adv-x="1792" d="M597 1115v-1173q0 -25 -12.5 -42.5t-36.5 -17.5q-17 0 -33 8l-465 233q-21 10 -35.5 33.5t-14.5 46.5v1140q0 20 10 34t29 14q14 0 44 -15l511 -256q3 -3 3 -5zM661 1014l534 -866l-534 266v600zM1792 996v-1054q0 -25 -14 -40.5t-38 -15.5t-47 13l-441 220zM1789 1116 q0 -3 -256.5 -419.5t-300.5 -487.5l-390 634l324 527q17 28 52 28q14 0 26 -6l541 -270q4 -2 4 -6z" /> +<glyph unicode="" d="M809 532l266 499h-112l-157 -312q-24 -48 -44 -92l-42 92l-155 312h-120l263 -493v-324h101v318zM1536 1408v-1536h-1536v1536h1536z" /> +<glyph unicode="" horiz-adv-x="2296" d="M478 -139q-8 -16 -27 -34.5t-37 -25.5q-25 -9 -51.5 3.5t-28.5 31.5q-1 22 40 55t68 38q23 4 34 -21.5t2 -46.5zM1819 -139q7 -16 26 -34.5t38 -25.5q25 -9 51.5 3.5t27.5 31.5q2 22 -39.5 55t-68.5 38q-22 4 -33 -21.5t-2 -46.5zM1867 -30q13 -27 56.5 -59.5t77.5 -41.5 q45 -13 82 4.5t37 50.5q0 46 -67.5 100.5t-115.5 59.5q-40 5 -63.5 -37.5t-6.5 -76.5zM428 -30q-13 -27 -56 -59.5t-77 -41.5q-45 -13 -82 4.5t-37 50.5q0 46 67.5 100.5t115.5 59.5q40 5 63 -37.5t6 -76.5zM1158 1094h1q-41 0 -76 -15q27 -8 44 -30.5t17 -49.5 q0 -35 -27 -60t-65 -25q-52 0 -80 43q-5 -23 -5 -42q0 -74 56 -126.5t135 -52.5q80 0 136 52.5t56 126.5t-56 126.5t-136 52.5zM1462 1312q-99 109 -220.5 131.5t-245.5 -44.5q27 60 82.5 96.5t118 39.5t121.5 -17t99.5 -74.5t44.5 -131.5zM2212 73q8 -11 -11 -42 q7 -23 7 -40q1 -56 -44.5 -112.5t-109.5 -91.5t-118 -37q-48 -2 -92 21.5t-66 65.5q-687 -25 -1259 0q-23 -41 -66.5 -65t-92.5 -22q-86 3 -179.5 80.5t-92.5 160.5q2 22 7 40q-19 31 -11 42q6 10 31 1q14 22 41 51q-7 29 2 38q11 10 39 -4q29 20 59 34q0 29 13 37 q23 12 51 -16q35 5 61 -2q18 -4 38 -19v73q-11 0 -18 2q-53 10 -97 44.5t-55 87.5q-9 38 0 81q15 62 93 95q2 17 19 35.5t36 23.5t33 -7.5t19 -30.5h13q46 -5 60 -23q3 -3 5 -7q10 1 30.5 3.5t30.5 3.5q-15 11 -30 17q-23 40 -91 43q0 6 1 10q-62 2 -118.5 18.5t-84.5 47.5 q-32 36 -42.5 92t-2.5 112q16 126 90 179q23 16 52 4.5t32 -40.5q0 -1 1.5 -14t2.5 -21t3 -20t5.5 -19t8.5 -10q27 -14 76 -12q48 46 98 74q-40 4 -162 -14l47 46q61 58 163 111q145 73 282 86q-20 8 -41 15.5t-47 14t-42.5 10.5t-47.5 11t-43 10q595 126 904 -139 q98 -84 158 -222q85 -10 121 9h1q5 3 8.5 10t5.5 19t3 19.5t3 21.5l1 14q3 28 32 40t52 -5q73 -52 91 -178q7 -57 -3.5 -113t-42.5 -91q-28 -32 -83.5 -48.5t-115.5 -18.5v-10q-71 -2 -95 -43q-14 -5 -31 -17q11 -1 32 -3.5t30 -3.5q1 4 5 8q16 18 60 23h13q5 18 19 30t33 8 t36 -23t19 -36q79 -32 93 -95q9 -40 1 -81q-12 -53 -56 -88t-97 -44q-10 -2 -17 -2q0 -49 -1 -73q20 15 38 19q26 7 61 2q28 28 51 16q14 -9 14 -37q33 -16 59 -34q27 13 38 4q10 -10 2 -38q28 -30 41 -51q23 8 31 -1zM1937 1025q0 -29 -9 -54q82 -32 112 -132 q4 37 -9.5 98.5t-41.5 90.5q-20 19 -36 17t-16 -20zM1859 925q35 -42 47.5 -108.5t-0.5 -124.5q67 13 97 45q13 14 18 28q-3 64 -31 114.5t-79 66.5q-15 -15 -52 -21zM1822 921q-30 0 -44 1q42 -115 53 -239q21 0 43 3q16 68 1 135t-53 100zM258 839q30 100 112 132 q-9 25 -9 54q0 18 -16.5 20t-35.5 -17q-28 -29 -41.5 -90.5t-9.5 -98.5zM294 737q29 -31 97 -45q-13 58 -0.5 124.5t47.5 108.5v0q-37 6 -52 21q-51 -16 -78.5 -66t-31.5 -115q9 -17 18 -28zM471 683q14 124 73 235q-19 -4 -55 -18l-45 -19v1q-46 -89 -20 -196q25 -3 47 -3z M1434 644q8 -38 16.5 -108.5t11.5 -89.5q3 -18 9.5 -21.5t23.5 4.5q40 20 62 85.5t23 125.5q-24 2 -146 4zM1152 1285q-116 0 -199 -82.5t-83 -198.5q0 -117 83 -199.5t199 -82.5t199 82.5t83 199.5q0 116 -83 198.5t-199 82.5zM1380 646q-106 2 -211 0v1q-1 -27 2.5 -86 t13.5 -66q29 -14 93.5 -14.5t95.5 10.5q9 3 11 39t-0.5 69.5t-4.5 46.5zM1112 447q8 4 9.5 48t-0.5 88t-4 63v1q-212 -3 -214 -3q-4 -20 -7 -62t0 -83t14 -46q34 -15 101 -16t101 10zM718 636q-16 -59 4.5 -118.5t77.5 -84.5q15 -8 24 -5t12 21q3 16 8 90t10 103 q-69 -2 -136 -6zM591 510q3 -23 -34 -36q132 -141 271.5 -240t305.5 -154q172 49 310.5 146t293.5 250q-33 13 -30 34l3 9v1v-1q-17 2 -50 5.5t-48 4.5q-26 -90 -82 -132q-51 -38 -82 1q-5 6 -9 14q-7 13 -17 62q-2 -5 -5 -9t-7.5 -7t-8 -5.5t-9.5 -4l-10 -2.5t-12 -2 l-12 -1.5t-13.5 -1t-13.5 -0.5q-106 -9 -163 11q-4 -17 -10 -26.5t-21 -15t-23 -7t-36 -3.5q-2 0 -3 -0.5t-3 -0.5h-3q-179 -17 -203 40q-2 -63 -56 -54q-47 8 -91 54q-12 13 -20 26q-17 29 -26 65q-58 -6 -87 -10q1 -2 4 -10zM507 -118q3 14 3 30q-17 71 -51 130t-73 70 q-41 12 -101.5 -14.5t-104.5 -80t-39 -107.5q35 -53 100 -93t119 -42q51 -2 94 28t53 79zM510 53q23 -63 27 -119q195 113 392 174q-98 52 -180.5 120t-179.5 165q-6 -4 -29 -13q0 -2 -1 -5t-1 -4q31 -18 22 -37q-12 -23 -56 -34q-10 -13 -29 -24h-1q-2 -83 1 -150 q19 -34 35 -73zM579 -113q532 -21 1145 0q-254 147 -428 196q-76 -35 -156 -57q-8 -3 -16 0q-65 21 -129 49q-208 -60 -416 -188h-1v-1q1 0 1 1zM1763 -67q4 54 28 120q14 38 33 71l-1 -1q3 77 3 153q-15 8 -30 25q-42 9 -56 33q-9 20 22 38q-2 4 -2 9q-16 4 -28 12 q-204 -190 -383 -284q198 -59 414 -176zM2155 -90q5 54 -39 107.5t-104 80t-102 14.5q-38 -11 -72.5 -70.5t-51.5 -129.5q0 -16 3 -30q10 -49 53 -79t94 -28q54 2 119 42t100 93z" /> +<glyph unicode="" horiz-adv-x="2304" d="M1524 -25q0 -68 -48 -116t-116 -48t-116.5 48t-48.5 116t48.5 116.5t116.5 48.5t116 -48.5t48 -116.5zM775 -25q0 -68 -48.5 -116t-116.5 -48t-116 48t-48 116t48 116.5t116 48.5t116.5 -48.5t48.5 -116.5zM0 1469q57 -60 110.5 -104.5t121 -82t136 -63t166 -45.5 t200 -31.5t250 -18.5t304 -9.5t372.5 -2.5q139 0 244.5 -5t181 -16.5t124 -27.5t71 -39.5t24 -51.5t-19.5 -64t-56.5 -76.5t-89.5 -91t-116 -104.5t-139 -119q-185 -157 -286 -247q29 51 76.5 109t94 105.5t94.5 98.5t83 91.5t54 80.5t13 70t-45.5 55.5t-116.5 41t-204 23.5 t-304 5q-168 -2 -314 6t-256 23t-204.5 41t-159.5 51.5t-122.5 62.5t-91.5 66.5t-68 71.5t-50.5 69.5t-40 68t-36.5 59.5z" /> +<glyph unicode="" horiz-adv-x="1792" d="M896 1472q-169 0 -323 -66t-265.5 -177.5t-177.5 -265.5t-66 -323t66 -323t177.5 -265.5t265.5 -177.5t323 -66t323 66t265.5 177.5t177.5 265.5t66 323t-66 323t-177.5 265.5t-265.5 177.5t-323 66zM896 1536q182 0 348 -71t286 -191t191 -286t71 -348t-71 -348 t-191 -286t-286 -191t-348 -71t-348 71t-286 191t-191 286t-71 348t71 348t191 286t286 191t348 71zM496 704q16 0 16 -16v-480q0 -16 -16 -16h-32q-16 0 -16 16v480q0 16 16 16h32zM896 640q53 0 90.5 -37.5t37.5 -90.5q0 -35 -17.5 -64t-46.5 -46v-114q0 -14 -9 -23 t-23 -9h-64q-14 0 -23 9t-9 23v114q-29 17 -46.5 46t-17.5 64q0 53 37.5 90.5t90.5 37.5zM896 1408q209 0 385.5 -103t279.5 -279.5t103 -385.5t-103 -385.5t-279.5 -279.5t-385.5 -103t-385.5 103t-279.5 279.5t-103 385.5t103 385.5t279.5 279.5t385.5 103zM544 928v-96 q0 -14 9 -23t23 -9h64q14 0 23 9t9 23v96q0 93 65.5 158.5t158.5 65.5t158.5 -65.5t65.5 -158.5v-96q0 -14 9 -23t23 -9h64q14 0 23 9t9 23v96q0 146 -103 249t-249 103t-249 -103t-103 -249zM1408 192v512q0 26 -19 45t-45 19h-896q-26 0 -45 -19t-19 -45v-512 q0 -26 19 -45t45 -19h896q26 0 45 19t19 45z" /> +<glyph unicode="" horiz-adv-x="2304" d="M1920 1024v-768h-1664v768h1664zM2048 448h128v384h-128v288q0 14 -9 23t-23 9h-1856q-14 0 -23 -9t-9 -23v-960q0 -14 9 -23t23 -9h1856q14 0 23 9t9 23v288zM2304 832v-384q0 -53 -37.5 -90.5t-90.5 -37.5v-160q0 -66 -47 -113t-113 -47h-1856q-66 0 -113 47t-47 113 v960q0 66 47 113t113 47h1856q66 0 113 -47t47 -113v-160q53 0 90.5 -37.5t37.5 -90.5z" /> +<glyph unicode="" horiz-adv-x="2304" d="M256 256v768h1280v-768h-1280zM2176 960q53 0 90.5 -37.5t37.5 -90.5v-384q0 -53 -37.5 -90.5t-90.5 -37.5v-160q0 -66 -47 -113t-113 -47h-1856q-66 0 -113 47t-47 113v960q0 66 47 113t113 47h1856q66 0 113 -47t47 -113v-160zM2176 448v384h-128v288q0 14 -9 23t-23 9 h-1856q-14 0 -23 -9t-9 -23v-960q0 -14 9 -23t23 -9h1856q14 0 23 9t9 23v288h128z" /> +<glyph unicode="" horiz-adv-x="2304" d="M256 256v768h896v-768h-896zM2176 960q53 0 90.5 -37.5t37.5 -90.5v-384q0 -53 -37.5 -90.5t-90.5 -37.5v-160q0 -66 -47 -113t-113 -47h-1856q-66 0 -113 47t-47 113v960q0 66 47 113t113 47h1856q66 0 113 -47t47 -113v-160zM2176 448v384h-128v288q0 14 -9 23t-23 9 h-1856q-14 0 -23 -9t-9 -23v-960q0 -14 9 -23t23 -9h1856q14 0 23 9t9 23v288h128z" /> +<glyph unicode="" horiz-adv-x="2304" d="M256 256v768h512v-768h-512zM2176 960q53 0 90.5 -37.5t37.5 -90.5v-384q0 -53 -37.5 -90.5t-90.5 -37.5v-160q0 -66 -47 -113t-113 -47h-1856q-66 0 -113 47t-47 113v960q0 66 47 113t113 47h1856q66 0 113 -47t47 -113v-160zM2176 448v384h-128v288q0 14 -9 23t-23 9 h-1856q-14 0 -23 -9t-9 -23v-960q0 -14 9 -23t23 -9h1856q14 0 23 9t9 23v288h128z" /> +<glyph unicode="" horiz-adv-x="2304" d="M2176 960q53 0 90.5 -37.5t37.5 -90.5v-384q0 -53 -37.5 -90.5t-90.5 -37.5v-160q0 -66 -47 -113t-113 -47h-1856q-66 0 -113 47t-47 113v960q0 66 47 113t113 47h1856q66 0 113 -47t47 -113v-160zM2176 448v384h-128v288q0 14 -9 23t-23 9h-1856q-14 0 -23 -9t-9 -23 v-960q0 -14 9 -23t23 -9h1856q14 0 23 9t9 23v288h128z" /> +<glyph unicode="" horiz-adv-x="1280" d="M1133 493q31 -30 14 -69q-17 -40 -59 -40h-382l201 -476q10 -25 0 -49t-34 -35l-177 -75q-25 -10 -49 0t-35 34l-191 452l-312 -312q-19 -19 -45 -19q-12 0 -24 5q-40 17 -40 59v1504q0 42 40 59q12 5 24 5q27 0 45 -19z" /> +<glyph unicode="" horiz-adv-x="1024" d="M832 1408q-320 0 -320 -224v-416h128v-128h-128v-544q0 -224 320 -224h64v-128h-64q-272 0 -384 146q-112 -146 -384 -146h-64v128h64q320 0 320 224v544h-128v128h128v416q0 224 -320 224h-64v128h64q272 0 384 -146q112 146 384 146h64v-128h-64z" /> +<glyph unicode="" horiz-adv-x="2048" d="M2048 1152h-128v-1024h128v-384h-384v128h-1280v-128h-384v384h128v1024h-128v384h384v-128h1280v128h384v-384zM1792 1408v-128h128v128h-128zM128 1408v-128h128v128h-128zM256 -128v128h-128v-128h128zM1664 0v128h128v1024h-128v128h-1280v-128h-128v-1024h128v-128 h1280zM1920 -128v128h-128v-128h128zM1280 896h384v-768h-896v256h-384v768h896v-256zM512 512h640v512h-640v-512zM1536 256v512h-256v-384h-384v-128h640z" /> +<glyph unicode="" horiz-adv-x="2304" d="M2304 768h-128v-640h128v-384h-384v128h-896v-128h-384v384h128v128h-384v-128h-384v384h128v640h-128v384h384v-128h896v128h384v-384h-128v-128h384v128h384v-384zM2048 1024v-128h128v128h-128zM1408 1408v-128h128v128h-128zM128 1408v-128h128v128h-128zM256 256 v128h-128v-128h128zM1536 384h-128v-128h128v128zM384 384h896v128h128v640h-128v128h-896v-128h-128v-640h128v-128zM896 -128v128h-128v-128h128zM2176 -128v128h-128v-128h128zM2048 128v640h-128v128h-384v-384h128v-384h-384v128h-384v-128h128v-128h896v128h128z" /> +<glyph unicode="" d="M1024 288v-416h-928q-40 0 -68 28t-28 68v1344q0 40 28 68t68 28h1344q40 0 68 -28t28 -68v-928h-416q-40 0 -68 -28t-28 -68zM1152 256h381q-15 -82 -65 -132l-184 -184q-50 -50 -132 -65v381z" /> +<glyph unicode="" d="M1400 256h-248v-248q29 10 41 22l185 185q12 12 22 41zM1120 384h288v896h-1280v-1280h896v288q0 40 28 68t68 28zM1536 1312v-1024q0 -40 -20 -88t-48 -76l-184 -184q-28 -28 -76 -48t-88 -20h-1024q-40 0 -68 28t-28 68v1344q0 40 28 68t68 28h1344q40 0 68 -28t28 -68 z" /> +<glyph unicode="" horiz-adv-x="2304" d="M1951 538q0 -26 -15.5 -44.5t-38.5 -23.5q-8 -2 -18 -2h-153v140h153q10 0 18 -2q23 -5 38.5 -23.5t15.5 -44.5zM1933 751q0 -25 -15 -42t-38 -21q-3 -1 -15 -1h-139v129h139q3 0 8.5 -0.5t6.5 -0.5q23 -4 38 -21.5t15 -42.5zM728 587v308h-228v-308q0 -58 -38 -94.5 t-105 -36.5q-108 0 -229 59v-112q53 -15 121 -23t109 -9l42 -1q328 0 328 217zM1442 403v113q-99 -52 -200 -59q-108 -8 -169 41t-61 142t61 142t169 41q101 -7 200 -58v112q-48 12 -100 19.5t-80 9.5l-28 2q-127 6 -218.5 -14t-140.5 -60t-71 -88t-22 -106t22 -106t71 -88 t140.5 -60t218.5 -14q101 4 208 31zM2176 518q0 54 -43 88.5t-109 39.5v3q57 8 89 41.5t32 79.5q0 55 -41 88t-107 36q-3 0 -12 0.5t-14 0.5h-455v-510h491q74 0 121.5 36.5t47.5 96.5zM2304 1280v-1280q0 -52 -38 -90t-90 -38h-2048q-52 0 -90 38t-38 90v1280q0 52 38 90 t90 38h2048q52 0 90 -38t38 -90z" /> +<glyph unicode="" horiz-adv-x="2304" d="M858 295v693q-106 -41 -172 -135.5t-66 -211.5t66 -211.5t172 -134.5zM1362 641q0 117 -66 211.5t-172 135.5v-694q106 41 172 135.5t66 211.5zM1577 641q0 -159 -78.5 -294t-213.5 -213.5t-294 -78.5q-119 0 -227.5 46.5t-187 125t-125 187t-46.5 227.5q0 159 78.5 294 t213.5 213.5t294 78.5t294 -78.5t213.5 -213.5t78.5 -294zM1960 634q0 139 -55.5 261.5t-147.5 205.5t-213.5 131t-252.5 48h-301q-176 0 -323.5 -81t-235 -230t-87.5 -335q0 -171 87 -317.5t236 -231.5t323 -85h301q129 0 251.5 50.5t214.5 135t147.5 202.5t55.5 246z M2304 1280v-1280q0 -52 -38 -90t-90 -38h-2048q-52 0 -90 38t-38 90v1280q0 52 38 90t90 38h2048q52 0 90 -38t38 -90z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1664 -96v1088q0 13 -9.5 22.5t-22.5 9.5h-1088q-13 0 -22.5 -9.5t-9.5 -22.5v-1088q0 -13 9.5 -22.5t22.5 -9.5h1088q13 0 22.5 9.5t9.5 22.5zM1792 992v-1088q0 -66 -47 -113t-113 -47h-1088q-66 0 -113 47t-47 113v1088q0 66 47 113t113 47h1088q66 0 113 -47t47 -113 zM1408 1376v-160h-128v160q0 13 -9.5 22.5t-22.5 9.5h-1088q-13 0 -22.5 -9.5t-9.5 -22.5v-1088q0 -13 9.5 -22.5t22.5 -9.5h160v-128h-160q-66 0 -113 47t-47 113v1088q0 66 47 113t113 47h1088q66 0 113 -47t47 -113z" /> +<glyph unicode="" horiz-adv-x="2304" d="M1728 1088l-384 -704h768zM448 1088l-384 -704h768zM1269 1280q-14 -40 -45.5 -71.5t-71.5 -45.5v-1291h608q14 0 23 -9t9 -23v-64q0 -14 -9 -23t-23 -9h-1344q-14 0 -23 9t-9 23v64q0 14 9 23t23 9h608v1291q-40 14 -71.5 45.5t-45.5 71.5h-491q-14 0 -23 9t-9 23v64 q0 14 9 23t23 9h491q21 57 70 92.5t111 35.5t111 -35.5t70 -92.5h491q14 0 23 -9t9 -23v-64q0 -14 -9 -23t-23 -9h-491zM1088 1264q33 0 56.5 23.5t23.5 56.5t-23.5 56.5t-56.5 23.5t-56.5 -23.5t-23.5 -56.5t23.5 -56.5t56.5 -23.5zM2176 384q0 -73 -46.5 -131t-117.5 -91 t-144.5 -49.5t-139.5 -16.5t-139.5 16.5t-144.5 49.5t-117.5 91t-46.5 131q0 11 35 81t92 174.5t107 195.5t102 184t56 100q18 33 56 33t56 -33q4 -7 56 -100t102 -184t107 -195.5t92 -174.5t35 -81zM896 384q0 -73 -46.5 -131t-117.5 -91t-144.5 -49.5t-139.5 -16.5 t-139.5 16.5t-144.5 49.5t-117.5 91t-46.5 131q0 11 35 81t92 174.5t107 195.5t102 184t56 100q18 33 56 33t56 -33q4 -7 56 -100t102 -184t107 -195.5t92 -174.5t35 -81z" /> +<glyph unicode="" d="M1408 1408q0 -261 -106.5 -461.5t-266.5 -306.5q160 -106 266.5 -306.5t106.5 -461.5h96q14 0 23 -9t9 -23v-64q0 -14 -9 -23t-23 -9h-1472q-14 0 -23 9t-9 23v64q0 14 9 23t23 9h96q0 261 106.5 461.5t266.5 306.5q-160 106 -266.5 306.5t-106.5 461.5h-96q-14 0 -23 9 t-9 23v64q0 14 9 23t23 9h1472q14 0 23 -9t9 -23v-64q0 -14 -9 -23t-23 -9h-96zM874 700q77 29 149 92.5t129.5 152.5t92.5 210t35 253h-1024q0 -132 35 -253t92.5 -210t129.5 -152.5t149 -92.5q19 -7 30.5 -23.5t11.5 -36.5t-11.5 -36.5t-30.5 -23.5q-77 -29 -149 -92.5 t-129.5 -152.5t-92.5 -210t-35 -253h1024q0 132 -35 253t-92.5 210t-129.5 152.5t-149 92.5q-19 7 -30.5 23.5t-11.5 36.5t11.5 36.5t30.5 23.5z" /> +<glyph unicode="" d="M1408 1408q0 -261 -106.5 -461.5t-266.5 -306.5q160 -106 266.5 -306.5t106.5 -461.5h96q14 0 23 -9t9 -23v-64q0 -14 -9 -23t-23 -9h-1472q-14 0 -23 9t-9 23v64q0 14 9 23t23 9h96q0 261 106.5 461.5t266.5 306.5q-160 106 -266.5 306.5t-106.5 461.5h-96q-14 0 -23 9 t-9 23v64q0 14 9 23t23 9h1472q14 0 23 -9t9 -23v-64q0 -14 -9 -23t-23 -9h-96zM1280 1408h-1024q0 -66 9 -128h1006q9 61 9 128zM1280 -128q0 130 -34 249.5t-90.5 208t-126.5 152t-146 94.5h-230q-76 -31 -146 -94.5t-126.5 -152t-90.5 -208t-34 -249.5h1024z" /> +<glyph unicode="" d="M1408 1408q0 -261 -106.5 -461.5t-266.5 -306.5q160 -106 266.5 -306.5t106.5 -461.5h96q14 0 23 -9t9 -23v-64q0 -14 -9 -23t-23 -9h-1472q-14 0 -23 9t-9 23v64q0 14 9 23t23 9h96q0 261 106.5 461.5t266.5 306.5q-160 106 -266.5 306.5t-106.5 461.5h-96q-14 0 -23 9 t-9 23v64q0 14 9 23t23 9h1472q14 0 23 -9t9 -23v-64q0 -14 -9 -23t-23 -9h-96zM1280 1408h-1024q0 -206 85 -384h854q85 178 85 384zM1223 192q-54 141 -145.5 241.5t-194.5 142.5h-230q-103 -42 -194.5 -142.5t-145.5 -241.5h910z" /> +<glyph unicode="" d="M1408 1408q0 -261 -106.5 -461.5t-266.5 -306.5q160 -106 266.5 -306.5t106.5 -461.5h96q14 0 23 -9t9 -23v-64q0 -14 -9 -23t-23 -9h-1472q-14 0 -23 9t-9 23v64q0 14 9 23t23 9h96q0 261 106.5 461.5t266.5 306.5q-160 106 -266.5 306.5t-106.5 461.5h-96q-14 0 -23 9 t-9 23v64q0 14 9 23t23 9h1472q14 0 23 -9t9 -23v-64q0 -14 -9 -23t-23 -9h-96zM874 700q77 29 149 92.5t129.5 152.5t92.5 210t35 253h-1024q0 -132 35 -253t92.5 -210t129.5 -152.5t149 -92.5q19 -7 30.5 -23.5t11.5 -36.5t-11.5 -36.5t-30.5 -23.5q-137 -51 -244 -196 h700q-107 145 -244 196q-19 7 -30.5 23.5t-11.5 36.5t11.5 36.5t30.5 23.5z" /> +<glyph unicode="" d="M1504 -64q14 0 23 -9t9 -23v-128q0 -14 -9 -23t-23 -9h-1472q-14 0 -23 9t-9 23v128q0 14 9 23t23 9h1472zM130 0q3 55 16 107t30 95t46 87t53.5 76t64.5 69.5t66 60t70.5 55t66.5 47.5t65 43q-43 28 -65 43t-66.5 47.5t-70.5 55t-66 60t-64.5 69.5t-53.5 76t-46 87 t-30 95t-16 107h1276q-3 -55 -16 -107t-30 -95t-46 -87t-53.5 -76t-64.5 -69.5t-66 -60t-70.5 -55t-66.5 -47.5t-65 -43q43 -28 65 -43t66.5 -47.5t70.5 -55t66 -60t64.5 -69.5t53.5 -76t46 -87t30 -95t16 -107h-1276zM1504 1536q14 0 23 -9t9 -23v-128q0 -14 -9 -23t-23 -9 h-1472q-14 0 -23 9t-9 23v128q0 14 9 23t23 9h1472z" /> +<glyph unicode="" d="M768 1152q-53 0 -90.5 -37.5t-37.5 -90.5v-128h-32v93q0 48 -32 81.5t-80 33.5q-46 0 -79 -33t-33 -79v-429l-32 30v172q0 48 -32 81.5t-80 33.5q-46 0 -79 -33t-33 -79v-224q0 -47 35 -82l310 -296q39 -39 39 -102q0 -26 19 -45t45 -19h640q26 0 45 19t19 45v25 q0 41 10 77l108 436q10 36 10 77v246q0 48 -32 81.5t-80 33.5q-46 0 -79 -33t-33 -79v-32h-32v125q0 40 -25 72.5t-64 40.5q-14 2 -23 2q-46 0 -79 -33t-33 -79v-128h-32v122q0 51 -32.5 89.5t-82.5 43.5q-5 1 -13 1zM768 1280q84 0 149 -50q57 34 123 34q59 0 111 -27 t86 -76q27 7 59 7q100 0 170 -71.5t70 -171.5v-246q0 -51 -13 -108l-109 -436q-6 -24 -6 -71q0 -80 -56 -136t-136 -56h-640q-84 0 -138 58.5t-54 142.5l-308 296q-76 73 -76 175v224q0 99 70.5 169.5t169.5 70.5q11 0 16 -1q6 95 75.5 160t164.5 65q52 0 98 -21 q72 69 174 69z" /> +<glyph unicode="" horiz-adv-x="1792" d="M880 1408q-46 0 -79 -33t-33 -79v-656h-32v528q0 46 -33 79t-79 33t-79 -33t-33 -79v-528v-256l-154 205q-38 51 -102 51q-53 0 -90.5 -37.5t-37.5 -90.5q0 -43 26 -77l384 -512q38 -51 102 -51h688q34 0 61 22t34 56l76 405q5 32 5 59v498q0 46 -33 79t-79 33t-79 -33 t-33 -79v-272h-32v528q0 46 -33 79t-79 33t-79 -33t-33 -79v-528h-32v656q0 46 -33 79t-79 33zM880 1536q68 0 125.5 -35.5t88.5 -96.5q19 4 42 4q99 0 169.5 -70.5t70.5 -169.5v-17q105 6 180.5 -64t75.5 -175v-498q0 -40 -8 -83l-76 -404q-14 -79 -76.5 -131t-143.5 -52 h-688q-60 0 -114.5 27.5t-90.5 74.5l-384 512q-51 68 -51 154q0 106 75 181t181 75q78 0 128 -34v434q0 99 70.5 169.5t169.5 70.5q23 0 42 -4q31 61 88.5 96.5t125.5 35.5z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1073 -128h-177q-163 0 -226 141q-23 49 -23 102v5q-62 30 -98.5 88.5t-36.5 127.5q0 38 5 48h-261q-106 0 -181 75t-75 181t75 181t181 75h113l-44 17q-74 28 -119.5 93.5t-45.5 145.5q0 106 75 181t181 75q46 0 91 -17l628 -239h401q106 0 181 -75t75 -181v-668 q0 -88 -54 -157.5t-140 -90.5l-339 -85q-92 -23 -186 -23zM1024 583l-155 -71l-163 -74q-30 -14 -48 -41.5t-18 -60.5q0 -46 33 -79t79 -33q26 0 46 10l338 154q-49 10 -80.5 50t-31.5 90v55zM1344 272q0 46 -33 79t-79 33q-26 0 -46 -10l-290 -132q-28 -13 -37 -17 t-30.5 -17t-29.5 -23.5t-16 -29t-8 -40.5q0 -50 31.5 -82t81.5 -32q20 0 38 9l352 160q30 14 48 41.5t18 60.5zM1112 1024l-650 248q-24 8 -46 8q-53 0 -90.5 -37.5t-37.5 -90.5q0 -40 22.5 -73t59.5 -47l526 -200v-64h-640q-53 0 -90.5 -37.5t-37.5 -90.5t37.5 -90.5 t90.5 -37.5h535l233 106v198q0 63 46 106l111 102h-69zM1073 0q82 0 155 19l339 85q43 11 70 45.5t27 78.5v668q0 53 -37.5 90.5t-90.5 37.5h-308l-136 -126q-36 -33 -36 -82v-296q0 -46 33 -77t79 -31t79 35t33 81v208h32v-208q0 -70 -57 -114q52 -8 86.5 -48.5t34.5 -93.5 q0 -42 -23 -78t-61 -53l-310 -141h91z" /> +<glyph unicode="" horiz-adv-x="2048" d="M1151 1536q61 0 116 -28t91 -77l572 -781q118 -159 118 -359v-355q0 -80 -56 -136t-136 -56h-384q-80 0 -136 56t-56 136v177l-286 143h-546q-80 0 -136 56t-56 136v32q0 119 84.5 203.5t203.5 84.5h420l42 128h-686q-100 0 -173.5 67.5t-81.5 166.5q-65 79 -65 182v32 q0 80 56 136t136 56h959zM1920 -64v355q0 157 -93 284l-573 781q-39 52 -103 52h-959q-26 0 -45 -19t-19 -45q0 -32 1.5 -49.5t9.5 -40.5t25 -43q10 31 35.5 50t56.5 19h832v-32h-832q-26 0 -45 -19t-19 -45q0 -44 3 -58q8 -44 44 -73t81 -29h640h91q40 0 68 -28t28 -68 q0 -15 -5 -30l-64 -192q-10 -29 -35 -47.5t-56 -18.5h-443q-66 0 -113 -47t-47 -113v-32q0 -26 19 -45t45 -19h561q16 0 29 -7l317 -158q24 -13 38.5 -36t14.5 -50v-197q0 -26 19 -45t45 -19h384q26 0 45 19t19 45z" /> +<glyph unicode="" horiz-adv-x="2048" d="M816 1408q-48 0 -79.5 -34t-31.5 -82q0 -14 3 -28l150 -624h-26l-116 482q-9 38 -39.5 62t-69.5 24q-47 0 -79 -34t-32 -81q0 -11 4 -29q3 -13 39 -161t68 -282t32 -138v-227l-307 230q-34 26 -77 26q-52 0 -89.5 -36.5t-37.5 -88.5q0 -67 56 -110l507 -379 q34 -26 76 -26h694q33 0 59 20.5t34 52.5l100 401q8 30 10 88t9 86l116 478q3 12 3 26q0 46 -33 79t-80 33q-38 0 -69 -25.5t-40 -62.5l-99 -408h-26l132 547q3 14 3 28q0 47 -32 80t-80 33q-38 0 -68.5 -24t-39.5 -62l-145 -602h-127l-164 682q-9 38 -39.5 62t-68.5 24z M1461 -256h-694q-85 0 -153 51l-507 380q-50 38 -78.5 94t-28.5 118q0 105 75 179t180 74q25 0 49.5 -5.5t41.5 -11t41 -20.5t35 -23t38.5 -29.5t37.5 -28.5l-123 512q-7 35 -7 59q0 93 60 162t152 79q14 87 80.5 144.5t155.5 57.5q83 0 148 -51.5t85 -132.5l103 -428 l83 348q20 81 85 132.5t148 51.5q87 0 152.5 -54t82.5 -139q93 -10 155 -78t62 -161q0 -30 -7 -57l-116 -477q-5 -22 -5 -67q0 -51 -13 -108l-101 -401q-19 -75 -79.5 -122.5t-137.5 -47.5z" /> +<glyph unicode="" horiz-adv-x="1792" d="M640 1408q-53 0 -90.5 -37.5t-37.5 -90.5v-512v-384l-151 202q-41 54 -107 54q-52 0 -89 -38t-37 -90q0 -43 26 -77l384 -512q38 -51 102 -51h718q22 0 39.5 13.5t22.5 34.5l92 368q24 96 24 194v217q0 41 -28 71t-68 30t-68 -28t-28 -68h-32v61q0 48 -32 81.5t-80 33.5 q-46 0 -79 -33t-33 -79v-64h-32v90q0 55 -37 94.5t-91 39.5q-53 0 -90.5 -37.5t-37.5 -90.5v-96h-32v570q0 55 -37 94.5t-91 39.5zM640 1536q107 0 181.5 -77.5t74.5 -184.5v-220q22 2 32 2q99 0 173 -69q47 21 99 21q113 0 184 -87q27 7 56 7q94 0 159 -67.5t65 -161.5 v-217q0 -116 -28 -225l-92 -368q-16 -64 -68 -104.5t-118 -40.5h-718q-60 0 -114.5 27.5t-90.5 74.5l-384 512q-51 68 -51 154q0 105 74.5 180.5t179.5 75.5q71 0 130 -35v547q0 106 75 181t181 75zM768 128v384h-32v-384h32zM1024 128v384h-32v-384h32zM1280 128v384h-32 v-384h32z" /> +<glyph unicode="" d="M1288 889q60 0 107 -23q141 -63 141 -226v-177q0 -94 -23 -186l-85 -339q-21 -86 -90.5 -140t-157.5 -54h-668q-106 0 -181 75t-75 181v401l-239 628q-17 45 -17 91q0 106 75 181t181 75q80 0 145.5 -45.5t93.5 -119.5l17 -44v113q0 106 75 181t181 75t181 -75t75 -181 v-261q27 5 48 5q69 0 127.5 -36.5t88.5 -98.5zM1072 896q-33 0 -60.5 -18t-41.5 -48l-74 -163l-71 -155h55q50 0 90 -31.5t50 -80.5l154 338q10 20 10 46q0 46 -33 79t-79 33zM1293 761q-22 0 -40.5 -8t-29 -16t-23.5 -29.5t-17 -30.5t-17 -37l-132 -290q-10 -20 -10 -46 q0 -46 33 -79t79 -33q33 0 60.5 18t41.5 48l160 352q9 18 9 38q0 50 -32 81.5t-82 31.5zM128 1120q0 -22 8 -46l248 -650v-69l102 111q43 46 106 46h198l106 233v535q0 53 -37.5 90.5t-90.5 37.5t-90.5 -37.5t-37.5 -90.5v-640h-64l-200 526q-14 37 -47 59.5t-73 22.5 q-53 0 -90.5 -37.5t-37.5 -90.5zM1180 -128q44 0 78.5 27t45.5 70l85 339q19 73 19 155v91l-141 -310q-17 -38 -53 -61t-78 -23q-53 0 -93.5 34.5t-48.5 86.5q-44 -57 -114 -57h-208v32h208q46 0 81 33t35 79t-31 79t-77 33h-296q-49 0 -82 -36l-126 -136v-308 q0 -53 37.5 -90.5t90.5 -37.5h668z" /> +<glyph unicode="" horiz-adv-x="1973" d="M857 992v-117q0 -13 -9.5 -22t-22.5 -9h-298v-812q0 -13 -9 -22.5t-22 -9.5h-135q-13 0 -22.5 9t-9.5 23v812h-297q-13 0 -22.5 9t-9.5 22v117q0 14 9 23t23 9h793q13 0 22.5 -9.5t9.5 -22.5zM1895 995l77 -961q1 -13 -8 -24q-10 -10 -23 -10h-134q-12 0 -21 8.5 t-10 20.5l-46 588l-189 -425q-8 -19 -29 -19h-120q-20 0 -29 19l-188 427l-45 -590q-1 -12 -10 -20.5t-21 -8.5h-135q-13 0 -23 10q-9 10 -9 24l78 961q1 12 10 20.5t21 8.5h142q20 0 29 -19l220 -520q10 -24 20 -51q3 7 9.5 24.5t10.5 26.5l221 520q9 19 29 19h141 q13 0 22 -8.5t10 -20.5z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1042 833q0 88 -60 121q-33 18 -117 18h-123v-281h162q66 0 102 37t36 105zM1094 548l205 -373q8 -17 -1 -31q-8 -16 -27 -16h-152q-20 0 -28 17l-194 365h-155v-350q0 -14 -9 -23t-23 -9h-134q-14 0 -23 9t-9 23v960q0 14 9 23t23 9h294q128 0 190 -24q85 -31 134 -109 t49 -180q0 -92 -42.5 -165.5t-115.5 -109.5q6 -10 9 -16zM896 1376q-150 0 -286 -58.5t-234.5 -157t-157 -234.5t-58.5 -286t58.5 -286t157 -234.5t234.5 -157t286 -58.5t286 58.5t234.5 157t157 234.5t58.5 286t-58.5 286t-157 234.5t-234.5 157t-286 58.5zM1792 640 q0 -182 -71 -348t-191 -286t-286 -191t-348 -71t-348 71t-286 191t-191 286t-71 348t71 348t191 286t286 191t348 71t348 -71t286 -191t191 -286t71 -348z" /> +<glyph unicode="" horiz-adv-x="1792" d="M605 303q153 0 257 104q14 18 3 36l-45 82q-6 13 -24 17q-16 2 -27 -11l-4 -3q-4 -4 -11.5 -10t-17.5 -13t-23.5 -14.5t-28.5 -13.5t-33.5 -9.5t-37.5 -3.5q-76 0 -125 50t-49 127q0 76 48 125.5t122 49.5q37 0 71.5 -14t50.5 -28l16 -14q11 -11 26 -10q16 2 24 14l53 78 q13 20 -2 39q-3 4 -11 12t-30 23.5t-48.5 28t-67.5 22.5t-86 10q-148 0 -246 -96.5t-98 -240.5q0 -146 97 -241.5t247 -95.5zM1235 303q153 0 257 104q14 18 4 36l-45 82q-8 14 -25 17q-16 2 -27 -11l-4 -3q-4 -4 -11.5 -10t-17.5 -13t-23.5 -14.5t-28.5 -13.5t-33.5 -9.5 t-37.5 -3.5q-76 0 -125 50t-49 127q0 76 48 125.5t122 49.5q37 0 71.5 -14t50.5 -28l16 -14q11 -11 26 -10q16 2 24 14l53 78q13 20 -2 39q-3 4 -11 12t-30 23.5t-48.5 28t-67.5 22.5t-86 10q-147 0 -245.5 -96.5t-98.5 -240.5q0 -146 97 -241.5t247 -95.5zM896 1376 q-150 0 -286 -58.5t-234.5 -157t-157 -234.5t-58.5 -286t58.5 -286t157 -234.5t234.5 -157t286 -58.5t286 58.5t234.5 157t157 234.5t58.5 286t-58.5 286t-157 234.5t-234.5 157t-286 58.5zM896 1536q182 0 348 -71t286 -191t191 -286t71 -348t-71 -348t-191 -286t-286 -191 t-348 -71t-348 71t-286 191t-191 286t-71 348t71 348t191 286t286 191t348 71z" /> +<glyph unicode="" horiz-adv-x="2048" d="M736 736l384 -384l-384 -384l-672 672l672 672l168 -168l-96 -96l-72 72l-480 -480l480 -480l193 193l-289 287zM1312 1312l672 -672l-672 -672l-168 168l96 96l72 -72l480 480l-480 480l-193 -193l289 -287l-96 -96l-384 384z" /> +<glyph unicode="" horiz-adv-x="1792" d="M717 182l271 271l-279 279l-88 -88l192 -191l-96 -96l-279 279l279 279l40 -40l87 87l-127 128l-454 -454zM1075 190l454 454l-454 454l-271 -271l279 -279l88 88l-192 191l96 96l279 -279l-279 -279l-40 40l-87 -88zM1792 640q0 -182 -71 -348t-191 -286t-286 -191 t-348 -71t-348 71t-286 191t-191 286t-71 348t71 348t191 286t286 191t348 71t348 -71t286 -191t191 -286t71 -348z" /> +<glyph unicode="" horiz-adv-x="2304" d="M651 539q0 -39 -27.5 -66.5t-65.5 -27.5q-39 0 -66.5 27.5t-27.5 66.5q0 38 27.5 65.5t66.5 27.5q38 0 65.5 -27.5t27.5 -65.5zM1805 540q0 -39 -27.5 -66.5t-66.5 -27.5t-66.5 27.5t-27.5 66.5t27.5 66t66.5 27t66.5 -27t27.5 -66zM765 539q0 79 -56.5 136t-136.5 57 t-136.5 -56.5t-56.5 -136.5t56.5 -136.5t136.5 -56.5t136.5 56.5t56.5 136.5zM1918 540q0 80 -56.5 136.5t-136.5 56.5q-79 0 -136 -56.5t-57 -136.5t56.5 -136.5t136.5 -56.5t136.5 56.5t56.5 136.5zM850 539q0 -116 -81.5 -197.5t-196.5 -81.5q-116 0 -197.5 82t-81.5 197 t82 196.5t197 81.5t196.5 -81.5t81.5 -196.5zM2004 540q0 -115 -81.5 -196.5t-197.5 -81.5q-115 0 -196.5 81.5t-81.5 196.5t81.5 196.5t196.5 81.5q116 0 197.5 -81.5t81.5 -196.5zM1040 537q0 191 -135.5 326.5t-326.5 135.5q-125 0 -231 -62t-168 -168.5t-62 -231.5 t62 -231.5t168 -168.5t231 -62q191 0 326.5 135.5t135.5 326.5zM1708 1110q-254 111 -556 111q-319 0 -573 -110q117 0 223 -45.5t182.5 -122.5t122 -183t45.5 -223q0 115 43.5 219.5t118 180.5t177.5 123t217 50zM2187 537q0 191 -135 326.5t-326 135.5t-326.5 -135.5 t-135.5 -326.5t135.5 -326.5t326.5 -135.5t326 135.5t135 326.5zM1921 1103h383q-44 -51 -75 -114.5t-40 -114.5q110 -151 110 -337q0 -156 -77 -288t-209 -208.5t-287 -76.5q-133 0 -249 56t-196 155q-47 -56 -129 -179q-11 22 -53.5 82.5t-74.5 97.5 q-80 -99 -196.5 -155.5t-249.5 -56.5q-155 0 -287 76.5t-209 208.5t-77 288q0 186 110 337q-9 51 -40 114.5t-75 114.5h365q149 100 355 156.5t432 56.5q224 0 421 -56t348 -157z" /> +<glyph unicode="" horiz-adv-x="1280" d="M640 629q-188 0 -321 133t-133 320q0 188 133 321t321 133t321 -133t133 -321q0 -187 -133 -320t-321 -133zM640 1306q-92 0 -157.5 -65.5t-65.5 -158.5q0 -92 65.5 -157.5t157.5 -65.5t157.5 65.5t65.5 157.5q0 93 -65.5 158.5t-157.5 65.5zM1163 574q13 -27 15 -49.5 t-4.5 -40.5t-26.5 -38.5t-42.5 -37t-61.5 -41.5q-115 -73 -315 -94l73 -72l267 -267q30 -31 30 -74t-30 -73l-12 -13q-31 -30 -74 -30t-74 30q-67 68 -267 268l-267 -268q-31 -30 -74 -30t-73 30l-12 13q-31 30 -31 73t31 74l267 267l72 72q-203 21 -317 94 q-39 25 -61.5 41.5t-42.5 37t-26.5 38.5t-4.5 40.5t15 49.5q10 20 28 35t42 22t56 -2t65 -35q5 -4 15 -11t43 -24.5t69 -30.5t92 -24t113 -11q91 0 174 25.5t120 50.5l38 25q33 26 65 35t56 2t42 -22t28 -35z" /> +<glyph unicode="" d="M927 956q0 -66 -46.5 -112.5t-112.5 -46.5t-112.5 46.5t-46.5 112.5t46.5 112.5t112.5 46.5t112.5 -46.5t46.5 -112.5zM1141 593q-10 20 -28 32t-47.5 9.5t-60.5 -27.5q-10 -8 -29 -20t-81 -32t-127 -20t-124 18t-86 36l-27 18q-31 25 -60.5 27.5t-47.5 -9.5t-28 -32 q-22 -45 -2 -74.5t87 -73.5q83 -53 226 -67l-51 -52q-142 -142 -191 -190q-22 -22 -22 -52.5t22 -52.5l9 -9q22 -22 52.5 -22t52.5 22l191 191q114 -115 191 -191q22 -22 52.5 -22t52.5 22l9 9q22 22 22 52.5t-22 52.5l-191 190l-52 52q141 14 225 67q67 44 87 73.5t-2 74.5 zM1092 956q0 134 -95 229t-229 95t-229 -95t-95 -229t95 -229t229 -95t229 95t95 229zM1536 1120v-960q0 -119 -84.5 -203.5t-203.5 -84.5h-960q-119 0 -203.5 84.5t-84.5 203.5v960q0 119 84.5 203.5t203.5 84.5h960q119 0 203.5 -84.5t84.5 -203.5z" /> +<glyph unicode="" horiz-adv-x="1720" d="M1565 1408q65 0 110 -45.5t45 -110.5v-519q0 -176 -68 -336t-182.5 -275t-274 -182.5t-334.5 -67.5q-176 0 -335.5 67.5t-274.5 182.5t-183 275t-68 336v519q0 64 46 110t110 46h1409zM861 344q47 0 82 33l404 388q37 35 37 85q0 49 -34.5 83.5t-83.5 34.5q-47 0 -82 -33 l-323 -310l-323 310q-35 33 -81 33q-49 0 -83.5 -34.5t-34.5 -83.5q0 -51 36 -85l405 -388q33 -33 81 -33z" /> +<glyph unicode="" horiz-adv-x="2304" d="M1494 -103l-295 695q-25 -49 -158.5 -305.5t-198.5 -389.5q-1 -1 -27.5 -0.5t-26.5 1.5q-82 193 -255.5 587t-259.5 596q-21 50 -66.5 107.5t-103.5 100.5t-102 43q0 5 -0.5 24t-0.5 27h583v-50q-39 -2 -79.5 -16t-66.5 -43t-10 -64q26 -59 216.5 -499t235.5 -540 q31 61 140 266.5t131 247.5q-19 39 -126 281t-136 295q-38 69 -201 71v50l513 -1v-47q-60 -2 -93.5 -25t-12.5 -69q33 -70 87 -189.5t86 -187.5q110 214 173 363q24 55 -10 79.5t-129 26.5q1 7 1 25v24q64 0 170.5 0.5t180 1t92.5 0.5v-49q-62 -2 -119 -33t-90 -81 l-213 -442q13 -33 127.5 -290t121.5 -274l441 1017q-14 38 -49.5 62.5t-65 31.5t-55.5 8v50l460 -4l1 -2l-1 -44q-139 -4 -201 -145q-526 -1216 -559 -1291h-49z" /> +<glyph unicode="" horiz-adv-x="1792" d="M949 643q0 -26 -16.5 -45t-41.5 -19q-26 0 -45 16.5t-19 41.5q0 26 17 45t42 19t44 -16.5t19 -41.5zM964 585l350 581q-9 -8 -67.5 -62.5t-125.5 -116.5t-136.5 -127t-117 -110.5t-50.5 -51.5l-349 -580q7 7 67 62t126 116.5t136 127t117 111t50 50.5zM1611 640 q0 -201 -104 -371q-3 2 -17 11t-26.5 16.5t-16.5 7.5q-13 0 -13 -13q0 -10 59 -44q-74 -112 -184.5 -190.5t-241.5 -110.5l-16 67q-1 10 -15 10q-5 0 -8 -5.5t-2 -9.5l16 -68q-72 -15 -146 -15q-199 0 -372 105q1 2 13 20.5t21.5 33.5t9.5 19q0 13 -13 13q-6 0 -17 -14.5 t-22.5 -34.5t-13.5 -23q-113 75 -192 187.5t-110 244.5l69 15q10 3 10 15q0 5 -5.5 8t-10.5 2l-68 -15q-14 72 -14 139q0 206 109 379q2 -1 18.5 -12t30 -19t17.5 -8q13 0 13 12q0 6 -12.5 15.5t-32.5 21.5l-20 12q77 112 189 189t244 107l15 -67q2 -10 15 -10q5 0 8 5.5 t2 10.5l-15 66q71 13 134 13q204 0 379 -109q-39 -56 -39 -65q0 -13 12 -13q11 0 48 64q111 -75 187.5 -186t107.5 -241l-56 -12q-10 -2 -10 -16q0 -5 5.5 -8t9.5 -2l57 13q14 -72 14 -140zM1696 640q0 163 -63.5 311t-170.5 255t-255 170.5t-311 63.5t-311 -63.5 t-255 -170.5t-170.5 -255t-63.5 -311t63.5 -311t170.5 -255t255 -170.5t311 -63.5t311 63.5t255 170.5t170.5 255t63.5 311zM1792 640q0 -182 -71 -348t-191 -286t-286 -191t-348 -71t-348 71t-286 191t-191 286t-71 348t71 348t191 286t286 191t348 71t348 -71t286 -191 t191 -286t71 -348z" /> +<glyph unicode="" horiz-adv-x="1792" d="M893 1536q240 2 451 -120q232 -134 352 -372l-742 39q-160 9 -294 -74.5t-185 -229.5l-276 424q128 159 311 245.5t383 87.5zM146 1131l337 -663q72 -143 211 -217t293 -45l-230 -451q-212 33 -385 157.5t-272.5 316t-99.5 411.5q0 267 146 491zM1732 962 q58 -150 59.5 -310.5t-48.5 -306t-153 -272t-246 -209.5q-230 -133 -498 -119l405 623q88 131 82.5 290.5t-106.5 277.5zM896 942q125 0 213.5 -88.5t88.5 -213.5t-88.5 -213.5t-213.5 -88.5t-213.5 88.5t-88.5 213.5t88.5 213.5t213.5 88.5z" /> +<glyph unicode="" horiz-adv-x="1792" d="M903 -256q-283 0 -504.5 150.5t-329.5 398.5q-58 131 -67 301t26 332.5t111 312t179 242.5l-11 -281q11 14 68 15.5t70 -15.5q42 81 160.5 138t234.5 59q-54 -45 -119.5 -148.5t-58.5 -163.5q25 -8 62.5 -13.5t63 -7.5t68 -4t50.5 -3q15 -5 9.5 -45.5t-30.5 -75.5 q-5 -7 -16.5 -18.5t-56.5 -35.5t-101 -34l15 -189l-139 67q-18 -43 -7.5 -81.5t36 -66.5t65.5 -41.5t81 -6.5q51 9 98 34.5t83.5 45t73.5 17.5q61 -4 89.5 -33t19.5 -65q-1 -2 -2.5 -5.5t-8.5 -12.5t-18 -15.5t-31.5 -10.5t-46.5 -1q-60 -95 -144.5 -135.5t-209.5 -29.5 q74 -61 162.5 -82.5t168.5 -6t154.5 52t128 87.5t80.5 104q43 91 39 192.5t-37.5 188.5t-78.5 125q87 -38 137 -79.5t77 -112.5q15 170 -57.5 343t-209.5 284q265 -77 412 -279.5t151 -517.5q2 -127 -40.5 -255t-123.5 -238t-189 -196t-247.5 -135.5t-288.5 -49.5z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1493 1308q-165 110 -359 110q-155 0 -293 -73t-240 -200q-75 -93 -119.5 -218t-48.5 -266v-42q4 -141 48.5 -266t119.5 -218q102 -127 240 -200t293 -73q194 0 359 110q-121 -108 -274.5 -168t-322.5 -60q-29 0 -43 1q-175 8 -333 82t-272 193t-181 281t-67 339 q0 182 71 348t191 286t286 191t348 71h3q168 -1 320.5 -60.5t273.5 -167.5zM1792 640q0 -192 -77 -362.5t-213 -296.5q-104 -63 -222 -63q-137 0 -255 84q154 56 253.5 233t99.5 405q0 227 -99 404t-253 234q119 83 254 83q119 0 226 -65q135 -125 210.5 -295t75.5 -361z " /> +<glyph unicode="" horiz-adv-x="1792" d="M1792 599q0 -56 -7 -104h-1151q0 -146 109.5 -244.5t257.5 -98.5q99 0 185.5 46.5t136.5 130.5h423q-56 -159 -170.5 -281t-267.5 -188.5t-321 -66.5q-187 0 -356 83q-228 -116 -394 -116q-237 0 -237 263q0 115 45 275q17 60 109 229q199 360 475 606 q-184 -79 -427 -354q63 274 283.5 449.5t501.5 175.5q30 0 45 -1q255 117 433 117q64 0 116 -13t94.5 -40.5t66.5 -76.5t24 -115q0 -116 -75 -286q101 -182 101 -390zM1722 1239q0 83 -53 132t-137 49q-108 0 -254 -70q121 -47 222.5 -131.5t170.5 -195.5q51 135 51 216z M128 2q0 -86 48.5 -132.5t134.5 -46.5q115 0 266 83q-122 72 -213.5 183t-137.5 245q-98 -205 -98 -332zM632 715h728q-5 142 -113 237t-251 95q-144 0 -251.5 -95t-112.5 -237z" /> +<glyph unicode="" horiz-adv-x="2048" d="M1792 288v960q0 13 -9.5 22.5t-22.5 9.5h-1600q-13 0 -22.5 -9.5t-9.5 -22.5v-960q0 -13 9.5 -22.5t22.5 -9.5h1600q13 0 22.5 9.5t9.5 22.5zM1920 1248v-960q0 -66 -47 -113t-113 -47h-736v-128h352q14 0 23 -9t9 -23v-64q0 -14 -9 -23t-23 -9h-832q-14 0 -23 9t-9 23 v64q0 14 9 23t23 9h352v128h-736q-66 0 -113 47t-47 113v960q0 66 47 113t113 47h1600q66 0 113 -47t47 -113z" /> +<glyph unicode="" horiz-adv-x="1792" d="M138 1408h197q-70 -64 -126 -149q-36 -56 -59 -115t-30 -125.5t-8.5 -120t10.5 -132t21 -126t28 -136.5q4 -19 6 -28q51 -238 81 -329q57 -171 152 -275h-272q-48 0 -82 34t-34 82v1304q0 48 34 82t82 34zM1346 1408h308q48 0 82 -34t34 -82v-1304q0 -48 -34 -82t-82 -34 h-178q212 210 196 565l-469 -101q-2 -45 -12 -82t-31 -72t-59.5 -59.5t-93.5 -36.5q-123 -26 -199 40q-32 27 -53 61t-51.5 129t-64.5 258q-35 163 -45.5 263t-5.5 139t23 77q20 41 62.5 73t102.5 45q45 12 83.5 6.5t67 -17t54 -35t43 -48t34.5 -56.5l468 100 q-68 175 -180 287z" /> +<glyph unicode="" d="M1401 -11l-6 -6q-113 -114 -259 -175q-154 -64 -317 -64q-165 0 -317 64q-148 63 -259 175q-113 112 -175 258q-42 103 -54 189q-4 28 48 36q51 8 56 -20q1 -1 1 -4q18 -90 46 -159q50 -124 152 -226q98 -98 226 -152q132 -56 276 -56q143 0 276 56q128 55 225 152l6 6 q10 10 25 6q12 -3 33 -22q36 -37 17 -58zM929 604l-66 -66l63 -63q21 -21 -7 -49q-17 -17 -32 -17q-10 0 -19 10l-62 61l-66 -66q-5 -5 -15 -5q-15 0 -31 16l-2 2q-18 15 -18 29q0 7 8 17l66 65l-66 66q-16 16 14 45q18 18 31 18q6 0 13 -5l65 -66l65 65q18 17 48 -13 q27 -27 11 -44zM1400 547q0 -118 -46 -228q-45 -105 -126 -186q-80 -80 -187 -126t-228 -46t-228 46t-187 126q-82 82 -125 186q-15 32 -15 40h-1q-9 27 43 44q50 16 60 -12q37 -99 97 -167h1v339v2q3 136 102 232q105 103 253 103q147 0 251 -103t104 -249 q0 -147 -104.5 -251t-250.5 -104q-58 0 -112 16q-28 11 -13 61q16 51 44 43l14 -3q14 -3 32.5 -6t30.5 -3q104 0 176 71.5t72 174.5q0 101 -72 171q-71 71 -175 71q-107 0 -178 -80q-64 -72 -64 -160v-413q110 -67 242 -67q96 0 185 36.5t156 103.5t103.5 155t36.5 183 q0 198 -141 339q-140 140 -339 140q-200 0 -340 -140q-53 -53 -77 -87l-2 -2q-8 -11 -13 -15.5t-21.5 -9.5t-38.5 3q-21 5 -36.5 16.5t-15.5 26.5v680q0 15 10.5 26.5t27.5 11.5h877q30 0 30 -55t-30 -55h-811v-483h1q40 42 102 84t108 61q109 46 231 46q121 0 228 -46 t187 -126q81 -81 126 -186q46 -112 46 -229zM1369 1128q9 -8 9 -18t-5.5 -18t-16.5 -21q-26 -26 -39 -26q-9 0 -16 7q-106 91 -207 133q-128 56 -276 56q-133 0 -262 -49q-27 -10 -45 37q-9 25 -8 38q3 16 16 20q130 57 299 57q164 0 316 -64q137 -58 235 -152z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1551 60q15 6 26 3t11 -17.5t-15 -33.5q-13 -16 -44 -43.5t-95.5 -68t-141 -74t-188 -58t-229.5 -24.5q-119 0 -238 31t-209 76.5t-172.5 104t-132.5 105t-84 87.5q-8 9 -10 16.5t1 12t8 7t11.5 2t11.5 -4.5q192 -117 300 -166q389 -176 799 -90q190 40 391 135z M1758 175q11 -16 2.5 -69.5t-28.5 -102.5q-34 -83 -85 -124q-17 -14 -26 -9t0 24q21 45 44.5 121.5t6.5 98.5q-5 7 -15.5 11.5t-27 6t-29.5 2.5t-35 0t-31.5 -2t-31 -3t-22.5 -2q-6 -1 -13 -1.5t-11 -1t-8.5 -1t-7 -0.5h-5.5h-4.5t-3 0.5t-2 1.5l-1.5 3q-6 16 47 40t103 30 q46 7 108 1t76 -24zM1364 618q0 -31 13.5 -64t32 -58t37.5 -46t33 -32l13 -11l-227 -224q-40 37 -79 75.5t-58 58.5l-19 20q-11 11 -25 33q-38 -59 -97.5 -102.5t-127.5 -63.5t-140 -23t-137.5 21t-117.5 65.5t-83 113t-31 162.5q0 84 28 154t72 116.5t106.5 83t122.5 57 t130 34.5t119.5 18.5t99.5 6.5v127q0 65 -21 97q-34 53 -121 53q-6 0 -16.5 -1t-40.5 -12t-56 -29.5t-56 -59.5t-48 -96l-294 27q0 60 22 119t67 113t108 95t151.5 65.5t190.5 24.5q100 0 181 -25t129.5 -61.5t81 -83t45 -86t12.5 -73.5v-589zM692 597q0 -86 70 -133 q66 -44 139 -22q84 25 114 123q14 45 14 101v162q-59 -2 -111 -12t-106.5 -33.5t-87 -71t-32.5 -114.5z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1536 1280q52 0 90 -38t38 -90v-1280q0 -52 -38 -90t-90 -38h-1408q-52 0 -90 38t-38 90v1280q0 52 38 90t90 38h128v96q0 66 47 113t113 47h64q66 0 113 -47t47 -113v-96h384v96q0 66 47 113t113 47h64q66 0 113 -47t47 -113v-96h128zM1152 1376v-288q0 -14 9 -23t23 -9 h64q14 0 23 9t9 23v288q0 14 -9 23t-23 9h-64q-14 0 -23 -9t-9 -23zM384 1376v-288q0 -14 9 -23t23 -9h64q14 0 23 9t9 23v288q0 14 -9 23t-23 9h-64q-14 0 -23 -9t-9 -23zM1536 -128v1024h-1408v-1024h1408zM896 448h224q14 0 23 -9t9 -23v-64q0 -14 -9 -23t-23 -9h-224 v-224q0 -14 -9 -23t-23 -9h-64q-14 0 -23 9t-9 23v224h-224q-14 0 -23 9t-9 23v64q0 14 9 23t23 9h224v224q0 14 9 23t23 9h64q14 0 23 -9t9 -23v-224z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1152 416v-64q0 -14 -9 -23t-23 -9h-576q-14 0 -23 9t-9 23v64q0 14 9 23t23 9h576q14 0 23 -9t9 -23zM128 -128h1408v1024h-1408v-1024zM512 1088v288q0 14 -9 23t-23 9h-64q-14 0 -23 -9t-9 -23v-288q0 -14 9 -23t23 -9h64q14 0 23 9t9 23zM1280 1088v288q0 14 -9 23 t-23 9h-64q-14 0 -23 -9t-9 -23v-288q0 -14 9 -23t23 -9h64q14 0 23 9t9 23zM1664 1152v-1280q0 -52 -38 -90t-90 -38h-1408q-52 0 -90 38t-38 90v1280q0 52 38 90t90 38h128v96q0 66 47 113t113 47h64q66 0 113 -47t47 -113v-96h384v96q0 66 47 113t113 47h64q66 0 113 -47 t47 -113v-96h128q52 0 90 -38t38 -90z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1111 151l-46 -46q-9 -9 -22 -9t-23 9l-188 189l-188 -189q-10 -9 -23 -9t-22 9l-46 46q-9 9 -9 22t9 23l189 188l-189 188q-9 10 -9 23t9 22l46 46q9 9 22 9t23 -9l188 -188l188 188q10 9 23 9t22 -9l46 -46q9 -9 9 -22t-9 -23l-188 -188l188 -188q9 -10 9 -23t-9 -22z M128 -128h1408v1024h-1408v-1024zM512 1088v288q0 14 -9 23t-23 9h-64q-14 0 -23 -9t-9 -23v-288q0 -14 9 -23t23 -9h64q14 0 23 9t9 23zM1280 1088v288q0 14 -9 23t-23 9h-64q-14 0 -23 -9t-9 -23v-288q0 -14 9 -23t23 -9h64q14 0 23 9t9 23zM1664 1152v-1280 q0 -52 -38 -90t-90 -38h-1408q-52 0 -90 38t-38 90v1280q0 52 38 90t90 38h128v96q0 66 47 113t113 47h64q66 0 113 -47t47 -113v-96h384v96q0 66 47 113t113 47h64q66 0 113 -47t47 -113v-96h128q52 0 90 -38t38 -90z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1303 572l-512 -512q-10 -9 -23 -9t-23 9l-288 288q-9 10 -9 23t9 22l46 46q9 9 22 9t23 -9l220 -220l444 444q10 9 23 9t22 -9l46 -46q9 -9 9 -22t-9 -23zM128 -128h1408v1024h-1408v-1024zM512 1088v288q0 14 -9 23t-23 9h-64q-14 0 -23 -9t-9 -23v-288q0 -14 9 -23 t23 -9h64q14 0 23 9t9 23zM1280 1088v288q0 14 -9 23t-23 9h-64q-14 0 -23 -9t-9 -23v-288q0 -14 9 -23t23 -9h64q14 0 23 9t9 23zM1664 1152v-1280q0 -52 -38 -90t-90 -38h-1408q-52 0 -90 38t-38 90v1280q0 52 38 90t90 38h128v96q0 66 47 113t113 47h64q66 0 113 -47 t47 -113v-96h384v96q0 66 47 113t113 47h64q66 0 113 -47t47 -113v-96h128q52 0 90 -38t38 -90z" /> +<glyph unicode="" horiz-adv-x="1792" d="M448 1536q26 0 45 -19t19 -45v-891l536 429q17 14 40 14q26 0 45 -19t19 -45v-379l536 429q17 14 40 14q26 0 45 -19t19 -45v-1152q0 -26 -19 -45t-45 -19h-1664q-26 0 -45 19t-19 45v1664q0 26 19 45t45 19h384z" /> +<glyph unicode="" horiz-adv-x="1024" d="M512 448q66 0 128 15v-655q0 -26 -19 -45t-45 -19h-128q-26 0 -45 19t-19 45v655q61 -15 128 -15zM512 1536q212 0 362 -150t150 -362t-150 -362t-362 -150t-362 150t-150 362t150 362t362 150zM512 1312q14 0 23 9t9 23t-9 23t-23 9q-146 0 -249 -103t-103 -249 q0 -14 9 -23t23 -9t23 9t9 23q0 119 84.5 203.5t203.5 84.5z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1745 1239q10 -10 10 -23t-10 -23l-141 -141q-28 -28 -68 -28h-1344q-26 0 -45 19t-19 45v256q0 26 19 45t45 19h576v64q0 26 19 45t45 19h128q26 0 45 -19t19 -45v-64h512q40 0 68 -28zM768 320h256v-512q0 -26 -19 -45t-45 -19h-128q-26 0 -45 19t-19 45v512zM1600 768 q26 0 45 -19t19 -45v-256q0 -26 -19 -45t-45 -19h-1344q-40 0 -68 28l-141 141q-10 10 -10 23t10 23l141 141q28 28 68 28h512v192h256v-192h576z" /> +<glyph unicode="" horiz-adv-x="2048" d="M2020 1525q28 -20 28 -53v-1408q0 -20 -11 -36t-29 -23l-640 -256q-24 -11 -48 0l-616 246l-616 -246q-10 -5 -24 -5q-19 0 -36 11q-28 20 -28 53v1408q0 20 11 36t29 23l640 256q24 11 48 0l616 -246l616 246q32 13 60 -6zM736 1390v-1270l576 -230v1270zM128 1173 v-1270l544 217v1270zM1920 107v1270l-544 -217v-1270z" /> +<glyph unicode="" horiz-adv-x="1792" d="M512 1536q13 0 22.5 -9.5t9.5 -22.5v-1472q0 -20 -17 -28l-480 -256q-7 -4 -15 -4q-13 0 -22.5 9.5t-9.5 22.5v1472q0 20 17 28l480 256q7 4 15 4zM1760 1536q13 0 22.5 -9.5t9.5 -22.5v-1472q0 -20 -17 -28l-480 -256q-7 -4 -15 -4q-13 0 -22.5 9.5t-9.5 22.5v1472 q0 20 17 28l480 256q7 4 15 4zM640 1536q8 0 14 -3l512 -256q18 -10 18 -29v-1472q0 -13 -9.5 -22.5t-22.5 -9.5q-8 0 -14 3l-512 256q-18 10 -18 29v1472q0 13 9.5 22.5t22.5 9.5z" /> +<glyph unicode="" horiz-adv-x="1792" d="M640 640q0 53 -37.5 90.5t-90.5 37.5t-90.5 -37.5t-37.5 -90.5t37.5 -90.5t90.5 -37.5t90.5 37.5t37.5 90.5zM1024 640q0 53 -37.5 90.5t-90.5 37.5t-90.5 -37.5t-37.5 -90.5t37.5 -90.5t90.5 -37.5t90.5 37.5t37.5 90.5zM1408 640q0 53 -37.5 90.5t-90.5 37.5 t-90.5 -37.5t-37.5 -90.5t37.5 -90.5t90.5 -37.5t90.5 37.5t37.5 90.5zM1792 640q0 -174 -120 -321.5t-326 -233t-450 -85.5q-110 0 -211 18q-173 -173 -435 -229q-52 -10 -86 -13q-12 -1 -22 6t-13 18q-4 15 20 37q5 5 23.5 21.5t25.5 23.5t23.5 25.5t24 31.5t20.5 37 t20 48t14.5 57.5t12.5 72.5q-146 90 -229.5 216.5t-83.5 269.5q0 174 120 321.5t326 233t450 85.5t450 -85.5t326 -233t120 -321.5z" /> +<glyph unicode="" horiz-adv-x="1792" d="M640 640q0 -53 -37.5 -90.5t-90.5 -37.5t-90.5 37.5t-37.5 90.5t37.5 90.5t90.5 37.5t90.5 -37.5t37.5 -90.5zM1024 640q0 -53 -37.5 -90.5t-90.5 -37.5t-90.5 37.5t-37.5 90.5t37.5 90.5t90.5 37.5t90.5 -37.5t37.5 -90.5zM1408 640q0 -53 -37.5 -90.5t-90.5 -37.5 t-90.5 37.5t-37.5 90.5t37.5 90.5t90.5 37.5t90.5 -37.5t37.5 -90.5zM896 1152q-204 0 -381.5 -69.5t-282 -187.5t-104.5 -255q0 -112 71.5 -213.5t201.5 -175.5l87 -50l-27 -96q-24 -91 -70 -172q152 63 275 171l43 38l57 -6q69 -8 130 -8q204 0 381.5 69.5t282 187.5 t104.5 255t-104.5 255t-282 187.5t-381.5 69.5zM1792 640q0 -174 -120 -321.5t-326 -233t-450 -85.5q-70 0 -145 8q-198 -175 -460 -242q-49 -14 -114 -22h-5q-15 0 -27 10.5t-16 27.5v1q-3 4 -0.5 12t2 10t4.5 9.5l6 9t7 8.5t8 9q7 8 31 34.5t34.5 38t31 39.5t32.5 51 t27 59t26 76q-157 89 -247.5 220t-90.5 281q0 130 71 248.5t191 204.5t286 136.5t348 50.5t348 -50.5t286 -136.5t191 -204.5t71 -248.5z" /> +<glyph unicode="" horiz-adv-x="1024" d="M512 345l512 295v-591l-512 -296v592zM0 640v-591l512 296zM512 1527v-591l-512 -296v591zM512 936l512 295v-591z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1709 1018q-10 -236 -332 -651q-333 -431 -562 -431q-142 0 -240 263q-44 160 -132 482q-72 262 -157 262q-18 0 -127 -76l-77 98q24 21 108 96.5t130 115.5q156 138 241 146q95 9 153 -55.5t81 -203.5q44 -287 66 -373q55 -249 120 -249q51 0 154 161q101 161 109 246 q13 139 -109 139q-57 0 -121 -26q120 393 459 382q251 -8 236 -326z" /> +<glyph unicode="" d="M0 1408h1536v-1536h-1536v1536zM1085 293l-221 631l221 297h-634l221 -297l-221 -631l317 -304z" /> +<glyph unicode="" d="M0 1408h1536v-1536h-1536v1536zM908 1088l-12 -33l75 -83l-31 -114l25 -25l107 57l107 -57l25 25l-31 114l75 83l-12 33h-95l-53 96h-32l-53 -96h-95zM641 925q32 0 44.5 -16t11.5 -63l174 21q0 55 -17.5 92.5t-50.5 56t-69 25.5t-85 7q-133 0 -199 -57.5t-66 -182.5v-72 h-96v-128h76q20 0 20 -8v-382q0 -14 -5 -20t-18 -7l-73 -7v-88h448v86l-149 14q-6 1 -8.5 1.5t-3.5 2.5t-0.5 4t1 7t0.5 10v387h191l38 128h-231q-6 0 -2 6t4 9v80q0 27 1.5 40.5t7.5 28t19.5 20t36.5 5.5zM1248 96v86l-54 9q-7 1 -9.5 2.5t-2.5 3t1 7.5t1 12v520h-275 l-23 -101l83 -22q23 -7 23 -27v-370q0 -14 -6 -18.5t-20 -6.5l-70 -9v-86h352z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1792 690q0 -58 -29.5 -105.5t-79.5 -72.5q12 -46 12 -96q0 -155 -106.5 -287t-290.5 -208.5t-400 -76.5t-399.5 76.5t-290 208.5t-106.5 287q0 47 11 94q-51 25 -82 73.5t-31 106.5q0 82 58 140.5t141 58.5q85 0 145 -63q218 152 515 162l116 521q3 13 15 21t26 5 l369 -81q18 37 54 59.5t79 22.5q62 0 106 -43.5t44 -105.5t-44 -106t-106 -44t-105.5 43.5t-43.5 105.5l-334 74l-104 -472q300 -9 519 -160q58 61 143 61q83 0 141 -58.5t58 -140.5zM418 491q0 -62 43.5 -106t105.5 -44t106 44t44 106t-44 105.5t-106 43.5q-61 0 -105 -44 t-44 -105zM1228 136q11 11 11 26t-11 26q-10 10 -25 10t-26 -10q-41 -42 -121 -62t-160 -20t-160 20t-121 62q-11 10 -26 10t-25 -10q-11 -10 -11 -25.5t11 -26.5q43 -43 118.5 -68t122.5 -29.5t91 -4.5t91 4.5t122.5 29.5t118.5 68zM1225 341q62 0 105.5 44t43.5 106 q0 61 -44 105t-105 44q-62 0 -106 -43.5t-44 -105.5t44 -106t106 -44z" /> +<glyph unicode="" horiz-adv-x="1792" d="M69 741h1q16 126 58.5 241.5t115 217t167.5 176t223.5 117.5t276.5 43q231 0 414 -105.5t294 -303.5q104 -187 104 -442v-188h-1125q1 -111 53.5 -192.5t136.5 -122.5t189.5 -57t213 -3t208 46.5t173.5 84.5v-377q-92 -55 -229.5 -92t-312.5 -38t-316 53 q-189 73 -311.5 249t-124.5 372q-3 242 111 412t325 268q-48 -60 -78 -125.5t-46 -159.5h635q8 77 -8 140t-47 101.5t-70.5 66.5t-80.5 41t-75 20.5t-56 8.5l-22 1q-135 -5 -259.5 -44.5t-223.5 -104.5t-176 -140.5t-138 -163.5z" /> +<glyph unicode="" horiz-adv-x="2304" d="M0 32v608h2304v-608q0 -66 -47 -113t-113 -47h-1984q-66 0 -113 47t-47 113zM640 256v-128h384v128h-384zM256 256v-128h256v128h-256zM2144 1408q66 0 113 -47t47 -113v-224h-2304v224q0 66 47 113t113 47h1984z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1549 857q55 0 85.5 -28.5t30.5 -83.5t-34 -82t-91 -27h-136v-177h-25v398h170zM1710 267l-4 -11l-5 -10q-113 -230 -330.5 -366t-474.5 -136q-182 0 -348 71t-286 191t-191 286t-71 348t71 348t191 286t286 191t348 71q244 0 454.5 -124t329.5 -338l2 -4l8 -16 q-30 -15 -136.5 -68.5t-163.5 -84.5q-6 -3 -479 -268q384 -183 799 -366zM896 -234q250 0 462.5 132.5t322.5 357.5l-287 129q-72 -140 -206 -222t-292 -82q-151 0 -280 75t-204 204t-75 280t75 280t204 204t280 75t280 -73.5t204 -204.5l280 143q-116 208 -321 329 t-443 121q-119 0 -232.5 -31.5t-209 -87.5t-176.5 -137t-137 -176.5t-87.5 -209t-31.5 -232.5t31.5 -232.5t87.5 -209t137 -176.5t176.5 -137t209 -87.5t232.5 -31.5z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1427 827l-614 386l92 151h855zM405 562l-184 116v858l1183 -743zM1424 697l147 -95v-858l-532 335zM1387 718l-500 -802h-855l356 571z" /> +<glyph unicode="" horiz-adv-x="1792" d="M640 528v224q0 16 -16 16h-96q-16 0 -16 -16v-224q0 -16 16 -16h96q16 0 16 16zM1152 528v224q0 16 -16 16h-96q-16 0 -16 -16v-224q0 -16 16 -16h96q16 0 16 16zM1664 496v-752h-640v320q0 80 -56 136t-136 56t-136 -56t-56 -136v-320h-640v752q0 16 16 16h96 q16 0 16 -16v-112h128v624q0 16 16 16h96q16 0 16 -16v-112h128v112q0 16 16 16h96q16 0 16 -16v-112h128v112q0 6 2.5 9.5t8.5 5t9.5 2t11.5 0t9 -0.5v391q-32 15 -32 50q0 23 16.5 39t38.5 16t38.5 -16t16.5 -39q0 -35 -32 -50v-17q45 10 83 10q21 0 59.5 -7.5t54.5 -7.5 q17 0 47 7.5t37 7.5q16 0 16 -16v-210q0 -15 -35 -21.5t-62 -6.5q-18 0 -54.5 7.5t-55.5 7.5q-40 0 -90 -12v-133q1 0 9 0.5t11.5 0t9.5 -2t8.5 -5t2.5 -9.5v-112h128v112q0 16 16 16h96q16 0 16 -16v-112h128v112q0 16 16 16h96q16 0 16 -16v-624h128v112q0 16 16 16h96 q16 0 16 -16z" /> +<glyph unicode="" horiz-adv-x="2304" d="M2288 731q16 -8 16 -27t-16 -27l-320 -192q-8 -5 -16 -5q-9 0 -16 4q-16 10 -16 28v128h-858q37 -58 83 -165q16 -37 24.5 -55t24 -49t27 -47t27 -34t31.5 -26t33 -8h96v96q0 14 9 23t23 9h320q14 0 23 -9t9 -23v-320q0 -14 -9 -23t-23 -9h-320q-14 0 -23 9t-9 23v96h-96 q-32 0 -61 10t-51 23.5t-45 40.5t-37 46t-33.5 57t-28.5 57.5t-28 60.5q-23 53 -37 81.5t-36 65t-44.5 53.5t-46.5 17h-360q-22 -84 -91 -138t-157 -54q-106 0 -181 75t-75 181t75 181t181 75q88 0 157 -54t91 -138h104q24 0 46.5 17t44.5 53.5t36 65t37 81.5q19 41 28 60.5 t28.5 57.5t33.5 57t37 46t45 40.5t51 23.5t61 10h107q21 57 70 92.5t111 35.5q80 0 136 -56t56 -136t-56 -136t-136 -56q-62 0 -111 35.5t-70 92.5h-107q-17 0 -33 -8t-31.5 -26t-27 -34t-27 -47t-24 -49t-24.5 -55q-46 -107 -83 -165h1114v128q0 18 16 28t32 -1z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1150 774q0 -56 -39.5 -95t-95.5 -39h-253v269h253q56 0 95.5 -39.5t39.5 -95.5zM1329 774q0 130 -91.5 222t-222.5 92h-433v-896h180v269h253q130 0 222 91.5t92 221.5zM1792 640q0 -182 -71 -348t-191 -286t-286 -191t-348 -71t-348 71t-286 191t-191 286t-71 348 t71 348t191 286t286 191t348 71t348 -71t286 -191t191 -286t71 -348z" /> +<glyph unicode="" horiz-adv-x="2304" d="M1645 438q0 59 -34 106.5t-87 68.5q-7 -45 -23 -92q-7 -24 -27.5 -38t-44.5 -14q-12 0 -24 3q-31 10 -45 38.5t-4 58.5q23 71 23 143q0 123 -61 227.5t-166 165.5t-228 61q-134 0 -247 -73t-167 -194q108 -28 188 -106q22 -23 22 -55t-22 -54t-54 -22t-55 22 q-75 75 -180 75q-106 0 -181 -74.5t-75 -180.5t75 -180.5t181 -74.5h1046q79 0 134.5 55.5t55.5 133.5zM1798 438q0 -142 -100.5 -242t-242.5 -100h-1046q-169 0 -289 119.5t-120 288.5q0 153 100 267t249 136q62 184 221 298t354 114q235 0 408.5 -158.5t196.5 -389.5 q116 -25 192.5 -118.5t76.5 -214.5zM2048 438q0 -175 -97 -319q-23 -33 -64 -33q-24 0 -43 13q-26 17 -32 48.5t12 57.5q71 104 71 233t-71 233q-18 26 -12 57t32 49t57.5 11.5t49.5 -32.5q97 -142 97 -318zM2304 438q0 -244 -134 -443q-23 -34 -64 -34q-23 0 -42 13 q-26 18 -32.5 49t11.5 57q108 164 108 358q0 195 -108 357q-18 26 -11.5 57.5t32.5 48.5q26 18 57 12t49 -33q134 -198 134 -442z" /> +<glyph unicode="" d="M1500 -13q0 -89 -63 -152.5t-153 -63.5t-153.5 63.5t-63.5 152.5q0 90 63.5 153.5t153.5 63.5t153 -63.5t63 -153.5zM1267 268q-115 -15 -192.5 -102.5t-77.5 -205.5q0 -74 33 -138q-146 -78 -379 -78q-109 0 -201 21t-153.5 54.5t-110.5 76.5t-76 85t-44.5 83 t-23.5 66.5t-6 39.5q0 19 4.5 42.5t18.5 56t36.5 58t64 43.5t94.5 18t94 -17.5t63 -41t35.5 -53t17.5 -49t4 -33.5q0 -34 -23 -81q28 -27 82 -42t93 -17l40 -1q115 0 190 51t75 133q0 26 -9 48.5t-31.5 44.5t-49.5 41t-74 44t-93.5 47.5t-119.5 56.5q-28 13 -43 20 q-116 55 -187 100t-122.5 102t-72 125.5t-20.5 162.5q0 78 20.5 150t66 137.5t112.5 114t166.5 77t221.5 28.5q120 0 220 -26t164.5 -67t109.5 -94t64 -105.5t19 -103.5q0 -46 -15 -82.5t-36.5 -58t-48.5 -36t-49 -19.5t-39 -5h-8h-32t-39 5t-44 14t-41 28t-37 46t-24 70.5 t-10 97.5q-15 16 -59 25.5t-81 10.5l-37 1q-68 0 -117.5 -31t-70.5 -70t-21 -76q0 -24 5 -43t24 -46t53 -51t97 -53.5t150 -58.5q76 -25 138.5 -53.5t109 -55.5t83 -59t60.5 -59.5t41 -62.5t26.5 -62t14.5 -63.5t6 -62t1 -62.5z" /> +<glyph unicode="" d="M704 352v576q0 14 -9 23t-23 9h-256q-14 0 -23 -9t-9 -23v-576q0 -14 9 -23t23 -9h256q14 0 23 9t9 23zM1152 352v576q0 14 -9 23t-23 9h-256q-14 0 -23 -9t-9 -23v-576q0 -14 9 -23t23 -9h256q14 0 23 9t9 23zM1536 640q0 -209 -103 -385.5t-279.5 -279.5t-385.5 -103 t-385.5 103t-279.5 279.5t-103 385.5t103 385.5t279.5 279.5t385.5 103t385.5 -103t279.5 -279.5t103 -385.5z" /> +<glyph unicode="" d="M768 1408q209 0 385.5 -103t279.5 -279.5t103 -385.5t-103 -385.5t-279.5 -279.5t-385.5 -103t-385.5 103t-279.5 279.5t-103 385.5t103 385.5t279.5 279.5t385.5 103zM768 96q148 0 273 73t198 198t73 273t-73 273t-198 198t-273 73t-273 -73t-198 -198t-73 -273 t73 -273t198 -198t273 -73zM864 320q-14 0 -23 9t-9 23v576q0 14 9 23t23 9h192q14 0 23 -9t9 -23v-576q0 -14 -9 -23t-23 -9h-192zM480 320q-14 0 -23 9t-9 23v576q0 14 9 23t23 9h192q14 0 23 -9t9 -23v-576q0 -14 -9 -23t-23 -9h-192z" /> +<glyph unicode="" d="M1088 352v576q0 14 -9 23t-23 9h-576q-14 0 -23 -9t-9 -23v-576q0 -14 9 -23t23 -9h576q14 0 23 9t9 23zM1536 640q0 -209 -103 -385.5t-279.5 -279.5t-385.5 -103t-385.5 103t-279.5 279.5t-103 385.5t103 385.5t279.5 279.5t385.5 103t385.5 -103t279.5 -279.5 t103 -385.5z" /> +<glyph unicode="" d="M768 1408q209 0 385.5 -103t279.5 -279.5t103 -385.5t-103 -385.5t-279.5 -279.5t-385.5 -103t-385.5 103t-279.5 279.5t-103 385.5t103 385.5t279.5 279.5t385.5 103zM768 96q148 0 273 73t198 198t73 273t-73 273t-198 198t-273 73t-273 -73t-198 -198t-73 -273 t73 -273t198 -198t273 -73zM480 320q-14 0 -23 9t-9 23v576q0 14 9 23t23 9h576q14 0 23 -9t9 -23v-576q0 -14 -9 -23t-23 -9h-576z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1757 128l35 -313q3 -28 -16 -50q-19 -21 -48 -21h-1664q-29 0 -48 21q-19 22 -16 50l35 313h1722zM1664 967l86 -775h-1708l86 775q3 24 21 40.5t43 16.5h256v-128q0 -53 37.5 -90.5t90.5 -37.5t90.5 37.5t37.5 90.5v128h384v-128q0 -53 37.5 -90.5t90.5 -37.5 t90.5 37.5t37.5 90.5v128h256q25 0 43 -16.5t21 -40.5zM1280 1152v-256q0 -26 -19 -45t-45 -19t-45 19t-19 45v256q0 106 -75 181t-181 75t-181 -75t-75 -181v-256q0 -26 -19 -45t-45 -19t-45 19t-19 45v256q0 159 112.5 271.5t271.5 112.5t271.5 -112.5t112.5 -271.5z" /> +<glyph unicode="" horiz-adv-x="2048" d="M1920 768q53 0 90.5 -37.5t37.5 -90.5t-37.5 -90.5t-90.5 -37.5h-15l-115 -662q-8 -46 -44 -76t-82 -30h-1280q-46 0 -82 30t-44 76l-115 662h-15q-53 0 -90.5 37.5t-37.5 90.5t37.5 90.5t90.5 37.5h1792zM485 -32q26 2 43.5 22.5t15.5 46.5l-32 416q-2 26 -22.5 43.5 t-46.5 15.5t-43.5 -22.5t-15.5 -46.5l32 -416q2 -25 20.5 -42t43.5 -17h5zM896 32v416q0 26 -19 45t-45 19t-45 -19t-19 -45v-416q0 -26 19 -45t45 -19t45 19t19 45zM1280 32v416q0 26 -19 45t-45 19t-45 -19t-19 -45v-416q0 -26 19 -45t45 -19t45 19t19 45zM1632 27l32 416 q2 26 -15.5 46.5t-43.5 22.5t-46.5 -15.5t-22.5 -43.5l-32 -416q-2 -26 15.5 -46.5t43.5 -22.5h5q25 0 43.5 17t20.5 42zM476 1244l-93 -412h-132l101 441q19 88 89 143.5t160 55.5h167q0 26 19 45t45 19h384q26 0 45 -19t19 -45h167q90 0 160 -55.5t89 -143.5l101 -441 h-132l-93 412q-11 44 -45.5 72t-79.5 28h-167q0 -26 -19 -45t-45 -19h-384q-26 0 -45 19t-19 45h-167q-45 0 -79.5 -28t-45.5 -72z" /> +<glyph unicode="" horiz-adv-x="1792" d="M991 512l64 256h-254l-64 -256h254zM1759 1016l-56 -224q-7 -24 -31 -24h-327l-64 -256h311q15 0 25 -12q10 -14 6 -28l-56 -224q-5 -24 -31 -24h-327l-81 -328q-7 -24 -31 -24h-224q-16 0 -26 12q-9 12 -6 28l78 312h-254l-81 -328q-7 -24 -31 -24h-225q-15 0 -25 12 q-9 12 -6 28l78 312h-311q-15 0 -25 12q-9 12 -6 28l56 224q7 24 31 24h327l64 256h-311q-15 0 -25 12q-10 14 -6 28l56 224q5 24 31 24h327l81 328q7 24 32 24h224q15 0 25 -12q9 -12 6 -28l-78 -312h254l81 328q7 24 32 24h224q15 0 25 -12q9 -12 6 -28l-78 -312h311 q15 0 25 -12q9 -12 6 -28z" /> +<glyph unicode="" d="M841 483l148 -148l-149 -149zM840 1094l149 -149l-148 -148zM710 -130l464 464l-306 306l306 306l-464 464v-611l-255 255l-93 -93l320 -321l-320 -321l93 -93l255 255v-611zM1429 640q0 -209 -32 -365.5t-87.5 -257t-140.5 -162.5t-181.5 -86.5t-219.5 -24.5 t-219.5 24.5t-181.5 86.5t-140.5 162.5t-87.5 257t-32 365.5t32 365.5t87.5 257t140.5 162.5t181.5 86.5t219.5 24.5t219.5 -24.5t181.5 -86.5t140.5 -162.5t87.5 -257t32 -365.5z" /> +<glyph unicode="" horiz-adv-x="1024" d="M596 113l173 172l-173 172v-344zM596 823l173 172l-173 172v-344zM628 640l356 -356l-539 -540v711l-297 -296l-108 108l372 373l-372 373l108 108l297 -296v711l539 -540z" /> +<glyph unicode="" d="M1280 256q0 52 -38 90t-90 38t-90 -38t-38 -90t38 -90t90 -38t90 38t38 90zM512 1024q0 52 -38 90t-90 38t-90 -38t-38 -90t38 -90t90 -38t90 38t38 90zM1536 256q0 -159 -112.5 -271.5t-271.5 -112.5t-271.5 112.5t-112.5 271.5t112.5 271.5t271.5 112.5t271.5 -112.5 t112.5 -271.5zM1440 1344q0 -20 -13 -38l-1056 -1408q-19 -26 -51 -26h-160q-26 0 -45 19t-19 45q0 20 13 38l1056 1408q19 26 51 26h160q26 0 45 -19t19 -45zM768 1024q0 -159 -112.5 -271.5t-271.5 -112.5t-271.5 112.5t-112.5 271.5t112.5 271.5t271.5 112.5 t271.5 -112.5t112.5 -271.5z" /> +<glyph unicode="" horiz-adv-x="1792" d="M104 830l792 -1015l-868 630q-18 13 -25 34.5t0 42.5l101 308v0zM566 830h660l-330 -1015v0zM368 1442l198 -612h-462l198 612q8 23 33 23t33 -23zM1688 830l101 -308q7 -21 0 -42.5t-25 -34.5l-868 -630l792 1015v0zM1688 830h-462l198 612q8 23 33 23t33 -23z" /> +<glyph unicode="" horiz-adv-x="1792" d="M384 704h160v224h-160v-224zM1221 372v92q-104 -36 -243 -38q-135 -1 -259.5 46.5t-220.5 122.5l1 -96q88 -80 212 -128.5t272 -47.5q129 0 238 49zM640 704h640v224h-640v-224zM1792 736q0 -187 -99 -352q89 -102 89 -229q0 -157 -129.5 -268t-313.5 -111 q-122 0 -225 52.5t-161 140.5q-19 -1 -57 -1t-57 1q-58 -88 -161 -140.5t-225 -52.5q-184 0 -313.5 111t-129.5 268q0 127 89 229q-99 165 -99 352q0 209 120 385.5t326.5 279.5t449.5 103t449.5 -103t326.5 -279.5t120 -385.5z" /> +<glyph unicode="" d="M515 625v-128h-252v128h252zM515 880v-127h-252v127h252zM1273 369v-128h-341v128h341zM1273 625v-128h-672v128h672zM1273 880v-127h-672v127h672zM1408 20v1240q0 8 -6 14t-14 6h-32l-378 -256l-210 171l-210 -171l-378 256h-32q-8 0 -14 -6t-6 -14v-1240q0 -8 6 -14 t14 -6h1240q8 0 14 6t6 14zM553 1130l185 150h-406zM983 1130l221 150h-406zM1536 1260v-1240q0 -62 -43 -105t-105 -43h-1240q-62 0 -105 43t-43 105v1240q0 62 43 105t105 43h1240q62 0 105 -43t43 -105z" /> +<glyph unicode="" horiz-adv-x="1792" d="M896 720q-104 196 -160 278q-139 202 -347 318q-34 19 -70 36q-89 40 -94 32t34 -38l39 -31q62 -43 112.5 -93.5t94.5 -116.5t70.5 -113t70.5 -131q9 -17 13 -25q44 -84 84 -153t98 -154t115.5 -150t131 -123.5t148.5 -90.5q153 -66 154 -60q1 3 -49 37q-53 36 -81 57 q-77 58 -179 211t-185 310zM549 177q-76 60 -132.5 125t-98 143.5t-71 154.5t-58.5 186t-52 209t-60.5 252t-76.5 289q273 0 497.5 -36t379 -92t271 -144.5t185.5 -172.5t110 -198.5t56 -199.5t12.5 -198.5t-9.5 -173t-20 -143.5t-13 -107l323 -327h-104l-281 285 q-22 -2 -91.5 -14t-121.5 -19t-138 -6t-160.5 17t-167.5 59t-179 111z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1374 879q-6 26 -28.5 39.5t-48.5 7.5q-261 -62 -401 -62t-401 62q-26 6 -48.5 -7.5t-28.5 -39.5t7.5 -48.5t39.5 -28.5q194 -46 303 -58q-2 -158 -15.5 -269t-26.5 -155.5t-41 -115.5l-9 -21q-10 -25 1 -49t36 -34q9 -4 23 -4q44 0 60 41l8 20q54 139 71 259h42 q17 -120 71 -259l8 -20q16 -41 60 -41q14 0 23 4q25 10 36 34t1 49l-9 21q-28 71 -41 115.5t-26.5 155.5t-15.5 269q109 12 303 58q26 6 39.5 28.5t7.5 48.5zM1024 1024q0 53 -37.5 90.5t-90.5 37.5t-90.5 -37.5t-37.5 -90.5t37.5 -90.5t90.5 -37.5t90.5 37.5t37.5 90.5z M1600 640q0 -143 -55.5 -273.5t-150 -225t-225 -150t-273.5 -55.5t-273.5 55.5t-225 150t-150 225t-55.5 273.5t55.5 273.5t150 225t225 150t273.5 55.5t273.5 -55.5t225 -150t150 -225t55.5 -273.5zM896 1408q-156 0 -298 -61t-245 -164t-164 -245t-61 -298t61 -298 t164 -245t245 -164t298 -61t298 61t245 164t164 245t61 298t-61 298t-164 245t-245 164t-298 61zM1792 640q0 -182 -71 -348t-191 -286t-286 -191t-348 -71t-348 71t-286 191t-191 286t-71 348t71 348t191 286t286 191t348 71t348 -71t286 -191t191 -286t71 -348z" /> +<glyph unicode="" d="M1438 723q34 -35 29 -82l-44 -551q-4 -42 -34.5 -70t-71.5 -28q-6 0 -9 1q-44 3 -72.5 36.5t-25.5 77.5l35 429l-143 -8q55 -113 55 -240q0 -216 -148 -372l-137 137q91 101 91 235q0 145 -102.5 248t-247.5 103q-134 0 -236 -92l-137 138q120 114 284 141l264 300 l-149 87l-181 -161q-33 -30 -77 -27.5t-73 35.5t-26.5 77t34.5 73l239 213q26 23 60 26.5t64 -14.5l488 -283q36 -21 48 -68q17 -67 -26 -117l-205 -232l371 20q49 3 83 -32zM1240 1180q-74 0 -126 52t-52 126t52 126t126 52t126.5 -52t52.5 -126t-52.5 -126t-126.5 -52z M613 -62q106 0 196 61l139 -139q-146 -116 -335 -116q-148 0 -273.5 73t-198.5 198t-73 273q0 188 116 336l139 -139q-60 -88 -60 -197q0 -145 102.5 -247.5t247.5 -102.5z" /> +<glyph unicode="" d="M880 336v-160q0 -14 -9 -23t-23 -9h-160q-14 0 -23 9t-9 23v160q0 14 9 23t23 9h160q14 0 23 -9t9 -23zM1136 832q0 -50 -15 -90t-45.5 -69t-52 -44t-59.5 -36q-32 -18 -46.5 -28t-26 -24t-11.5 -29v-32q0 -14 -9 -23t-23 -9h-160q-14 0 -23 9t-9 23v68q0 35 10.5 64.5 t24 47.5t39 35.5t41 25.5t44.5 21q53 25 75 43t22 49q0 42 -43.5 71.5t-95.5 29.5q-56 0 -95 -27q-29 -20 -80 -83q-9 -12 -25 -12q-11 0 -19 6l-108 82q-10 7 -12 20t5 23q122 192 349 192q129 0 238.5 -89.5t109.5 -214.5zM768 1280q-130 0 -248.5 -51t-204 -136.5 t-136.5 -204t-51 -248.5t51 -248.5t136.5 -204t204 -136.5t248.5 -51t248.5 51t204 136.5t136.5 204t51 248.5t-51 248.5t-136.5 204t-204 136.5t-248.5 51zM1536 640q0 -209 -103 -385.5t-279.5 -279.5t-385.5 -103t-385.5 103t-279.5 279.5t-103 385.5t103 385.5 t279.5 279.5t385.5 103t385.5 -103t279.5 -279.5t103 -385.5z" /> +<glyph unicode="" horiz-adv-x="1408" d="M366 1225q-64 0 -110 45.5t-46 110.5q0 64 46 109.5t110 45.5t109.5 -45.5t45.5 -109.5q0 -65 -45.5 -110.5t-109.5 -45.5zM917 583q0 -50 -30 -67.5t-63.5 -6.5t-47.5 34l-367 438q-7 12 -14 15.5t-11 1.5l-3 -3q-7 -8 4 -21l122 -139l1 -354l-161 -457 q-67 -192 -92 -234q-16 -26 -28 -32q-50 -26 -103 -1q-29 13 -41.5 43t-9.5 57q2 17 197 618l5 416l-85 -164l35 -222q4 -24 -1 -42t-14 -27.5t-19 -16t-17 -7.5l-7 -2q-19 -3 -34.5 3t-24 16t-14 22t-7.5 19.5t-2 9.5l-46 299l211 381q23 34 113 34q75 0 107 -40l424 -521 q7 -5 14 -17l3 -3l-1 -1q7 -13 7 -29zM514 433q43 -113 88.5 -225t69.5 -168l24 -55q36 -93 42 -125q11 -70 -36 -97q-35 -22 -66 -16t-51 22t-29 35h-1q-6 16 -8 25l-124 351zM1338 -159q31 -49 31 -57q0 -5 -3 -7q-9 -5 -14.5 0.5t-15.5 26t-16 30.5q-114 172 -423 661 q3 -1 7 1t7 4l3 2q11 9 11 17z" /> +<glyph unicode="" horiz-adv-x="2304" d="M504 542h171l-1 265zM1530 641q0 87 -50.5 140t-146.5 53h-54v-388h52q91 0 145 57t54 138zM956 1018l1 -756q0 -14 -9.5 -24t-23.5 -10h-216q-14 0 -23.5 10t-9.5 24v62h-291l-55 -81q-10 -15 -28 -15h-267q-21 0 -30.5 18t3.5 35l556 757q9 14 27 14h332q14 0 24 -10 t10 -24zM1783 641q0 -193 -125.5 -303t-324.5 -110h-270q-14 0 -24 10t-10 24v756q0 14 10 24t24 10h268q200 0 326 -109t126 -302zM1939 640q0 -11 -0.5 -29t-8 -71.5t-21.5 -102t-44.5 -108t-73.5 -102.5h-51q38 45 66.5 104.5t41.5 112t21 98t9 72.5l1 27q0 8 -0.5 22.5 t-7.5 60t-20 91.5t-41 111.5t-66 124.5h43q41 -47 72 -107t45.5 -111.5t23 -96t10.5 -70.5zM2123 640q0 -11 -0.5 -29t-8 -71.5t-21.5 -102t-45 -108t-74 -102.5h-51q38 45 66.5 104.5t41.5 112t21 98t9 72.5l1 27q0 8 -0.5 22.5t-7.5 60t-19.5 91.5t-40.5 111.5t-66 124.5 h43q41 -47 72 -107t45.5 -111.5t23 -96t10.5 -70.5zM2304 640q0 -11 -0.5 -29t-8 -71.5t-21.5 -102t-44.5 -108t-73.5 -102.5h-51q38 45 66 104.5t41 112t21 98t9 72.5l1 27q0 8 -0.5 22.5t-7.5 60t-19.5 91.5t-40.5 111.5t-66 124.5h43q41 -47 72 -107t45.5 -111.5t23 -96 t9.5 -70.5z" /> +<glyph unicode="" horiz-adv-x="1408" d="M617 -153q0 11 -13 58t-31 107t-20 69q-1 4 -5 26.5t-8.5 36t-13.5 21.5q-15 14 -51 14q-23 0 -70 -5.5t-71 -5.5q-34 0 -47 11q-6 5 -11 15.5t-7.5 20t-6.5 24t-5 18.5q-37 128 -37 255t37 255q1 4 5 18.5t6.5 24t7.5 20t11 15.5q13 11 47 11q24 0 71 -5.5t70 -5.5 q36 0 51 14q9 8 13.5 21.5t8.5 36t5 26.5q2 9 20 69t31 107t13 58q0 22 -43.5 52.5t-75.5 42.5q-20 8 -45 8q-34 0 -98 -18q-57 -17 -96.5 -40.5t-71 -66t-46 -70t-45.5 -94.5q-6 -12 -9 -19q-49 -107 -68 -216t-19 -244t19 -244t68 -216q56 -122 83 -161q63 -91 179 -127 l6 -2q64 -18 98 -18q25 0 45 8q32 12 75.5 42.5t43.5 52.5zM776 760q-26 0 -45 19t-19 45.5t19 45.5q37 37 37 90q0 52 -37 91q-19 19 -19 45t19 45t45 19t45 -19q75 -75 75 -181t-75 -181q-21 -19 -45 -19zM957 579q-27 0 -45 19q-19 19 -19 45t19 45q112 114 112 272 t-112 272q-19 19 -19 45t19 45t45 19t45 -19q150 -150 150 -362t-150 -362q-18 -19 -45 -19zM1138 398q-27 0 -45 19q-19 19 -19 45t19 45q90 91 138.5 208t48.5 245t-48.5 245t-138.5 208q-19 19 -19 45t19 45t45 19t45 -19q109 -109 167 -249t58 -294t-58 -294t-167 -249 q-18 -19 -45 -19z" /> +<glyph unicode="" horiz-adv-x="2176" d="M192 352q-66 0 -113 -47t-47 -113t47 -113t113 -47t113 47t47 113t-47 113t-113 47zM704 352q-66 0 -113 -47t-47 -113t47 -113t113 -47t113 47t47 113t-47 113t-113 47zM704 864q-66 0 -113 -47t-47 -113t47 -113t113 -47t113 47t47 113t-47 113t-113 47zM1472 352 q-66 0 -113 -47t-47 -113t47 -113t113 -47t113 47t47 113t-47 113t-113 47zM1984 352q-66 0 -113 -47t-47 -113t47 -113t113 -47t113 47t47 113t-47 113t-113 47zM1472 864q-66 0 -113 -47t-47 -113t47 -113t113 -47t113 47t47 113t-47 113t-113 47zM1984 864 q-66 0 -113 -47t-47 -113t47 -113t113 -47t113 47t47 113t-47 113t-113 47zM1984 1376q-66 0 -113 -47t-47 -113t47 -113t113 -47t113 47t47 113t-47 113t-113 47zM384 192q0 -80 -56 -136t-136 -56t-136 56t-56 136t56 136t136 56t136 -56t56 -136zM896 192q0 -80 -56 -136 t-136 -56t-136 56t-56 136t56 136t136 56t136 -56t56 -136zM384 704q0 -80 -56 -136t-136 -56t-136 56t-56 136t56 136t136 56t136 -56t56 -136zM896 704q0 -80 -56 -136t-136 -56t-136 56t-56 136t56 136t136 56t136 -56t56 -136zM384 1216q0 -80 -56 -136t-136 -56 t-136 56t-56 136t56 136t136 56t136 -56t56 -136zM1664 192q0 -80 -56 -136t-136 -56t-136 56t-56 136t56 136t136 56t136 -56t56 -136zM896 1216q0 -80 -56 -136t-136 -56t-136 56t-56 136t56 136t136 56t136 -56t56 -136zM2176 192q0 -80 -56 -136t-136 -56t-136 56 t-56 136t56 136t136 56t136 -56t56 -136zM1664 704q0 -80 -56 -136t-136 -56t-136 56t-56 136t56 136t136 56t136 -56t56 -136zM2176 704q0 -80 -56 -136t-136 -56t-136 56t-56 136t56 136t136 56t136 -56t56 -136zM1664 1216q0 -80 -56 -136t-136 -56t-136 56t-56 136 t56 136t136 56t136 -56t56 -136zM2176 1216q0 -80 -56 -136t-136 -56t-136 56t-56 136t56 136t136 56t136 -56t56 -136z" /> +<glyph unicode="" horiz-adv-x="1792" d="M128 -192q0 -26 -19 -45t-45 -19t-45 19t-19 45t19 45t45 19t45 -19t19 -45zM320 0q0 -26 -19 -45t-45 -19t-45 19t-19 45t19 45t45 19t45 -19t19 -45zM365 365l256 -256l-90 -90l-256 256zM704 384q0 -26 -19 -45t-45 -19t-45 19t-19 45t19 45t45 19t45 -19t19 -45z M1411 704q0 -59 -11.5 -108.5t-37.5 -93.5t-44 -67.5t-53 -64.5q-31 -35 -45.5 -54t-33.5 -50t-26.5 -64t-7.5 -74q0 -159 -112.5 -271.5t-271.5 -112.5q-26 0 -45 19t-19 45t19 45t45 19q106 0 181 75t75 181q0 57 11.5 105.5t37 91t43.5 66.5t52 63q40 46 59.5 72 t37.5 74.5t18 103.5q0 185 -131.5 316.5t-316.5 131.5t-316.5 -131.5t-131.5 -316.5q0 -26 -19 -45t-45 -19t-45 19t-19 45q0 117 45.5 223.5t123 184t184 123t223.5 45.5t223.5 -45.5t184 -123t123 -184t45.5 -223.5zM896 576q0 -26 -19 -45t-45 -19t-45 19t-19 45t19 45 t45 19t45 -19t19 -45zM1184 704q0 -26 -19 -45t-45 -19t-45 19t-19 45q0 93 -65.5 158.5t-158.5 65.5q-92 0 -158 -65.5t-66 -158.5q0 -26 -19 -45t-45 -19t-45 19t-19 45q0 146 103 249t249 103t249 -103t103 -249zM1578 993q10 -25 -1 -49t-36 -34q-9 -4 -23 -4 q-19 0 -35.5 11t-23.5 30q-68 178 -224 295q-21 16 -25 42t12 47q17 21 43 25t47 -12q183 -137 266 -351zM1788 1074q9 -25 -1.5 -49t-35.5 -34q-11 -4 -23 -4q-44 0 -60 41q-92 238 -297 393q-22 16 -25.5 42t12.5 47q16 22 42 25.5t47 -12.5q235 -175 341 -449z" /> +<glyph unicode="" horiz-adv-x="2304" d="M1032 576q-59 2 -84 55q-17 34 -48 53.5t-68 19.5q-53 0 -90.5 -37.5t-37.5 -90.5q0 -56 36 -89l10 -8q34 -31 82 -31q37 0 68 19.5t48 53.5q25 53 84 55zM1600 704q0 56 -36 89l-10 8q-34 31 -82 31q-37 0 -68 -19.5t-48 -53.5q-25 -53 -84 -55q59 -2 84 -55 q17 -34 48 -53.5t68 -19.5q53 0 90.5 37.5t37.5 90.5zM1174 925q-17 -35 -55 -48t-73 4q-62 31 -134 31q-51 0 -99 -17q3 0 9.5 0.5t9.5 0.5q92 0 170.5 -50t118.5 -133q17 -36 3.5 -73.5t-49.5 -54.5q-18 -9 -39 -9q21 0 39 -9q36 -17 49.5 -54.5t-3.5 -73.5 q-40 -83 -118.5 -133t-170.5 -50h-6q-16 2 -44 4l-290 27l-239 -120q-14 -7 -29 -7q-40 0 -57 35l-160 320q-11 23 -4 47.5t29 37.5l209 119l148 267q17 155 91.5 291.5t195.5 236.5q31 25 70.5 21.5t64.5 -34.5t21.5 -70t-34.5 -65q-70 -59 -117 -128q123 84 267 101 q40 5 71.5 -19t35.5 -64q5 -40 -19 -71.5t-64 -35.5q-84 -10 -159 -55q46 10 99 10q115 0 218 -50q36 -18 49 -55.5t-5 -73.5zM2137 1085l160 -320q11 -23 4 -47.5t-29 -37.5l-209 -119l-148 -267q-17 -155 -91.5 -291.5t-195.5 -236.5q-26 -22 -61 -22q-45 0 -74 35 q-25 31 -21.5 70t34.5 65q70 59 117 128q-123 -84 -267 -101q-4 -1 -12 -1q-36 0 -63.5 24t-31.5 60q-5 40 19 71.5t64 35.5q84 10 159 55q-46 -10 -99 -10q-115 0 -218 50q-36 18 -49 55.5t5 73.5q17 35 55 48t73 -4q62 -31 134 -31q51 0 99 17q-3 0 -9.5 -0.5t-9.5 -0.5 q-92 0 -170.5 50t-118.5 133q-17 36 -3.5 73.5t49.5 54.5q18 9 39 9q-21 0 -39 9q-36 17 -49.5 54.5t3.5 73.5q40 83 118.5 133t170.5 50h6h1q14 -2 42 -4l291 -27l239 120q14 7 29 7q40 0 57 -35z" /> +<glyph unicode="" horiz-adv-x="1792" d="M1056 704q0 -26 19 -45t45 -19t45 19t19 45q0 146 -103 249t-249 103t-249 -103t-103 -249q0 -26 19 -45t45 -19t45 19t19 45q0 93 66 158.5t158 65.5t158 -65.5t66 -158.5zM835 1280q-117 0 -223.5 -45.5t-184 -123t-123 -184t-45.5 -223.5q0 -26 19 -45t45 -19t45 19 t19 45q0 185 131.5 316.5t316.5 131.5t316.5 -131.5t131.5 -316.5q0 -55 -18 -103.5t-37.5 -74.5t-59.5 -72q-34 -39 -52 -63t-43.5 -66.5t-37 -91t-11.5 -105.5q0 -106 -75 -181t-181 -75q-26 0 -45 -19t-19 -45t19 -45t45 -19q159 0 271.5 112.5t112.5 271.5q0 41 7.5 74 t26.5 64t33.5 50t45.5 54q35 41 53 64.5t44 67.5t37.5 93.5t11.5 108.5q0 117 -45.5 223.5t-123 184t-184 123t-223.5 45.5zM591 561l226 -226l-579 -579q-12 -12 -29 -12t-29 12l-168 168q-12 12 -12 29t12 29zM1612 1524l168 -168q12 -12 12 -29t-12 -30l-233 -233 l-26 -25l-71 -71q-66 153 -195 258l91 91l207 207q13 12 30 12t29 -12z" /> +<glyph unicode="" d="M866 1021q0 -27 -13 -94q-11 -50 -31.5 -150t-30.5 -150q-2 -11 -4.5 -12.5t-13.5 -2.5q-20 -2 -31 -2q-58 0 -84 49.5t-26 113.5q0 88 35 174t103 124q28 14 51 14q28 0 36.5 -16.5t8.5 -47.5zM1352 597q0 14 -39 75.5t-52 66.5q-21 8 -34 8q-91 0 -226 -77l-2 2 q3 22 27.5 135t24.5 178q0 233 -242 233q-24 0 -68 -6q-94 -17 -168.5 -89.5t-111.5 -166.5t-37 -189q0 -146 80.5 -225t227.5 -79q25 0 25 -3t-1 -5q-4 -34 -26 -117q-14 -52 -51.5 -101t-82.5 -49q-42 0 -42 47q0 24 10.5 47.5t25 39.5t29.5 28.5t26 20t11 8.5q0 3 -7 10 q-24 22 -58.5 36.5t-65.5 14.5q-35 0 -63.5 -34t-41 -75t-12.5 -75q0 -88 51.5 -142t138.5 -54q82 0 155 53t117.5 126t65.5 153q6 22 15.5 66.5t14.5 66.5q3 12 14 18q118 60 227 60q48 0 127 -18q1 -1 4 -1q5 0 9.5 4.5t4.5 8.5zM1536 1120v-960q0 -119 -84.5 -203.5 t-203.5 -84.5h-960q-119 0 -203.5 84.5t-84.5 203.5v960q0 119 84.5 203.5t203.5 84.5h960q119 0 203.5 -84.5t84.5 -203.5z" /> +<glyph unicode="" horiz-adv-x="1535" d="M744 1231q0 24 -2 38.5t-8.5 30t-21 23t-37.5 7.5q-39 0 -78 -23q-105 -58 -159 -190.5t-54 -269.5q0 -44 8.5 -85.5t26.5 -80.5t52.5 -62.5t81.5 -23.5q4 0 18 -0.5t20 0t16 3t15 8.5t7 16q16 77 48 231.5t48 231.5q19 91 19 146zM1498 575q0 -7 -7.5 -13.5t-15.5 -6.5 l-6 1q-22 3 -62 11t-72 12.5t-63 4.5q-167 0 -351 -93q-15 -8 -21 -27q-10 -36 -24.5 -105.5t-22.5 -100.5q-23 -91 -70 -179.5t-112.5 -164.5t-154.5 -123t-185 -47q-135 0 -214.5 83.5t-79.5 219.5q0 53 19.5 117t63 116.5t97.5 52.5q38 0 120 -33.5t83 -61.5 q0 -1 -16.5 -12.5t-39.5 -31t-46 -44.5t-39 -61t-16 -74q0 -33 16.5 -53t48.5 -20q45 0 85 31.5t66.5 78t48 105.5t32.5 107t16 90v9q0 2 -3.5 3.5t-8.5 1.5h-10t-10 -0.5t-6 -0.5q-227 0 -352 122.5t-125 348.5q0 108 34.5 221t96 210t156 167.5t204.5 89.5q52 9 106 9 q374 0 374 -360q0 -98 -38 -273t-43 -211l3 -3q101 57 182.5 88t167.5 31q22 0 53 -13q19 -7 80 -102.5t61 -116.5z" /> +<glyph unicode="" horiz-adv-x="1664" d="M831 863q32 0 59 -18l222 -148q61 -40 110 -97l146 -170q40 -46 29 -106l-72 -413q-6 -32 -29.5 -53.5t-55.5 -25.5l-527 -56l-352 -32h-9q-39 0 -67.5 28t-28.5 68q0 37 27 64t65 32l260 32h-448q-41 0 -69.5 30t-26.5 71q2 39 32 65t69 26l442 1l-521 64q-41 5 -66 37 t-19 73q6 35 34.5 57.5t65.5 22.5h10l481 -60l-351 94q-38 10 -62 41.5t-18 68.5q6 36 33 58.5t62 22.5q6 0 20 -2l448 -96l217 -37q1 0 3 -0.5t3 -0.5q23 0 30.5 23t-12.5 36l-186 125q-35 23 -42 63.5t18 73.5q27 38 76 38zM761 661l186 -125l-218 37l-5 2l-36 38 l-238 262q-1 1 -2.5 3.5t-2.5 3.5q-24 31 -18.5 70t37.5 64q31 23 68 17.5t64 -33.5l142 -147l-4 -4t-5 -4q-32 -45 -23 -99t55 -85zM1648 1115l15 -266q4 -73 -11 -147l-48 -219q-12 -59 -67 -87l-106 -54q2 62 -39 109l-146 170q-53 61 -117 103l-222 148q-34 23 -76 23 q-51 0 -88 -37l-235 312q-25 33 -18 73.5t41 63.5q33 22 71.5 14t62.5 -40l266 -352l-262 455q-21 35 -10.5 75t47.5 59q35 18 72.5 6t57.5 -46l241 -420l-136 337q-15 35 -4.5 74t44.5 56q37 19 76 6t56 -51l193 -415l101 -196q8 -15 23 -17.5t27 7.5t11 26l-12 224 q-2 41 26 71t69 31q39 0 67 -28.5t30 -67.5z" /> +<glyph unicode="" horiz-adv-x="1792" d="M335 180q-2 0 -6 2q-86 57 -168.5 145t-139.5 180q-21 30 -21 69q0 9 2 19t4 18t7 18t8.5 16t10.5 17t10 15t12 15.5t11 14.5q184 251 452 365q-110 198 -110 211q0 19 17 29q116 64 128 64q18 0 28 -16l124 -229q92 19 192 19q266 0 497.5 -137.5t378.5 -369.5 q20 -31 20 -69t-20 -69q-91 -142 -218.5 -253.5t-278.5 -175.5q110 -198 110 -211q0 -20 -17 -29q-116 -64 -127 -64q-19 0 -29 16l-124 229l-64 119l-444 820l7 7q-58 -24 -99 -47q3 -5 127 -234t243 -449t119 -223q0 -7 -9 -9q-13 -3 -72 -3q-57 0 -60 7l-456 841 q-39 -28 -82 -68q24 -43 214 -393.5t190 -354.5q0 -10 -11 -10q-14 0 -82.5 22t-72.5 28l-106 197l-224 413q-44 -53 -78 -106q2 -3 18 -25t23 -34l176 -327q0 -10 -10 -10zM1165 282l49 -91q273 111 450 385q-180 277 -459 389q67 -64 103 -148.5t36 -176.5 q0 -106 -47 -200.5t-132 -157.5zM848 896q0 -20 14 -34t34 -14q86 0 147 -61t61 -147q0 -20 14 -34t34 -14t34 14t14 34q0 126 -89 215t-215 89q-20 0 -34 -14t-14 -34zM1214 961l-9 4l7 -7z" /> +<glyph unicode="" horiz-adv-x="1280" d="M1050 430q0 -215 -147 -374q-148 -161 -378 -161q-232 0 -378 161q-147 159 -147 374q0 147 68 270.5t189 196.5t268 73q96 0 182 -31q-32 -62 -39 -126q-66 28 -143 28q-167 0 -280.5 -123t-113.5 -291q0 -170 112.5 -288.5t281.5 -118.5t281 118.5t112 288.5 q0 89 -32 166q66 13 123 49q41 -98 41 -212zM846 619q0 -192 -79.5 -345t-238.5 -253l-14 -1q-29 0 -62 5q83 32 146.5 102.5t99.5 154.5t58.5 189t30 192.5t7.5 178.5q0 69 -3 103q55 -160 55 -326zM791 947v-2q-73 214 -206 440q88 -59 142.5 -186.5t63.5 -251.5z M1035 744q-83 0 -160 75q218 120 290 247q19 37 21 56q-42 -94 -139.5 -166.5t-204.5 -97.5q-35 54 -35 113q0 37 17 79t43 68q46 44 157 74q59 16 106 58.5t74 100.5q74 -105 74 -253q0 -109 -24 -170q-32 -77 -88.5 -130.5t-130.5 -53.5z" /> +<glyph unicode="" d="M1050 495q0 78 -28 147q-41 -25 -85 -34q22 -50 22 -114q0 -117 -77 -198.5t-193 -81.5t-193.5 81.5t-77.5 198.5q0 115 78 199.5t193 84.5q53 0 98 -19q4 43 27 87q-60 21 -125 21q-154 0 -257.5 -108.5t-103.5 -263.5t103.5 -261t257.5 -106t257.5 106.5t103.5 260.5z M872 850q2 -24 2 -71q0 -63 -5 -123t-20.5 -132.5t-40.5 -130t-68.5 -106t-100.5 -70.5q21 -3 42 -3h10q219 139 219 411q0 116 -38 225zM872 850q-4 80 -44 171.5t-98 130.5q92 -156 142 -302zM1207 955q0 102 -51 174q-41 -86 -124 -109q-69 -19 -109 -53.5t-40 -99.5 q0 -40 24 -77q74 17 140.5 67t95.5 115q-4 -52 -74.5 -111.5t-138.5 -97.5q52 -52 110 -52q51 0 90 37t60 90q17 43 17 117zM1536 1120v-960q0 -119 -84.5 -203.5t-203.5 -84.5h-960q-119 0 -203.5 84.5t-84.5 203.5v960q0 119 84.5 203.5t203.5 84.5h960q119 0 203.5 -84.5 t84.5 -203.5z" /> +<glyph unicode="" d="M1279 388q0 22 -22 27q-67 15 -118 59t-80 108q-7 19 -7 25q0 15 19.5 26t43 17t43 20.5t19.5 36.5q0 19 -18.5 31.5t-38.5 12.5q-12 0 -32 -8t-31 -8q-4 0 -12 2q5 95 5 114q0 79 -17 114q-36 78 -103 121.5t-152 43.5q-199 0 -275 -165q-17 -35 -17 -114q0 -19 5 -114 q-4 -2 -14 -2q-12 0 -32 7.5t-30 7.5q-21 0 -38.5 -12t-17.5 -32q0 -21 19.5 -35.5t43 -20.5t43 -17t19.5 -26q0 -6 -7 -25q-64 -138 -198 -167q-22 -5 -22 -27q0 -46 137 -68q2 -5 6 -26t11.5 -30.5t23.5 -9.5q12 0 37.5 4.5t39.5 4.5q35 0 67 -15t54 -32.5t57.5 -32.5 t76.5 -15q43 0 79 15t57.5 32.5t53.5 32.5t67 15q14 0 39.5 -4t38.5 -4q16 0 23 10t11 30t6 25q137 22 137 68zM1536 640q0 -209 -103 -385.5t-279.5 -279.5t-385.5 -103t-385.5 103t-279.5 279.5t-103 385.5t103 385.5t279.5 279.5t385.5 103t385.5 -103t279.5 -279.5 t103 -385.5z" /> +<glyph unicode="" horiz-adv-x="1664" d="M848 1408q134 1 240.5 -68.5t163.5 -192.5q27 -58 27 -179q0 -47 -9 -191q14 -7 28 -7q18 0 51 13.5t51 13.5q29 0 56 -18t27 -46q0 -32 -31.5 -54t-69 -31.5t-69 -29t-31.5 -47.5q0 -15 12 -43q37 -82 102.5 -150t144.5 -101q28 -12 80 -23q28 -6 28 -35 q0 -70 -219 -103q-7 -11 -11 -39t-14 -46.5t-33 -18.5q-20 0 -62 6.5t-64 6.5q-37 0 -62 -5q-32 -5 -63 -22.5t-58 -38t-58 -40.5t-76 -33.5t-99 -13.5q-52 0 -96.5 13.5t-75 33.5t-57.5 40.5t-58 38t-62 22.5q-26 5 -63 5q-24 0 -65.5 -7.5t-58.5 -7.5q-25 0 -35 18.5 t-14 47.5t-11 40q-219 33 -219 103q0 29 28 35q52 11 80 23q78 32 144.5 101t102.5 150q12 28 12 43q0 28 -31.5 47.5t-69.5 29.5t-69.5 31.5t-31.5 52.5q0 27 26 45.5t55 18.5q15 0 48 -13t53 -13q18 0 32 7q-9 142 -9 190q0 122 27 180q64 137 172 198t264 63z" /> +<glyph unicode="" d="M1280 388q0 22 -22 27q-67 14 -118 58t-80 109q-7 14 -7 25q0 15 19.5 26t42.5 17t42.5 20.5t19.5 36.5q0 19 -18.5 31.5t-38.5 12.5q-11 0 -31 -8t-32 -8q-4 0 -12 2q5 63 5 115q0 78 -17 114q-36 78 -102.5 121.5t-152.5 43.5q-198 0 -275 -165q-18 -38 -18 -115 q0 -38 6 -114q-10 -2 -15 -2q-11 0 -31.5 8t-30.5 8q-20 0 -37.5 -12.5t-17.5 -32.5q0 -21 19.5 -35.5t42.5 -20.5t42.5 -17t19.5 -26q0 -11 -7 -25q-64 -138 -198 -167q-22 -5 -22 -27q0 -47 138 -69q2 -5 6 -26t11 -30.5t23 -9.5q13 0 38.5 5t38.5 5q35 0 67.5 -15 t54.5 -32.5t57.5 -32.5t76.5 -15q43 0 79 15t57.5 32.5t54 32.5t67.5 15q13 0 39 -4.5t39 -4.5q15 0 22.5 9.5t11.5 31t5 24.5q138 22 138 69zM1536 1120v-960q0 -119 -84.5 -203.5t-203.5 -84.5h-960q-119 0 -203.5 84.5t-84.5 203.5v960q0 119 84.5 203.5t203.5 84.5h960 q119 0 203.5 -84.5t84.5 -203.5z" /> +<glyph unicode="" horiz-adv-x="2304" d="M2304 1536q-69 -46 -125 -92t-89 -81t-59.5 -71.5t-37.5 -57.5t-22 -44.5t-14 -29.5q-10 -18 -35.5 -136.5t-48.5 -164.5q-15 -29 -50 -60.5t-67.5 -50.5t-72.5 -41t-48 -28q-47 -31 -151 -231q-341 14 -630 -158q-92 -53 -303 -179q47 16 86 31t55 22l15 7 q71 27 163 64.5t133.5 53.5t108 34.5t142.5 31.5q186 31 465 -7q1 0 10 -3q11 -6 14 -17t-3 -22l-194 -345q-15 -29 -47 -22q-128 24 -354 24q-146 0 -402 -44.5t-392 -46.5q-82 -1 -149 13t-107 37t-61 40t-33 34l-1 1v2q0 6 6 6q138 0 371 55q192 366 374.5 524t383.5 158 q5 0 14.5 -0.5t38 -5t55 -12t61.5 -24.5t63 -39.5t54 -59t40 -82.5l102 177q2 4 21 42.5t44.5 86.5t61 109.5t84 133.5t100.5 137q66 82 128 141.5t121.5 96.5t92.5 53.5t88 39.5z" /> +<glyph unicode="" d="M1322 640q0 -45 -5 -76l-236 14l224 -78q-19 -73 -58 -141l-214 103l177 -158q-44 -61 -107 -108l-157 178l103 -215q-61 -37 -140 -59l-79 228l14 -240q-38 -6 -76 -6t-76 6l14 238l-78 -226q-74 19 -140 59l103 215l-157 -178q-59 43 -108 108l178 158l-214 -104 q-39 69 -58 141l224 79l-237 -14q-5 42 -5 76q0 35 5 77l238 -14l-225 79q19 73 58 140l214 -104l-177 159q46 61 107 108l158 -178l-103 215q67 39 140 58l77 -224l-13 236q36 6 75 6q38 0 76 -6l-14 -237l78 225q74 -19 140 -59l-103 -214l158 178q61 -47 107 -108 l-177 -159l213 104q37 -62 58 -141l-224 -78l237 14q5 -31 5 -77zM1352 640q0 160 -78.5 295.5t-213 214t-292.5 78.5q-119 0 -227 -46.5t-186.5 -125t-124.5 -187.5t-46 -229q0 -119 46 -228t124.5 -187.5t186.5 -125t227 -46.5q158 0 292.5 78.5t213 214t78.5 294.5z M1425 1023v-766l-657 -383l-657 383v766l657 383zM768 -183l708 412v823l-708 411l-708 -411v-823zM1536 1088v-896l-768 -448l-768 448v896l768 448z" /> +<glyph unicode="" horiz-adv-x="1664" d="M339 1318h691l-26 -72h-665q-110 0 -188.5 -79t-78.5 -189v-771q0 -95 60.5 -169.5t153.5 -93.5q23 -5 98 -5v-72h-45q-140 0 -239.5 100t-99.5 240v771q0 140 99.5 240t239.5 100zM1190 1536h247l-482 -1294q-23 -61 -40.5 -103.5t-45 -98t-54 -93.5t-64.5 -78.5 t-79.5 -65t-95.5 -41t-116 -18.5v195q163 26 220 182q20 52 20 105q0 54 -20 106l-285 733h228l187 -585zM1664 978v-1111h-795q37 55 45 73h678v1038q0 85 -49.5 155t-129.5 99l25 67q101 -34 163.5 -123.5t62.5 -197.5z" /> +<glyph unicode="" horiz-adv-x="1792" d="M852 1227q0 -29 -17 -52.5t-45 -23.5t-45 23.5t-17 52.5t17 52.5t45 23.5t45 -23.5t17 -52.5zM688 -149v114q0 30 -20.5 51.5t-50.5 21.5t-50 -21.5t-20 -51.5v-114q0 -30 20.5 -52t49.5 -22q30 0 50.5 22t20.5 52zM860 -149v114q0 30 -20 51.5t-50 21.5t-50.5 -21.5 t-20.5 -51.5v-114q0 -30 20.5 -52t50.5 -22q29 0 49.5 22t20.5 52zM1034 -149v114q0 30 -20.5 51.5t-50.5 21.5t-50.5 -21.5t-20.5 -51.5v-114q0 -30 20.5 -52t50.5 -22t50.5 22t20.5 52zM1208 -149v114q0 30 -20.5 51.5t-50.5 21.5t-50.5 -21.5t-20.5 -51.5v-114 q0 -30 20.5 -52t50.5 -22t50.5 22t20.5 52zM1476 535q-84 -160 -232 -259.5t-323 -99.5q-123 0 -229.5 51.5t-178.5 137t-113 197.5t-41 232q0 88 21 174q-104 -175 -104 -390q0 -162 65 -312t185 -251q30 57 91 57q56 0 86 -50q32 50 87 50q56 0 86 -50q32 50 87 50t87 -50 q30 50 86 50q28 0 52.5 -15.5t37.5 -40.5q112 94 177 231.5t73 287.5zM1326 564q0 75 -72 75q-17 0 -47 -6q-95 -19 -149 -19q-226 0 -226 243q0 86 30 204q-83 -127 -83 -275q0 -150 89 -260.5t235 -110.5q111 0 210 70q13 48 13 79zM884 1223q0 50 -32 89.5t-81 39.5 t-81 -39.5t-32 -89.5q0 -51 31.5 -90.5t81.5 -39.5t81.5 39.5t31.5 90.5zM1513 884q0 96 -37.5 179t-113 137t-173.5 54q-77 0 -149 -35t-127 -94q-48 -159 -48 -268q0 -104 45.5 -157t147.5 -53q53 0 142 19q36 6 53 6q51 0 77.5 -28t26.5 -80q0 -26 -4 -46 q75 68 117.5 165.5t42.5 200.5zM1792 667q0 -111 -33.5 -249.5t-93.5 -204.5q-58 -64 -195 -142.5t-228 -104.5l-4 -1v-114q0 -43 -29.5 -75t-72.5 -32q-56 0 -86 50q-32 -50 -87 -50t-87 50q-30 -50 -86 -50q-55 0 -87 50q-30 -50 -86 -50q-47 0 -75 33.5t-28 81.5 q-90 -68 -198 -68q-118 0 -211 80q54 1 106 20q-113 31 -182 127q32 -7 71 -7q89 0 164 46q-192 192 -240 306q-24 56 -24 160q0 57 9 125.5t31.5 146.5t55 141t86.5 105t120 42q59 0 81 -52q19 29 42 54q2 3 12 13t13 16q10 15 23 38t25 42t28 39q87 111 211.5 177 t260.5 66q35 0 62 -4q59 64 146 64q83 0 140 -57q5 -5 5 -12q0 -5 -6 -13.5t-12.5 -16t-16 -17l-10.5 -10.5q17 -6 36 -18t19 -24q0 -6 -16 -25q157 -138 197 -378q25 30 60 30q45 0 100 -49q90 -80 90 -279z" /> +<glyph unicode="" d="M917 631q0 33 -6 64h-362v-132h217q-12 -76 -74.5 -120.5t-142.5 -44.5q-99 0 -169 71.5t-70 170.5t70 170.5t169 71.5q93 0 153 -59l104 101q-108 100 -257 100q-160 0 -272 -112.5t-112 -271.5t112 -271.5t272 -112.5q165 0 266.5 105t101.5 270zM1262 585h109v110 h-109v110h-110v-110h-110v-110h110v-110h110v110zM1536 640q0 -209 -103 -385.5t-279.5 -279.5t-385.5 -103t-385.5 103t-279.5 279.5t-103 385.5t103 385.5t279.5 279.5t385.5 103t385.5 -103t279.5 -279.5t103 -385.5z" /> +<glyph unicode="" d="M1536 1024v-839q0 -48 -49 -62q-174 -52 -338 -52q-73 0 -215.5 29.5t-227.5 29.5q-164 0 -370 -48v-338h-160v1368q-63 25 -101 81t-38 124q0 91 64 155t155 64t155 -64t64 -155q0 -68 -38 -124t-101 -81v-68q190 44 343 44q99 0 198 -15q14 -2 111.5 -22.5t149.5 -20.5 q77 0 165 18q11 2 80 21t89 19q26 0 45 -19t19 -45z" /> +<glyph unicode="" horiz-adv-x="1792" /> +<glyph unicode="" horiz-adv-x="1792" /> +<glyph unicode="" horiz-adv-x="1792" /> +<glyph unicode="" horiz-adv-x="1792" /> +<glyph unicode="" horiz-adv-x="1792" /> +<glyph unicode="" horiz-adv-x="1792" /> +<glyph unicode="" horiz-adv-x="1792" /> +<glyph unicode="" horiz-adv-x="1792" /> +<glyph unicode="" horiz-adv-x="1792" /> +<glyph unicode="" horiz-adv-x="1792" /> +<glyph unicode="" horiz-adv-x="1792" /> +</font> +</defs></svg> \ No newline at end of file diff --git a/website/docs/_static/fonts/fontawesome-webfont.ttf b/website/docs/_static/fonts/fontawesome-webfont.ttf new file mode 100644 index 0000000..f221e50 Binary files /dev/null and b/website/docs/_static/fonts/fontawesome-webfont.ttf differ diff --git a/website/docs/_static/fonts/fontawesome-webfont.woff b/website/docs/_static/fonts/fontawesome-webfont.woff new file mode 100644 index 0000000..6e7483c Binary files /dev/null and b/website/docs/_static/fonts/fontawesome-webfont.woff differ diff --git a/website/docs/_static/fonts/fontawesome-webfont.woff2 b/website/docs/_static/fonts/fontawesome-webfont.woff2 new file mode 100644 index 0000000..7eb74fd Binary files /dev/null and b/website/docs/_static/fonts/fontawesome-webfont.woff2 differ diff --git a/website/docs/_static/jquery-3.1.0.js b/website/docs/_static/jquery-3.1.0.js new file mode 100644 index 0000000..f2fc274 --- /dev/null +++ b/website/docs/_static/jquery-3.1.0.js @@ -0,0 +1,10074 @@ +/*eslint-disable no-unused-vars*/ +/*! + * jQuery JavaScript Library v3.1.0 + * https://jquery.com/ + * + * Includes Sizzle.js + * https://sizzlejs.com/ + * + * Copyright jQuery Foundation and other contributors + * Released under the MIT license + * https://jquery.org/license + * + * Date: 2016-07-07T21:44Z + */ +( function( global, factory ) { + + "use strict"; + + if ( typeof module === "object" && typeof module.exports === "object" ) { + + // For CommonJS and CommonJS-like environments where a proper `window` + // is present, execute the factory and get jQuery. + // For environments that do not have a `window` with a `document` + // (such as Node.js), expose a factory as module.exports. + // This accentuates the need for the creation of a real `window`. + // e.g. var jQuery = require("jquery")(window); + // See ticket #14549 for more info. + module.exports = global.document ? + factory( global, true ) : + function( w ) { + if ( !w.document ) { + throw new Error( "jQuery requires a window with a document" ); + } + return factory( w ); + }; + } else { + factory( global ); + } + +// Pass this if window is not defined yet +} )( typeof window !== "undefined" ? window : this, function( window, noGlobal ) { + +// Edge <= 12 - 13+, Firefox <=18 - 45+, IE 10 - 11, Safari 5.1 - 9+, iOS 6 - 9.1 +// throw exceptions when non-strict code (e.g., ASP.NET 4.5) accesses strict mode +// arguments.callee.caller (trac-13335). But as of jQuery 3.0 (2016), strict mode should be common +// enough that all such attempts are guarded in a try block. +"use strict"; + +var arr = []; + +var document = window.document; + +var getProto = Object.getPrototypeOf; + +var slice = arr.slice; + +var concat = arr.concat; + +var push = arr.push; + +var indexOf = arr.indexOf; + +var class2type = {}; + +var toString = class2type.toString; + +var hasOwn = class2type.hasOwnProperty; + +var fnToString = hasOwn.toString; + +var ObjectFunctionString = fnToString.call( Object ); + +var support = {}; + + + + function DOMEval( code, doc ) { + doc = doc || document; + + var script = doc.createElement( "script" ); + + script.text = code; + doc.head.appendChild( script ).parentNode.removeChild( script ); + } +/* global Symbol */ +// Defining this global in .eslintrc would create a danger of using the global +// unguarded in another place, it seems safer to define global only for this module + + + +var + version = "3.1.0", + + // Define a local copy of jQuery + jQuery = function( selector, context ) { + + // The jQuery object is actually just the init constructor 'enhanced' + // Need init if jQuery is called (just allow error to be thrown if not included) + return new jQuery.fn.init( selector, context ); + }, + + // Support: Android <=4.0 only + // Make sure we trim BOM and NBSP + rtrim = /^[\s\uFEFF\xA0]+|[\s\uFEFF\xA0]+$/g, + + // Matches dashed string for camelizing + rmsPrefix = /^-ms-/, + rdashAlpha = /-([a-z])/g, + + // Used by jQuery.camelCase as callback to replace() + fcamelCase = function( all, letter ) { + return letter.toUpperCase(); + }; + +jQuery.fn = jQuery.prototype = { + + // The current version of jQuery being used + jquery: version, + + constructor: jQuery, + + // The default length of a jQuery object is 0 + length: 0, + + toArray: function() { + return slice.call( this ); + }, + + // Get the Nth element in the matched element set OR + // Get the whole matched element set as a clean array + get: function( num ) { + return num != null ? + + // Return just the one element from the set + ( num < 0 ? this[ num + this.length ] : this[ num ] ) : + + // Return all the elements in a clean array + slice.call( this ); + }, + + // Take an array of elements and push it onto the stack + // (returning the new matched element set) + pushStack: function( elems ) { + + // Build a new jQuery matched element set + var ret = jQuery.merge( this.constructor(), elems ); + + // Add the old object onto the stack (as a reference) + ret.prevObject = this; + + // Return the newly-formed element set + return ret; + }, + + // Execute a callback for every element in the matched set. + each: function( callback ) { + return jQuery.each( this, callback ); + }, + + map: function( callback ) { + return this.pushStack( jQuery.map( this, function( elem, i ) { + return callback.call( elem, i, elem ); + } ) ); + }, + + slice: function() { + return this.pushStack( slice.apply( this, arguments ) ); + }, + + first: function() { + return this.eq( 0 ); + }, + + last: function() { + return this.eq( -1 ); + }, + + eq: function( i ) { + var len = this.length, + j = +i + ( i < 0 ? len : 0 ); + return this.pushStack( j >= 0 && j < len ? [ this[ j ] ] : [] ); + }, + + end: function() { + return this.prevObject || this.constructor(); + }, + + // For internal use only. + // Behaves like an Array's method, not like a jQuery method. + push: push, + sort: arr.sort, + splice: arr.splice +}; + +jQuery.extend = jQuery.fn.extend = function() { + var options, name, src, copy, copyIsArray, clone, + target = arguments[ 0 ] || {}, + i = 1, + length = arguments.length, + deep = false; + + // Handle a deep copy situation + if ( typeof target === "boolean" ) { + deep = target; + + // Skip the boolean and the target + target = arguments[ i ] || {}; + i++; + } + + // Handle case when target is a string or something (possible in deep copy) + if ( typeof target !== "object" && !jQuery.isFunction( target ) ) { + target = {}; + } + + // Extend jQuery itself if only one argument is passed + if ( i === length ) { + target = this; + i--; + } + + for ( ; i < length; i++ ) { + + // Only deal with non-null/undefined values + if ( ( options = arguments[ i ] ) != null ) { + + // Extend the base object + for ( name in options ) { + src = target[ name ]; + copy = options[ name ]; + + // Prevent never-ending loop + if ( target === copy ) { + continue; + } + + // Recurse if we're merging plain objects or arrays + if ( deep && copy && ( jQuery.isPlainObject( copy ) || + ( copyIsArray = jQuery.isArray( copy ) ) ) ) { + + if ( copyIsArray ) { + copyIsArray = false; + clone = src && jQuery.isArray( src ) ? src : []; + + } else { + clone = src && jQuery.isPlainObject( src ) ? src : {}; + } + + // Never move original objects, clone them + target[ name ] = jQuery.extend( deep, clone, copy ); + + // Don't bring in undefined values + } else if ( copy !== undefined ) { + target[ name ] = copy; + } + } + } + } + + // Return the modified object + return target; +}; + +jQuery.extend( { + + // Unique for each copy of jQuery on the page + expando: "jQuery" + ( version + Math.random() ).replace( /\D/g, "" ), + + // Assume jQuery is ready without the ready module + isReady: true, + + error: function( msg ) { + throw new Error( msg ); + }, + + noop: function() {}, + + isFunction: function( obj ) { + return jQuery.type( obj ) === "function"; + }, + + isArray: Array.isArray, + + isWindow: function( obj ) { + return obj != null && obj === obj.window; + }, + + isNumeric: function( obj ) { + + // As of jQuery 3.0, isNumeric is limited to + // strings and numbers (primitives or objects) + // that can be coerced to finite numbers (gh-2662) + var type = jQuery.type( obj ); + return ( type === "number" || type === "string" ) && + + // parseFloat NaNs numeric-cast false positives ("") + // ...but misinterprets leading-number strings, particularly hex literals ("0x...") + // subtraction forces infinities to NaN + !isNaN( obj - parseFloat( obj ) ); + }, + + isPlainObject: function( obj ) { + var proto, Ctor; + + // Detect obvious negatives + // Use toString instead of jQuery.type to catch host objects + if ( !obj || toString.call( obj ) !== "[object Object]" ) { + return false; + } + + proto = getProto( obj ); + + // Objects with no prototype (e.g., `Object.create( null )`) are plain + if ( !proto ) { + return true; + } + + // Objects with prototype are plain iff they were constructed by a global Object function + Ctor = hasOwn.call( proto, "constructor" ) && proto.constructor; + return typeof Ctor === "function" && fnToString.call( Ctor ) === ObjectFunctionString; + }, + + isEmptyObject: function( obj ) { + + /* eslint-disable no-unused-vars */ + // See https://github.com/eslint/eslint/issues/6125 + var name; + + for ( name in obj ) { + return false; + } + return true; + }, + + type: function( obj ) { + if ( obj == null ) { + return obj + ""; + } + + // Support: Android <=2.3 only (functionish RegExp) + return typeof obj === "object" || typeof obj === "function" ? + class2type[ toString.call( obj ) ] || "object" : + typeof obj; + }, + + // Evaluates a script in a global context + globalEval: function( code ) { + DOMEval( code ); + }, + + // Convert dashed to camelCase; used by the css and data modules + // Support: IE <=9 - 11, Edge 12 - 13 + // Microsoft forgot to hump their vendor prefix (#9572) + camelCase: function( string ) { + return string.replace( rmsPrefix, "ms-" ).replace( rdashAlpha, fcamelCase ); + }, + + nodeName: function( elem, name ) { + return elem.nodeName && elem.nodeName.toLowerCase() === name.toLowerCase(); + }, + + each: function( obj, callback ) { + var length, i = 0; + + if ( isArrayLike( obj ) ) { + length = obj.length; + for ( ; i < length; i++ ) { + if ( callback.call( obj[ i ], i, obj[ i ] ) === false ) { + break; + } + } + } else { + for ( i in obj ) { + if ( callback.call( obj[ i ], i, obj[ i ] ) === false ) { + break; + } + } + } + + return obj; + }, + + // Support: Android <=4.0 only + trim: function( text ) { + return text == null ? + "" : + ( text + "" ).replace( rtrim, "" ); + }, + + // results is for internal usage only + makeArray: function( arr, results ) { + var ret = results || []; + + if ( arr != null ) { + if ( isArrayLike( Object( arr ) ) ) { + jQuery.merge( ret, + typeof arr === "string" ? + [ arr ] : arr + ); + } else { + push.call( ret, arr ); + } + } + + return ret; + }, + + inArray: function( elem, arr, i ) { + return arr == null ? -1 : indexOf.call( arr, elem, i ); + }, + + // Support: Android <=4.0 only, PhantomJS 1 only + // push.apply(_, arraylike) throws on ancient WebKit + merge: function( first, second ) { + var len = +second.length, + j = 0, + i = first.length; + + for ( ; j < len; j++ ) { + first[ i++ ] = second[ j ]; + } + + first.length = i; + + return first; + }, + + grep: function( elems, callback, invert ) { + var callbackInverse, + matches = [], + i = 0, + length = elems.length, + callbackExpect = !invert; + + // Go through the array, only saving the items + // that pass the validator function + for ( ; i < length; i++ ) { + callbackInverse = !callback( elems[ i ], i ); + if ( callbackInverse !== callbackExpect ) { + matches.push( elems[ i ] ); + } + } + + return matches; + }, + + // arg is for internal usage only + map: function( elems, callback, arg ) { + var length, value, + i = 0, + ret = []; + + // Go through the array, translating each of the items to their new values + if ( isArrayLike( elems ) ) { + length = elems.length; + for ( ; i < length; i++ ) { + value = callback( elems[ i ], i, arg ); + + if ( value != null ) { + ret.push( value ); + } + } + + // Go through every key on the object, + } else { + for ( i in elems ) { + value = callback( elems[ i ], i, arg ); + + if ( value != null ) { + ret.push( value ); + } + } + } + + // Flatten any nested arrays + return concat.apply( [], ret ); + }, + + // A global GUID counter for objects + guid: 1, + + // Bind a function to a context, optionally partially applying any + // arguments. + proxy: function( fn, context ) { + var tmp, args, proxy; + + if ( typeof context === "string" ) { + tmp = fn[ context ]; + context = fn; + fn = tmp; + } + + // Quick check to determine if target is callable, in the spec + // this throws a TypeError, but we will just return undefined. + if ( !jQuery.isFunction( fn ) ) { + return undefined; + } + + // Simulated bind + args = slice.call( arguments, 2 ); + proxy = function() { + return fn.apply( context || this, args.concat( slice.call( arguments ) ) ); + }; + + // Set the guid of unique handler to the same of original handler, so it can be removed + proxy.guid = fn.guid = fn.guid || jQuery.guid++; + + return proxy; + }, + + now: Date.now, + + // jQuery.support is not used in Core but other projects attach their + // properties to it so it needs to exist. + support: support +} ); + +if ( typeof Symbol === "function" ) { + jQuery.fn[ Symbol.iterator ] = arr[ Symbol.iterator ]; +} + +// Populate the class2type map +jQuery.each( "Boolean Number String Function Array Date RegExp Object Error Symbol".split( " " ), +function( i, name ) { + class2type[ "[object " + name + "]" ] = name.toLowerCase(); +} ); + +function isArrayLike( obj ) { + + // Support: real iOS 8.2 only (not reproducible in simulator) + // `in` check used to prevent JIT error (gh-2145) + // hasOwn isn't used here due to false negatives + // regarding Nodelist length in IE + var length = !!obj && "length" in obj && obj.length, + type = jQuery.type( obj ); + + if ( type === "function" || jQuery.isWindow( obj ) ) { + return false; + } + + return type === "array" || length === 0 || + typeof length === "number" && length > 0 && ( length - 1 ) in obj; +} +var Sizzle = +/*! + * Sizzle CSS Selector Engine v2.3.0 + * https://sizzlejs.com/ + * + * Copyright jQuery Foundation and other contributors + * Released under the MIT license + * http://jquery.org/license + * + * Date: 2016-01-04 + */ +(function( window ) { + +var i, + support, + Expr, + getText, + isXML, + tokenize, + compile, + select, + outermostContext, + sortInput, + hasDuplicate, + + // Local document vars + setDocument, + document, + docElem, + documentIsHTML, + rbuggyQSA, + rbuggyMatches, + matches, + contains, + + // Instance-specific data + expando = "sizzle" + 1 * new Date(), + preferredDoc = window.document, + dirruns = 0, + done = 0, + classCache = createCache(), + tokenCache = createCache(), + compilerCache = createCache(), + sortOrder = function( a, b ) { + if ( a === b ) { + hasDuplicate = true; + } + return 0; + }, + + // Instance methods + hasOwn = ({}).hasOwnProperty, + arr = [], + pop = arr.pop, + push_native = arr.push, + push = arr.push, + slice = arr.slice, + // Use a stripped-down indexOf as it's faster than native + // https://jsperf.com/thor-indexof-vs-for/5 + indexOf = function( list, elem ) { + var i = 0, + len = list.length; + for ( ; i < len; i++ ) { + if ( list[i] === elem ) { + return i; + } + } + return -1; + }, + + booleans = "checked|selected|async|autofocus|autoplay|controls|defer|disabled|hidden|ismap|loop|multiple|open|readonly|required|scoped", + + // Regular expressions + + // http://www.w3.org/TR/css3-selectors/#whitespace + whitespace = "[\\x20\\t\\r\\n\\f]", + + // http://www.w3.org/TR/CSS21/syndata.html#value-def-identifier + identifier = "(?:\\\\.|[\\w-]|[^\0-\\xa0])+", + + // Attribute selectors: http://www.w3.org/TR/selectors/#attribute-selectors + attributes = "\\[" + whitespace + "*(" + identifier + ")(?:" + whitespace + + // Operator (capture 2) + "*([*^$|!~]?=)" + whitespace + + // "Attribute values must be CSS identifiers [capture 5] or strings [capture 3 or capture 4]" + "*(?:'((?:\\\\.|[^\\\\'])*)'|\"((?:\\\\.|[^\\\\\"])*)\"|(" + identifier + "))|)" + whitespace + + "*\\]", + + pseudos = ":(" + identifier + ")(?:\\((" + + // To reduce the number of selectors needing tokenize in the preFilter, prefer arguments: + // 1. quoted (capture 3; capture 4 or capture 5) + "('((?:\\\\.|[^\\\\'])*)'|\"((?:\\\\.|[^\\\\\"])*)\")|" + + // 2. simple (capture 6) + "((?:\\\\.|[^\\\\()[\\]]|" + attributes + ")*)|" + + // 3. anything else (capture 2) + ".*" + + ")\\)|)", + + // Leading and non-escaped trailing whitespace, capturing some non-whitespace characters preceding the latter + rwhitespace = new RegExp( whitespace + "+", "g" ), + rtrim = new RegExp( "^" + whitespace + "+|((?:^|[^\\\\])(?:\\\\.)*)" + whitespace + "+$", "g" ), + + rcomma = new RegExp( "^" + whitespace + "*," + whitespace + "*" ), + rcombinators = new RegExp( "^" + whitespace + "*([>+~]|" + whitespace + ")" + whitespace + "*" ), + + rattributeQuotes = new RegExp( "=" + whitespace + "*([^\\]'\"]*?)" + whitespace + "*\\]", "g" ), + + rpseudo = new RegExp( pseudos ), + ridentifier = new RegExp( "^" + identifier + "$" ), + + matchExpr = { + "ID": new RegExp( "^#(" + identifier + ")" ), + "CLASS": new RegExp( "^\\.(" + identifier + ")" ), + "TAG": new RegExp( "^(" + identifier + "|[*])" ), + "ATTR": new RegExp( "^" + attributes ), + "PSEUDO": new RegExp( "^" + pseudos ), + "CHILD": new RegExp( "^:(only|first|last|nth|nth-last)-(child|of-type)(?:\\(" + whitespace + + "*(even|odd|(([+-]|)(\\d*)n|)" + whitespace + "*(?:([+-]|)" + whitespace + + "*(\\d+)|))" + whitespace + "*\\)|)", "i" ), + "bool": new RegExp( "^(?:" + booleans + ")$", "i" ), + // For use in libraries implementing .is() + // We use this for POS matching in `select` + "needsContext": new RegExp( "^" + whitespace + "*[>+~]|:(even|odd|eq|gt|lt|nth|first|last)(?:\\(" + + whitespace + "*((?:-\\d)?\\d*)" + whitespace + "*\\)|)(?=[^-]|$)", "i" ) + }, + + rinputs = /^(?:input|select|textarea|button)$/i, + rheader = /^h\d$/i, + + rnative = /^[^{]+\{\s*\[native \w/, + + // Easily-parseable/retrievable ID or TAG or CLASS selectors + rquickExpr = /^(?:#([\w-]+)|(\w+)|\.([\w-]+))$/, + + rsibling = /[+~]/, + + // CSS escapes + // http://www.w3.org/TR/CSS21/syndata.html#escaped-characters + runescape = new RegExp( "\\\\([\\da-f]{1,6}" + whitespace + "?|(" + whitespace + ")|.)", "ig" ), + funescape = function( _, escaped, escapedWhitespace ) { + var high = "0x" + escaped - 0x10000; + // NaN means non-codepoint + // Support: Firefox<24 + // Workaround erroneous numeric interpretation of +"0x" + return high !== high || escapedWhitespace ? + escaped : + high < 0 ? + // BMP codepoint + String.fromCharCode( high + 0x10000 ) : + // Supplemental Plane codepoint (surrogate pair) + String.fromCharCode( high >> 10 | 0xD800, high & 0x3FF | 0xDC00 ); + }, + + // CSS string/identifier serialization + // https://drafts.csswg.org/cssom/#common-serializing-idioms + rcssescape = /([\0-\x1f\x7f]|^-?\d)|^-$|[^\x80-\uFFFF\w-]/g, + fcssescape = function( ch, asCodePoint ) { + if ( asCodePoint ) { + + // U+0000 NULL becomes U+FFFD REPLACEMENT CHARACTER + if ( ch === "\0" ) { + return "\uFFFD"; + } + + // Control characters and (dependent upon position) numbers get escaped as code points + return ch.slice( 0, -1 ) + "\\" + ch.charCodeAt( ch.length - 1 ).toString( 16 ) + " "; + } + + // Other potentially-special ASCII characters get backslash-escaped + return "\\" + ch; + }, + + // Used for iframes + // See setDocument() + // Removing the function wrapper causes a "Permission Denied" + // error in IE + unloadHandler = function() { + setDocument(); + }, + + disabledAncestor = addCombinator( + function( elem ) { + return elem.disabled === true; + }, + { dir: "parentNode", next: "legend" } + ); + +// Optimize for push.apply( _, NodeList ) +try { + push.apply( + (arr = slice.call( preferredDoc.childNodes )), + preferredDoc.childNodes + ); + // Support: Android<4.0 + // Detect silently failing push.apply + arr[ preferredDoc.childNodes.length ].nodeType; +} catch ( e ) { + push = { apply: arr.length ? + + // Leverage slice if possible + function( target, els ) { + push_native.apply( target, slice.call(els) ); + } : + + // Support: IE<9 + // Otherwise append directly + function( target, els ) { + var j = target.length, + i = 0; + // Can't trust NodeList.length + while ( (target[j++] = els[i++]) ) {} + target.length = j - 1; + } + }; +} + +function Sizzle( selector, context, results, seed ) { + var m, i, elem, nid, match, groups, newSelector, + newContext = context && context.ownerDocument, + + // nodeType defaults to 9, since context defaults to document + nodeType = context ? context.nodeType : 9; + + results = results || []; + + // Return early from calls with invalid selector or context + if ( typeof selector !== "string" || !selector || + nodeType !== 1 && nodeType !== 9 && nodeType !== 11 ) { + + return results; + } + + // Try to shortcut find operations (as opposed to filters) in HTML documents + if ( !seed ) { + + if ( ( context ? context.ownerDocument || context : preferredDoc ) !== document ) { + setDocument( context ); + } + context = context || document; + + if ( documentIsHTML ) { + + // If the selector is sufficiently simple, try using a "get*By*" DOM method + // (excepting DocumentFragment context, where the methods don't exist) + if ( nodeType !== 11 && (match = rquickExpr.exec( selector )) ) { + + // ID selector + if ( (m = match[1]) ) { + + // Document context + if ( nodeType === 9 ) { + if ( (elem = context.getElementById( m )) ) { + + // Support: IE, Opera, Webkit + // TODO: identify versions + // getElementById can match elements by name instead of ID + if ( elem.id === m ) { + results.push( elem ); + return results; + } + } else { + return results; + } + + // Element context + } else { + + // Support: IE, Opera, Webkit + // TODO: identify versions + // getElementById can match elements by name instead of ID + if ( newContext && (elem = newContext.getElementById( m )) && + contains( context, elem ) && + elem.id === m ) { + + results.push( elem ); + return results; + } + } + + // Type selector + } else if ( match[2] ) { + push.apply( results, context.getElementsByTagName( selector ) ); + return results; + + // Class selector + } else if ( (m = match[3]) && support.getElementsByClassName && + context.getElementsByClassName ) { + + push.apply( results, context.getElementsByClassName( m ) ); + return results; + } + } + + // Take advantage of querySelectorAll + if ( support.qsa && + !compilerCache[ selector + " " ] && + (!rbuggyQSA || !rbuggyQSA.test( selector )) ) { + + if ( nodeType !== 1 ) { + newContext = context; + newSelector = selector; + + // qSA looks outside Element context, which is not what we want + // Thanks to Andrew Dupont for this workaround technique + // Support: IE <=8 + // Exclude object elements + } else if ( context.nodeName.toLowerCase() !== "object" ) { + + // Capture the context ID, setting it first if necessary + if ( (nid = context.getAttribute( "id" )) ) { + nid = nid.replace( rcssescape, fcssescape ); + } else { + context.setAttribute( "id", (nid = expando) ); + } + + // Prefix every selector in the list + groups = tokenize( selector ); + i = groups.length; + while ( i-- ) { + groups[i] = "#" + nid + " " + toSelector( groups[i] ); + } + newSelector = groups.join( "," ); + + // Expand context for sibling selectors + newContext = rsibling.test( selector ) && testContext( context.parentNode ) || + context; + } + + if ( newSelector ) { + try { + push.apply( results, + newContext.querySelectorAll( newSelector ) + ); + return results; + } catch ( qsaError ) { + } finally { + if ( nid === expando ) { + context.removeAttribute( "id" ); + } + } + } + } + } + } + + // All others + return select( selector.replace( rtrim, "$1" ), context, results, seed ); +} + +/** + * Create key-value caches of limited size + * @returns {function(string, object)} Returns the Object data after storing it on itself with + * property name the (space-suffixed) string and (if the cache is larger than Expr.cacheLength) + * deleting the oldest entry + */ +function createCache() { + var keys = []; + + function cache( key, value ) { + // Use (key + " ") to avoid collision with native prototype properties (see Issue #157) + if ( keys.push( key + " " ) > Expr.cacheLength ) { + // Only keep the most recent entries + delete cache[ keys.shift() ]; + } + return (cache[ key + " " ] = value); + } + return cache; +} + +/** + * Mark a function for special use by Sizzle + * @param {Function} fn The function to mark + */ +function markFunction( fn ) { + fn[ expando ] = true; + return fn; +} + +/** + * Support testing using an element + * @param {Function} fn Passed the created element and returns a boolean result + */ +function assert( fn ) { + var el = document.createElement("fieldset"); + + try { + return !!fn( el ); + } catch (e) { + return false; + } finally { + // Remove from its parent by default + if ( el.parentNode ) { + el.parentNode.removeChild( el ); + } + // release memory in IE + el = null; + } +} + +/** + * Adds the same handler for all of the specified attrs + * @param {String} attrs Pipe-separated list of attributes + * @param {Function} handler The method that will be applied + */ +function addHandle( attrs, handler ) { + var arr = attrs.split("|"), + i = arr.length; + + while ( i-- ) { + Expr.attrHandle[ arr[i] ] = handler; + } +} + +/** + * Checks document order of two siblings + * @param {Element} a + * @param {Element} b + * @returns {Number} Returns less than 0 if a precedes b, greater than 0 if a follows b + */ +function siblingCheck( a, b ) { + var cur = b && a, + diff = cur && a.nodeType === 1 && b.nodeType === 1 && + a.sourceIndex - b.sourceIndex; + + // Use IE sourceIndex if available on both nodes + if ( diff ) { + return diff; + } + + // Check if b follows a + if ( cur ) { + while ( (cur = cur.nextSibling) ) { + if ( cur === b ) { + return -1; + } + } + } + + return a ? 1 : -1; +} + +/** + * Returns a function to use in pseudos for input types + * @param {String} type + */ +function createInputPseudo( type ) { + return function( elem ) { + var name = elem.nodeName.toLowerCase(); + return name === "input" && elem.type === type; + }; +} + +/** + * Returns a function to use in pseudos for buttons + * @param {String} type + */ +function createButtonPseudo( type ) { + return function( elem ) { + var name = elem.nodeName.toLowerCase(); + return (name === "input" || name === "button") && elem.type === type; + }; +} + +/** + * Returns a function to use in pseudos for :enabled/:disabled + * @param {Boolean} disabled true for :disabled; false for :enabled + */ +function createDisabledPseudo( disabled ) { + // Known :disabled false positives: + // IE: *[disabled]:not(button, input, select, textarea, optgroup, option, menuitem, fieldset) + // not IE: fieldset[disabled] > legend:nth-of-type(n+2) :can-disable + return function( elem ) { + + // Check form elements and option elements for explicit disabling + return "label" in elem && elem.disabled === disabled || + "form" in elem && elem.disabled === disabled || + + // Check non-disabled form elements for fieldset[disabled] ancestors + "form" in elem && elem.disabled === false && ( + // Support: IE6-11+ + // Ancestry is covered for us + elem.isDisabled === disabled || + + // Otherwise, assume any non-<option> under fieldset[disabled] is disabled + /* jshint -W018 */ + elem.isDisabled !== !disabled && + ("label" in elem || !disabledAncestor( elem )) !== disabled + ); + }; +} + +/** + * Returns a function to use in pseudos for positionals + * @param {Function} fn + */ +function createPositionalPseudo( fn ) { + return markFunction(function( argument ) { + argument = +argument; + return markFunction(function( seed, matches ) { + var j, + matchIndexes = fn( [], seed.length, argument ), + i = matchIndexes.length; + + // Match elements found at the specified indexes + while ( i-- ) { + if ( seed[ (j = matchIndexes[i]) ] ) { + seed[j] = !(matches[j] = seed[j]); + } + } + }); + }); +} + +/** + * Checks a node for validity as a Sizzle context + * @param {Element|Object=} context + * @returns {Element|Object|Boolean} The input node if acceptable, otherwise a falsy value + */ +function testContext( context ) { + return context && typeof context.getElementsByTagName !== "undefined" && context; +} + +// Expose support vars for convenience +support = Sizzle.support = {}; + +/** + * Detects XML nodes + * @param {Element|Object} elem An element or a document + * @returns {Boolean} True iff elem is a non-HTML XML node + */ +isXML = Sizzle.isXML = function( elem ) { + // documentElement is verified for cases where it doesn't yet exist + // (such as loading iframes in IE - #4833) + var documentElement = elem && (elem.ownerDocument || elem).documentElement; + return documentElement ? documentElement.nodeName !== "HTML" : false; +}; + +/** + * Sets document-related variables once based on the current document + * @param {Element|Object} [doc] An element or document object to use to set the document + * @returns {Object} Returns the current document + */ +setDocument = Sizzle.setDocument = function( node ) { + var hasCompare, subWindow, + doc = node ? node.ownerDocument || node : preferredDoc; + + // Return early if doc is invalid or already selected + if ( doc === document || doc.nodeType !== 9 || !doc.documentElement ) { + return document; + } + + // Update global variables + document = doc; + docElem = document.documentElement; + documentIsHTML = !isXML( document ); + + // Support: IE 9-11, Edge + // Accessing iframe documents after unload throws "permission denied" errors (jQuery #13936) + if ( preferredDoc !== document && + (subWindow = document.defaultView) && subWindow.top !== subWindow ) { + + // Support: IE 11, Edge + if ( subWindow.addEventListener ) { + subWindow.addEventListener( "unload", unloadHandler, false ); + + // Support: IE 9 - 10 only + } else if ( subWindow.attachEvent ) { + subWindow.attachEvent( "onunload", unloadHandler ); + } + } + + /* Attributes + ---------------------------------------------------------------------- */ + + // Support: IE<8 + // Verify that getAttribute really returns attributes and not properties + // (excepting IE8 booleans) + support.attributes = assert(function( el ) { + el.className = "i"; + return !el.getAttribute("className"); + }); + + /* getElement(s)By* + ---------------------------------------------------------------------- */ + + // Check if getElementsByTagName("*") returns only elements + support.getElementsByTagName = assert(function( el ) { + el.appendChild( document.createComment("") ); + return !el.getElementsByTagName("*").length; + }); + + // Support: IE<9 + support.getElementsByClassName = rnative.test( document.getElementsByClassName ); + + // Support: IE<10 + // Check if getElementById returns elements by name + // The broken getElementById methods don't pick up programmatically-set names, + // so use a roundabout getElementsByName test + support.getById = assert(function( el ) { + docElem.appendChild( el ).id = expando; + return !document.getElementsByName || !document.getElementsByName( expando ).length; + }); + + // ID find and filter + if ( support.getById ) { + Expr.find["ID"] = function( id, context ) { + if ( typeof context.getElementById !== "undefined" && documentIsHTML ) { + var m = context.getElementById( id ); + return m ? [ m ] : []; + } + }; + Expr.filter["ID"] = function( id ) { + var attrId = id.replace( runescape, funescape ); + return function( elem ) { + return elem.getAttribute("id") === attrId; + }; + }; + } else { + // Support: IE6/7 + // getElementById is not reliable as a find shortcut + delete Expr.find["ID"]; + + Expr.filter["ID"] = function( id ) { + var attrId = id.replace( runescape, funescape ); + return function( elem ) { + var node = typeof elem.getAttributeNode !== "undefined" && + elem.getAttributeNode("id"); + return node && node.value === attrId; + }; + }; + } + + // Tag + Expr.find["TAG"] = support.getElementsByTagName ? + function( tag, context ) { + if ( typeof context.getElementsByTagName !== "undefined" ) { + return context.getElementsByTagName( tag ); + + // DocumentFragment nodes don't have gEBTN + } else if ( support.qsa ) { + return context.querySelectorAll( tag ); + } + } : + + function( tag, context ) { + var elem, + tmp = [], + i = 0, + // By happy coincidence, a (broken) gEBTN appears on DocumentFragment nodes too + results = context.getElementsByTagName( tag ); + + // Filter out possible comments + if ( tag === "*" ) { + while ( (elem = results[i++]) ) { + if ( elem.nodeType === 1 ) { + tmp.push( elem ); + } + } + + return tmp; + } + return results; + }; + + // Class + Expr.find["CLASS"] = support.getElementsByClassName && function( className, context ) { + if ( typeof context.getElementsByClassName !== "undefined" && documentIsHTML ) { + return context.getElementsByClassName( className ); + } + }; + + /* QSA/matchesSelector + ---------------------------------------------------------------------- */ + + // QSA and matchesSelector support + + // matchesSelector(:active) reports false when true (IE9/Opera 11.5) + rbuggyMatches = []; + + // qSa(:focus) reports false when true (Chrome 21) + // We allow this because of a bug in IE8/9 that throws an error + // whenever `document.activeElement` is accessed on an iframe + // So, we allow :focus to pass through QSA all the time to avoid the IE error + // See https://bugs.jquery.com/ticket/13378 + rbuggyQSA = []; + + if ( (support.qsa = rnative.test( document.querySelectorAll )) ) { + // Build QSA regex + // Regex strategy adopted from Diego Perini + assert(function( el ) { + // Select is set to empty string on purpose + // This is to test IE's treatment of not explicitly + // setting a boolean content attribute, + // since its presence should be enough + // https://bugs.jquery.com/ticket/12359 + docElem.appendChild( el ).innerHTML = "<a id='" + expando + "'></a>" + + "<select id='" + expando + "-\r\\' msallowcapture=''>" + + "<option selected=''></option></select>"; + + // Support: IE8, Opera 11-12.16 + // Nothing should be selected when empty strings follow ^= or $= or *= + // The test attribute must be unknown in Opera but "safe" for WinRT + // https://msdn.microsoft.com/en-us/library/ie/hh465388.aspx#attribute_section + if ( el.querySelectorAll("[msallowcapture^='']").length ) { + rbuggyQSA.push( "[*^$]=" + whitespace + "*(?:''|\"\")" ); + } + + // Support: IE8 + // Boolean attributes and "value" are not treated correctly + if ( !el.querySelectorAll("[selected]").length ) { + rbuggyQSA.push( "\\[" + whitespace + "*(?:value|" + booleans + ")" ); + } + + // Support: Chrome<29, Android<4.4, Safari<7.0+, iOS<7.0+, PhantomJS<1.9.8+ + if ( !el.querySelectorAll( "[id~=" + expando + "-]" ).length ) { + rbuggyQSA.push("~="); + } + + // Webkit/Opera - :checked should return selected option elements + // http://www.w3.org/TR/2011/REC-css3-selectors-20110929/#checked + // IE8 throws error here and will not see later tests + if ( !el.querySelectorAll(":checked").length ) { + rbuggyQSA.push(":checked"); + } + + // Support: Safari 8+, iOS 8+ + // https://bugs.webkit.org/show_bug.cgi?id=136851 + // In-page `selector#id sibling-combinator selector` fails + if ( !el.querySelectorAll( "a#" + expando + "+*" ).length ) { + rbuggyQSA.push(".#.+[+~]"); + } + }); + + assert(function( el ) { + el.innerHTML = "<a href='' disabled='disabled'></a>" + + "<select disabled='disabled'><option/></select>"; + + // Support: Windows 8 Native Apps + // The type and name attributes are restricted during .innerHTML assignment + var input = document.createElement("input"); + input.setAttribute( "type", "hidden" ); + el.appendChild( input ).setAttribute( "name", "D" ); + + // Support: IE8 + // Enforce case-sensitivity of name attribute + if ( el.querySelectorAll("[name=d]").length ) { + rbuggyQSA.push( "name" + whitespace + "*[*^$|!~]?=" ); + } + + // FF 3.5 - :enabled/:disabled and hidden elements (hidden elements are still enabled) + // IE8 throws error here and will not see later tests + if ( el.querySelectorAll(":enabled").length !== 2 ) { + rbuggyQSA.push( ":enabled", ":disabled" ); + } + + // Support: IE9-11+ + // IE's :disabled selector does not pick up the children of disabled fieldsets + docElem.appendChild( el ).disabled = true; + if ( el.querySelectorAll(":disabled").length !== 2 ) { + rbuggyQSA.push( ":enabled", ":disabled" ); + } + + // Opera 10-11 does not throw on post-comma invalid pseudos + el.querySelectorAll("*,:x"); + rbuggyQSA.push(",.*:"); + }); + } + + if ( (support.matchesSelector = rnative.test( (matches = docElem.matches || + docElem.webkitMatchesSelector || + docElem.mozMatchesSelector || + docElem.oMatchesSelector || + docElem.msMatchesSelector) )) ) { + + assert(function( el ) { + // Check to see if it's possible to do matchesSelector + // on a disconnected node (IE 9) + support.disconnectedMatch = matches.call( el, "*" ); + + // This should fail with an exception + // Gecko does not error, returns false instead + matches.call( el, "[s!='']:x" ); + rbuggyMatches.push( "!=", pseudos ); + }); + } + + rbuggyQSA = rbuggyQSA.length && new RegExp( rbuggyQSA.join("|") ); + rbuggyMatches = rbuggyMatches.length && new RegExp( rbuggyMatches.join("|") ); + + /* Contains + ---------------------------------------------------------------------- */ + hasCompare = rnative.test( docElem.compareDocumentPosition ); + + // Element contains another + // Purposefully self-exclusive + // As in, an element does not contain itself + contains = hasCompare || rnative.test( docElem.contains ) ? + function( a, b ) { + var adown = a.nodeType === 9 ? a.documentElement : a, + bup = b && b.parentNode; + return a === bup || !!( bup && bup.nodeType === 1 && ( + adown.contains ? + adown.contains( bup ) : + a.compareDocumentPosition && a.compareDocumentPosition( bup ) & 16 + )); + } : + function( a, b ) { + if ( b ) { + while ( (b = b.parentNode) ) { + if ( b === a ) { + return true; + } + } + } + return false; + }; + + /* Sorting + ---------------------------------------------------------------------- */ + + // Document order sorting + sortOrder = hasCompare ? + function( a, b ) { + + // Flag for duplicate removal + if ( a === b ) { + hasDuplicate = true; + return 0; + } + + // Sort on method existence if only one input has compareDocumentPosition + var compare = !a.compareDocumentPosition - !b.compareDocumentPosition; + if ( compare ) { + return compare; + } + + // Calculate position if both inputs belong to the same document + compare = ( a.ownerDocument || a ) === ( b.ownerDocument || b ) ? + a.compareDocumentPosition( b ) : + + // Otherwise we know they are disconnected + 1; + + // Disconnected nodes + if ( compare & 1 || + (!support.sortDetached && b.compareDocumentPosition( a ) === compare) ) { + + // Choose the first element that is related to our preferred document + if ( a === document || a.ownerDocument === preferredDoc && contains(preferredDoc, a) ) { + return -1; + } + if ( b === document || b.ownerDocument === preferredDoc && contains(preferredDoc, b) ) { + return 1; + } + + // Maintain original order + return sortInput ? + ( indexOf( sortInput, a ) - indexOf( sortInput, b ) ) : + 0; + } + + return compare & 4 ? -1 : 1; + } : + function( a, b ) { + // Exit early if the nodes are identical + if ( a === b ) { + hasDuplicate = true; + return 0; + } + + var cur, + i = 0, + aup = a.parentNode, + bup = b.parentNode, + ap = [ a ], + bp = [ b ]; + + // Parentless nodes are either documents or disconnected + if ( !aup || !bup ) { + return a === document ? -1 : + b === document ? 1 : + aup ? -1 : + bup ? 1 : + sortInput ? + ( indexOf( sortInput, a ) - indexOf( sortInput, b ) ) : + 0; + + // If the nodes are siblings, we can do a quick check + } else if ( aup === bup ) { + return siblingCheck( a, b ); + } + + // Otherwise we need full lists of their ancestors for comparison + cur = a; + while ( (cur = cur.parentNode) ) { + ap.unshift( cur ); + } + cur = b; + while ( (cur = cur.parentNode) ) { + bp.unshift( cur ); + } + + // Walk down the tree looking for a discrepancy + while ( ap[i] === bp[i] ) { + i++; + } + + return i ? + // Do a sibling check if the nodes have a common ancestor + siblingCheck( ap[i], bp[i] ) : + + // Otherwise nodes in our document sort first + ap[i] === preferredDoc ? -1 : + bp[i] === preferredDoc ? 1 : + 0; + }; + + return document; +}; + +Sizzle.matches = function( expr, elements ) { + return Sizzle( expr, null, null, elements ); +}; + +Sizzle.matchesSelector = function( elem, expr ) { + // Set document vars if needed + if ( ( elem.ownerDocument || elem ) !== document ) { + setDocument( elem ); + } + + // Make sure that attribute selectors are quoted + expr = expr.replace( rattributeQuotes, "='$1']" ); + + if ( support.matchesSelector && documentIsHTML && + !compilerCache[ expr + " " ] && + ( !rbuggyMatches || !rbuggyMatches.test( expr ) ) && + ( !rbuggyQSA || !rbuggyQSA.test( expr ) ) ) { + + try { + var ret = matches.call( elem, expr ); + + // IE 9's matchesSelector returns false on disconnected nodes + if ( ret || support.disconnectedMatch || + // As well, disconnected nodes are said to be in a document + // fragment in IE 9 + elem.document && elem.document.nodeType !== 11 ) { + return ret; + } + } catch (e) {} + } + + return Sizzle( expr, document, null, [ elem ] ).length > 0; +}; + +Sizzle.contains = function( context, elem ) { + // Set document vars if needed + if ( ( context.ownerDocument || context ) !== document ) { + setDocument( context ); + } + return contains( context, elem ); +}; + +Sizzle.attr = function( elem, name ) { + // Set document vars if needed + if ( ( elem.ownerDocument || elem ) !== document ) { + setDocument( elem ); + } + + var fn = Expr.attrHandle[ name.toLowerCase() ], + // Don't get fooled by Object.prototype properties (jQuery #13807) + val = fn && hasOwn.call( Expr.attrHandle, name.toLowerCase() ) ? + fn( elem, name, !documentIsHTML ) : + undefined; + + return val !== undefined ? + val : + support.attributes || !documentIsHTML ? + elem.getAttribute( name ) : + (val = elem.getAttributeNode(name)) && val.specified ? + val.value : + null; +}; + +Sizzle.escape = function( sel ) { + return (sel + "").replace( rcssescape, fcssescape ); +}; + +Sizzle.error = function( msg ) { + throw new Error( "Syntax error, unrecognized expression: " + msg ); +}; + +/** + * Document sorting and removing duplicates + * @param {ArrayLike} results + */ +Sizzle.uniqueSort = function( results ) { + var elem, + duplicates = [], + j = 0, + i = 0; + + // Unless we *know* we can detect duplicates, assume their presence + hasDuplicate = !support.detectDuplicates; + sortInput = !support.sortStable && results.slice( 0 ); + results.sort( sortOrder ); + + if ( hasDuplicate ) { + while ( (elem = results[i++]) ) { + if ( elem === results[ i ] ) { + j = duplicates.push( i ); + } + } + while ( j-- ) { + results.splice( duplicates[ j ], 1 ); + } + } + + // Clear input after sorting to release objects + // See https://github.com/jquery/sizzle/pull/225 + sortInput = null; + + return results; +}; + +/** + * Utility function for retrieving the text value of an array of DOM nodes + * @param {Array|Element} elem + */ +getText = Sizzle.getText = function( elem ) { + var node, + ret = "", + i = 0, + nodeType = elem.nodeType; + + if ( !nodeType ) { + // If no nodeType, this is expected to be an array + while ( (node = elem[i++]) ) { + // Do not traverse comment nodes + ret += getText( node ); + } + } else if ( nodeType === 1 || nodeType === 9 || nodeType === 11 ) { + // Use textContent for elements + // innerText usage removed for consistency of new lines (jQuery #11153) + if ( typeof elem.textContent === "string" ) { + return elem.textContent; + } else { + // Traverse its children + for ( elem = elem.firstChild; elem; elem = elem.nextSibling ) { + ret += getText( elem ); + } + } + } else if ( nodeType === 3 || nodeType === 4 ) { + return elem.nodeValue; + } + // Do not include comment or processing instruction nodes + + return ret; +}; + +Expr = Sizzle.selectors = { + + // Can be adjusted by the user + cacheLength: 50, + + createPseudo: markFunction, + + match: matchExpr, + + attrHandle: {}, + + find: {}, + + relative: { + ">": { dir: "parentNode", first: true }, + " ": { dir: "parentNode" }, + "+": { dir: "previousSibling", first: true }, + "~": { dir: "previousSibling" } + }, + + preFilter: { + "ATTR": function( match ) { + match[1] = match[1].replace( runescape, funescape ); + + // Move the given value to match[3] whether quoted or unquoted + match[3] = ( match[3] || match[4] || match[5] || "" ).replace( runescape, funescape ); + + if ( match[2] === "~=" ) { + match[3] = " " + match[3] + " "; + } + + return match.slice( 0, 4 ); + }, + + "CHILD": function( match ) { + /* matches from matchExpr["CHILD"] + 1 type (only|nth|...) + 2 what (child|of-type) + 3 argument (even|odd|\d*|\d*n([+-]\d+)?|...) + 4 xn-component of xn+y argument ([+-]?\d*n|) + 5 sign of xn-component + 6 x of xn-component + 7 sign of y-component + 8 y of y-component + */ + match[1] = match[1].toLowerCase(); + + if ( match[1].slice( 0, 3 ) === "nth" ) { + // nth-* requires argument + if ( !match[3] ) { + Sizzle.error( match[0] ); + } + + // numeric x and y parameters for Expr.filter.CHILD + // remember that false/true cast respectively to 0/1 + match[4] = +( match[4] ? match[5] + (match[6] || 1) : 2 * ( match[3] === "even" || match[3] === "odd" ) ); + match[5] = +( ( match[7] + match[8] ) || match[3] === "odd" ); + + // other types prohibit arguments + } else if ( match[3] ) { + Sizzle.error( match[0] ); + } + + return match; + }, + + "PSEUDO": function( match ) { + var excess, + unquoted = !match[6] && match[2]; + + if ( matchExpr["CHILD"].test( match[0] ) ) { + return null; + } + + // Accept quoted arguments as-is + if ( match[3] ) { + match[2] = match[4] || match[5] || ""; + + // Strip excess characters from unquoted arguments + } else if ( unquoted && rpseudo.test( unquoted ) && + // Get excess from tokenize (recursively) + (excess = tokenize( unquoted, true )) && + // advance to the next closing parenthesis + (excess = unquoted.indexOf( ")", unquoted.length - excess ) - unquoted.length) ) { + + // excess is a negative index + match[0] = match[0].slice( 0, excess ); + match[2] = unquoted.slice( 0, excess ); + } + + // Return only captures needed by the pseudo filter method (type and argument) + return match.slice( 0, 3 ); + } + }, + + filter: { + + "TAG": function( nodeNameSelector ) { + var nodeName = nodeNameSelector.replace( runescape, funescape ).toLowerCase(); + return nodeNameSelector === "*" ? + function() { return true; } : + function( elem ) { + return elem.nodeName && elem.nodeName.toLowerCase() === nodeName; + }; + }, + + "CLASS": function( className ) { + var pattern = classCache[ className + " " ]; + + return pattern || + (pattern = new RegExp( "(^|" + whitespace + ")" + className + "(" + whitespace + "|$)" )) && + classCache( className, function( elem ) { + return pattern.test( typeof elem.className === "string" && elem.className || typeof elem.getAttribute !== "undefined" && elem.getAttribute("class") || "" ); + }); + }, + + "ATTR": function( name, operator, check ) { + return function( elem ) { + var result = Sizzle.attr( elem, name ); + + if ( result == null ) { + return operator === "!="; + } + if ( !operator ) { + return true; + } + + result += ""; + + return operator === "=" ? result === check : + operator === "!=" ? result !== check : + operator === "^=" ? check && result.indexOf( check ) === 0 : + operator === "*=" ? check && result.indexOf( check ) > -1 : + operator === "$=" ? check && result.slice( -check.length ) === check : + operator === "~=" ? ( " " + result.replace( rwhitespace, " " ) + " " ).indexOf( check ) > -1 : + operator === "|=" ? result === check || result.slice( 0, check.length + 1 ) === check + "-" : + false; + }; + }, + + "CHILD": function( type, what, argument, first, last ) { + var simple = type.slice( 0, 3 ) !== "nth", + forward = type.slice( -4 ) !== "last", + ofType = what === "of-type"; + + return first === 1 && last === 0 ? + + // Shortcut for :nth-*(n) + function( elem ) { + return !!elem.parentNode; + } : + + function( elem, context, xml ) { + var cache, uniqueCache, outerCache, node, nodeIndex, start, + dir = simple !== forward ? "nextSibling" : "previousSibling", + parent = elem.parentNode, + name = ofType && elem.nodeName.toLowerCase(), + useCache = !xml && !ofType, + diff = false; + + if ( parent ) { + + // :(first|last|only)-(child|of-type) + if ( simple ) { + while ( dir ) { + node = elem; + while ( (node = node[ dir ]) ) { + if ( ofType ? + node.nodeName.toLowerCase() === name : + node.nodeType === 1 ) { + + return false; + } + } + // Reverse direction for :only-* (if we haven't yet done so) + start = dir = type === "only" && !start && "nextSibling"; + } + return true; + } + + start = [ forward ? parent.firstChild : parent.lastChild ]; + + // non-xml :nth-child(...) stores cache data on `parent` + if ( forward && useCache ) { + + // Seek `elem` from a previously-cached index + + // ...in a gzip-friendly way + node = parent; + outerCache = node[ expando ] || (node[ expando ] = {}); + + // Support: IE <9 only + // Defend against cloned attroperties (jQuery gh-1709) + uniqueCache = outerCache[ node.uniqueID ] || + (outerCache[ node.uniqueID ] = {}); + + cache = uniqueCache[ type ] || []; + nodeIndex = cache[ 0 ] === dirruns && cache[ 1 ]; + diff = nodeIndex && cache[ 2 ]; + node = nodeIndex && parent.childNodes[ nodeIndex ]; + + while ( (node = ++nodeIndex && node && node[ dir ] || + + // Fallback to seeking `elem` from the start + (diff = nodeIndex = 0) || start.pop()) ) { + + // When found, cache indexes on `parent` and break + if ( node.nodeType === 1 && ++diff && node === elem ) { + uniqueCache[ type ] = [ dirruns, nodeIndex, diff ]; + break; + } + } + + } else { + // Use previously-cached element index if available + if ( useCache ) { + // ...in a gzip-friendly way + node = elem; + outerCache = node[ expando ] || (node[ expando ] = {}); + + // Support: IE <9 only + // Defend against cloned attroperties (jQuery gh-1709) + uniqueCache = outerCache[ node.uniqueID ] || + (outerCache[ node.uniqueID ] = {}); + + cache = uniqueCache[ type ] || []; + nodeIndex = cache[ 0 ] === dirruns && cache[ 1 ]; + diff = nodeIndex; + } + + // xml :nth-child(...) + // or :nth-last-child(...) or :nth(-last)?-of-type(...) + if ( diff === false ) { + // Use the same loop as above to seek `elem` from the start + while ( (node = ++nodeIndex && node && node[ dir ] || + (diff = nodeIndex = 0) || start.pop()) ) { + + if ( ( ofType ? + node.nodeName.toLowerCase() === name : + node.nodeType === 1 ) && + ++diff ) { + + // Cache the index of each encountered element + if ( useCache ) { + outerCache = node[ expando ] || (node[ expando ] = {}); + + // Support: IE <9 only + // Defend against cloned attroperties (jQuery gh-1709) + uniqueCache = outerCache[ node.uniqueID ] || + (outerCache[ node.uniqueID ] = {}); + + uniqueCache[ type ] = [ dirruns, diff ]; + } + + if ( node === elem ) { + break; + } + } + } + } + } + + // Incorporate the offset, then check against cycle size + diff -= last; + return diff === first || ( diff % first === 0 && diff / first >= 0 ); + } + }; + }, + + "PSEUDO": function( pseudo, argument ) { + // pseudo-class names are case-insensitive + // http://www.w3.org/TR/selectors/#pseudo-classes + // Prioritize by case sensitivity in case custom pseudos are added with uppercase letters + // Remember that setFilters inherits from pseudos + var args, + fn = Expr.pseudos[ pseudo ] || Expr.setFilters[ pseudo.toLowerCase() ] || + Sizzle.error( "unsupported pseudo: " + pseudo ); + + // The user may use createPseudo to indicate that + // arguments are needed to create the filter function + // just as Sizzle does + if ( fn[ expando ] ) { + return fn( argument ); + } + + // But maintain support for old signatures + if ( fn.length > 1 ) { + args = [ pseudo, pseudo, "", argument ]; + return Expr.setFilters.hasOwnProperty( pseudo.toLowerCase() ) ? + markFunction(function( seed, matches ) { + var idx, + matched = fn( seed, argument ), + i = matched.length; + while ( i-- ) { + idx = indexOf( seed, matched[i] ); + seed[ idx ] = !( matches[ idx ] = matched[i] ); + } + }) : + function( elem ) { + return fn( elem, 0, args ); + }; + } + + return fn; + } + }, + + pseudos: { + // Potentially complex pseudos + "not": markFunction(function( selector ) { + // Trim the selector passed to compile + // to avoid treating leading and trailing + // spaces as combinators + var input = [], + results = [], + matcher = compile( selector.replace( rtrim, "$1" ) ); + + return matcher[ expando ] ? + markFunction(function( seed, matches, context, xml ) { + var elem, + unmatched = matcher( seed, null, xml, [] ), + i = seed.length; + + // Match elements unmatched by `matcher` + while ( i-- ) { + if ( (elem = unmatched[i]) ) { + seed[i] = !(matches[i] = elem); + } + } + }) : + function( elem, context, xml ) { + input[0] = elem; + matcher( input, null, xml, results ); + // Don't keep the element (issue #299) + input[0] = null; + return !results.pop(); + }; + }), + + "has": markFunction(function( selector ) { + return function( elem ) { + return Sizzle( selector, elem ).length > 0; + }; + }), + + "contains": markFunction(function( text ) { + text = text.replace( runescape, funescape ); + return function( elem ) { + return ( elem.textContent || elem.innerText || getText( elem ) ).indexOf( text ) > -1; + }; + }), + + // "Whether an element is represented by a :lang() selector + // is based solely on the element's language value + // being equal to the identifier C, + // or beginning with the identifier C immediately followed by "-". + // The matching of C against the element's language value is performed case-insensitively. + // The identifier C does not have to be a valid language name." + // http://www.w3.org/TR/selectors/#lang-pseudo + "lang": markFunction( function( lang ) { + // lang value must be a valid identifier + if ( !ridentifier.test(lang || "") ) { + Sizzle.error( "unsupported lang: " + lang ); + } + lang = lang.replace( runescape, funescape ).toLowerCase(); + return function( elem ) { + var elemLang; + do { + if ( (elemLang = documentIsHTML ? + elem.lang : + elem.getAttribute("xml:lang") || elem.getAttribute("lang")) ) { + + elemLang = elemLang.toLowerCase(); + return elemLang === lang || elemLang.indexOf( lang + "-" ) === 0; + } + } while ( (elem = elem.parentNode) && elem.nodeType === 1 ); + return false; + }; + }), + + // Miscellaneous + "target": function( elem ) { + var hash = window.location && window.location.hash; + return hash && hash.slice( 1 ) === elem.id; + }, + + "root": function( elem ) { + return elem === docElem; + }, + + "focus": function( elem ) { + return elem === document.activeElement && (!document.hasFocus || document.hasFocus()) && !!(elem.type || elem.href || ~elem.tabIndex); + }, + + // Boolean properties + "enabled": createDisabledPseudo( false ), + "disabled": createDisabledPseudo( true ), + + "checked": function( elem ) { + // In CSS3, :checked should return both checked and selected elements + // http://www.w3.org/TR/2011/REC-css3-selectors-20110929/#checked + var nodeName = elem.nodeName.toLowerCase(); + return (nodeName === "input" && !!elem.checked) || (nodeName === "option" && !!elem.selected); + }, + + "selected": function( elem ) { + // Accessing this property makes selected-by-default + // options in Safari work properly + if ( elem.parentNode ) { + elem.parentNode.selectedIndex; + } + + return elem.selected === true; + }, + + // Contents + "empty": function( elem ) { + // http://www.w3.org/TR/selectors/#empty-pseudo + // :empty is negated by element (1) or content nodes (text: 3; cdata: 4; entity ref: 5), + // but not by others (comment: 8; processing instruction: 7; etc.) + // nodeType < 6 works because attributes (2) do not appear as children + for ( elem = elem.firstChild; elem; elem = elem.nextSibling ) { + if ( elem.nodeType < 6 ) { + return false; + } + } + return true; + }, + + "parent": function( elem ) { + return !Expr.pseudos["empty"]( elem ); + }, + + // Element/input types + "header": function( elem ) { + return rheader.test( elem.nodeName ); + }, + + "input": function( elem ) { + return rinputs.test( elem.nodeName ); + }, + + "button": function( elem ) { + var name = elem.nodeName.toLowerCase(); + return name === "input" && elem.type === "button" || name === "button"; + }, + + "text": function( elem ) { + var attr; + return elem.nodeName.toLowerCase() === "input" && + elem.type === "text" && + + // Support: IE<8 + // New HTML5 attribute values (e.g., "search") appear with elem.type === "text" + ( (attr = elem.getAttribute("type")) == null || attr.toLowerCase() === "text" ); + }, + + // Position-in-collection + "first": createPositionalPseudo(function() { + return [ 0 ]; + }), + + "last": createPositionalPseudo(function( matchIndexes, length ) { + return [ length - 1 ]; + }), + + "eq": createPositionalPseudo(function( matchIndexes, length, argument ) { + return [ argument < 0 ? argument + length : argument ]; + }), + + "even": createPositionalPseudo(function( matchIndexes, length ) { + var i = 0; + for ( ; i < length; i += 2 ) { + matchIndexes.push( i ); + } + return matchIndexes; + }), + + "odd": createPositionalPseudo(function( matchIndexes, length ) { + var i = 1; + for ( ; i < length; i += 2 ) { + matchIndexes.push( i ); + } + return matchIndexes; + }), + + "lt": createPositionalPseudo(function( matchIndexes, length, argument ) { + var i = argument < 0 ? argument + length : argument; + for ( ; --i >= 0; ) { + matchIndexes.push( i ); + } + return matchIndexes; + }), + + "gt": createPositionalPseudo(function( matchIndexes, length, argument ) { + var i = argument < 0 ? argument + length : argument; + for ( ; ++i < length; ) { + matchIndexes.push( i ); + } + return matchIndexes; + }) + } +}; + +Expr.pseudos["nth"] = Expr.pseudos["eq"]; + +// Add button/input type pseudos +for ( i in { radio: true, checkbox: true, file: true, password: true, image: true } ) { + Expr.pseudos[ i ] = createInputPseudo( i ); +} +for ( i in { submit: true, reset: true } ) { + Expr.pseudos[ i ] = createButtonPseudo( i ); +} + +// Easy API for creating new setFilters +function setFilters() {} +setFilters.prototype = Expr.filters = Expr.pseudos; +Expr.setFilters = new setFilters(); + +tokenize = Sizzle.tokenize = function( selector, parseOnly ) { + var matched, match, tokens, type, + soFar, groups, preFilters, + cached = tokenCache[ selector + " " ]; + + if ( cached ) { + return parseOnly ? 0 : cached.slice( 0 ); + } + + soFar = selector; + groups = []; + preFilters = Expr.preFilter; + + while ( soFar ) { + + // Comma and first run + if ( !matched || (match = rcomma.exec( soFar )) ) { + if ( match ) { + // Don't consume trailing commas as valid + soFar = soFar.slice( match[0].length ) || soFar; + } + groups.push( (tokens = []) ); + } + + matched = false; + + // Combinators + if ( (match = rcombinators.exec( soFar )) ) { + matched = match.shift(); + tokens.push({ + value: matched, + // Cast descendant combinators to space + type: match[0].replace( rtrim, " " ) + }); + soFar = soFar.slice( matched.length ); + } + + // Filters + for ( type in Expr.filter ) { + if ( (match = matchExpr[ type ].exec( soFar )) && (!preFilters[ type ] || + (match = preFilters[ type ]( match ))) ) { + matched = match.shift(); + tokens.push({ + value: matched, + type: type, + matches: match + }); + soFar = soFar.slice( matched.length ); + } + } + + if ( !matched ) { + break; + } + } + + // Return the length of the invalid excess + // if we're just parsing + // Otherwise, throw an error or return tokens + return parseOnly ? + soFar.length : + soFar ? + Sizzle.error( selector ) : + // Cache the tokens + tokenCache( selector, groups ).slice( 0 ); +}; + +function toSelector( tokens ) { + var i = 0, + len = tokens.length, + selector = ""; + for ( ; i < len; i++ ) { + selector += tokens[i].value; + } + return selector; +} + +function addCombinator( matcher, combinator, base ) { + var dir = combinator.dir, + skip = combinator.next, + key = skip || dir, + checkNonElements = base && key === "parentNode", + doneName = done++; + + return combinator.first ? + // Check against closest ancestor/preceding element + function( elem, context, xml ) { + while ( (elem = elem[ dir ]) ) { + if ( elem.nodeType === 1 || checkNonElements ) { + return matcher( elem, context, xml ); + } + } + } : + + // Check against all ancestor/preceding elements + function( elem, context, xml ) { + var oldCache, uniqueCache, outerCache, + newCache = [ dirruns, doneName ]; + + // We can't set arbitrary data on XML nodes, so they don't benefit from combinator caching + if ( xml ) { + while ( (elem = elem[ dir ]) ) { + if ( elem.nodeType === 1 || checkNonElements ) { + if ( matcher( elem, context, xml ) ) { + return true; + } + } + } + } else { + while ( (elem = elem[ dir ]) ) { + if ( elem.nodeType === 1 || checkNonElements ) { + outerCache = elem[ expando ] || (elem[ expando ] = {}); + + // Support: IE <9 only + // Defend against cloned attroperties (jQuery gh-1709) + uniqueCache = outerCache[ elem.uniqueID ] || (outerCache[ elem.uniqueID ] = {}); + + if ( skip && skip === elem.nodeName.toLowerCase() ) { + elem = elem[ dir ] || elem; + } else if ( (oldCache = uniqueCache[ key ]) && + oldCache[ 0 ] === dirruns && oldCache[ 1 ] === doneName ) { + + // Assign to newCache so results back-propagate to previous elements + return (newCache[ 2 ] = oldCache[ 2 ]); + } else { + // Reuse newcache so results back-propagate to previous elements + uniqueCache[ key ] = newCache; + + // A match means we're done; a fail means we have to keep checking + if ( (newCache[ 2 ] = matcher( elem, context, xml )) ) { + return true; + } + } + } + } + } + }; +} + +function elementMatcher( matchers ) { + return matchers.length > 1 ? + function( elem, context, xml ) { + var i = matchers.length; + while ( i-- ) { + if ( !matchers[i]( elem, context, xml ) ) { + return false; + } + } + return true; + } : + matchers[0]; +} + +function multipleContexts( selector, contexts, results ) { + var i = 0, + len = contexts.length; + for ( ; i < len; i++ ) { + Sizzle( selector, contexts[i], results ); + } + return results; +} + +function condense( unmatched, map, filter, context, xml ) { + var elem, + newUnmatched = [], + i = 0, + len = unmatched.length, + mapped = map != null; + + for ( ; i < len; i++ ) { + if ( (elem = unmatched[i]) ) { + if ( !filter || filter( elem, context, xml ) ) { + newUnmatched.push( elem ); + if ( mapped ) { + map.push( i ); + } + } + } + } + + return newUnmatched; +} + +function setMatcher( preFilter, selector, matcher, postFilter, postFinder, postSelector ) { + if ( postFilter && !postFilter[ expando ] ) { + postFilter = setMatcher( postFilter ); + } + if ( postFinder && !postFinder[ expando ] ) { + postFinder = setMatcher( postFinder, postSelector ); + } + return markFunction(function( seed, results, context, xml ) { + var temp, i, elem, + preMap = [], + postMap = [], + preexisting = results.length, + + // Get initial elements from seed or context + elems = seed || multipleContexts( selector || "*", context.nodeType ? [ context ] : context, [] ), + + // Prefilter to get matcher input, preserving a map for seed-results synchronization + matcherIn = preFilter && ( seed || !selector ) ? + condense( elems, preMap, preFilter, context, xml ) : + elems, + + matcherOut = matcher ? + // If we have a postFinder, or filtered seed, or non-seed postFilter or preexisting results, + postFinder || ( seed ? preFilter : preexisting || postFilter ) ? + + // ...intermediate processing is necessary + [] : + + // ...otherwise use results directly + results : + matcherIn; + + // Find primary matches + if ( matcher ) { + matcher( matcherIn, matcherOut, context, xml ); + } + + // Apply postFilter + if ( postFilter ) { + temp = condense( matcherOut, postMap ); + postFilter( temp, [], context, xml ); + + // Un-match failing elements by moving them back to matcherIn + i = temp.length; + while ( i-- ) { + if ( (elem = temp[i]) ) { + matcherOut[ postMap[i] ] = !(matcherIn[ postMap[i] ] = elem); + } + } + } + + if ( seed ) { + if ( postFinder || preFilter ) { + if ( postFinder ) { + // Get the final matcherOut by condensing this intermediate into postFinder contexts + temp = []; + i = matcherOut.length; + while ( i-- ) { + if ( (elem = matcherOut[i]) ) { + // Restore matcherIn since elem is not yet a final match + temp.push( (matcherIn[i] = elem) ); + } + } + postFinder( null, (matcherOut = []), temp, xml ); + } + + // Move matched elements from seed to results to keep them synchronized + i = matcherOut.length; + while ( i-- ) { + if ( (elem = matcherOut[i]) && + (temp = postFinder ? indexOf( seed, elem ) : preMap[i]) > -1 ) { + + seed[temp] = !(results[temp] = elem); + } + } + } + + // Add elements to results, through postFinder if defined + } else { + matcherOut = condense( + matcherOut === results ? + matcherOut.splice( preexisting, matcherOut.length ) : + matcherOut + ); + if ( postFinder ) { + postFinder( null, results, matcherOut, xml ); + } else { + push.apply( results, matcherOut ); + } + } + }); +} + +function matcherFromTokens( tokens ) { + var checkContext, matcher, j, + len = tokens.length, + leadingRelative = Expr.relative[ tokens[0].type ], + implicitRelative = leadingRelative || Expr.relative[" "], + i = leadingRelative ? 1 : 0, + + // The foundational matcher ensures that elements are reachable from top-level context(s) + matchContext = addCombinator( function( elem ) { + return elem === checkContext; + }, implicitRelative, true ), + matchAnyContext = addCombinator( function( elem ) { + return indexOf( checkContext, elem ) > -1; + }, implicitRelative, true ), + matchers = [ function( elem, context, xml ) { + var ret = ( !leadingRelative && ( xml || context !== outermostContext ) ) || ( + (checkContext = context).nodeType ? + matchContext( elem, context, xml ) : + matchAnyContext( elem, context, xml ) ); + // Avoid hanging onto element (issue #299) + checkContext = null; + return ret; + } ]; + + for ( ; i < len; i++ ) { + if ( (matcher = Expr.relative[ tokens[i].type ]) ) { + matchers = [ addCombinator(elementMatcher( matchers ), matcher) ]; + } else { + matcher = Expr.filter[ tokens[i].type ].apply( null, tokens[i].matches ); + + // Return special upon seeing a positional matcher + if ( matcher[ expando ] ) { + // Find the next relative operator (if any) for proper handling + j = ++i; + for ( ; j < len; j++ ) { + if ( Expr.relative[ tokens[j].type ] ) { + break; + } + } + return setMatcher( + i > 1 && elementMatcher( matchers ), + i > 1 && toSelector( + // If the preceding token was a descendant combinator, insert an implicit any-element `*` + tokens.slice( 0, i - 1 ).concat({ value: tokens[ i - 2 ].type === " " ? "*" : "" }) + ).replace( rtrim, "$1" ), + matcher, + i < j && matcherFromTokens( tokens.slice( i, j ) ), + j < len && matcherFromTokens( (tokens = tokens.slice( j )) ), + j < len && toSelector( tokens ) + ); + } + matchers.push( matcher ); + } + } + + return elementMatcher( matchers ); +} + +function matcherFromGroupMatchers( elementMatchers, setMatchers ) { + var bySet = setMatchers.length > 0, + byElement = elementMatchers.length > 0, + superMatcher = function( seed, context, xml, results, outermost ) { + var elem, j, matcher, + matchedCount = 0, + i = "0", + unmatched = seed && [], + setMatched = [], + contextBackup = outermostContext, + // We must always have either seed elements or outermost context + elems = seed || byElement && Expr.find["TAG"]( "*", outermost ), + // Use integer dirruns iff this is the outermost matcher + dirrunsUnique = (dirruns += contextBackup == null ? 1 : Math.random() || 0.1), + len = elems.length; + + if ( outermost ) { + outermostContext = context === document || context || outermost; + } + + // Add elements passing elementMatchers directly to results + // Support: IE<9, Safari + // Tolerate NodeList properties (IE: "length"; Safari: <number>) matching elements by id + for ( ; i !== len && (elem = elems[i]) != null; i++ ) { + if ( byElement && elem ) { + j = 0; + if ( !context && elem.ownerDocument !== document ) { + setDocument( elem ); + xml = !documentIsHTML; + } + while ( (matcher = elementMatchers[j++]) ) { + if ( matcher( elem, context || document, xml) ) { + results.push( elem ); + break; + } + } + if ( outermost ) { + dirruns = dirrunsUnique; + } + } + + // Track unmatched elements for set filters + if ( bySet ) { + // They will have gone through all possible matchers + if ( (elem = !matcher && elem) ) { + matchedCount--; + } + + // Lengthen the array for every element, matched or not + if ( seed ) { + unmatched.push( elem ); + } + } + } + + // `i` is now the count of elements visited above, and adding it to `matchedCount` + // makes the latter nonnegative. + matchedCount += i; + + // Apply set filters to unmatched elements + // NOTE: This can be skipped if there are no unmatched elements (i.e., `matchedCount` + // equals `i`), unless we didn't visit _any_ elements in the above loop because we have + // no element matchers and no seed. + // Incrementing an initially-string "0" `i` allows `i` to remain a string only in that + // case, which will result in a "00" `matchedCount` that differs from `i` but is also + // numerically zero. + if ( bySet && i !== matchedCount ) { + j = 0; + while ( (matcher = setMatchers[j++]) ) { + matcher( unmatched, setMatched, context, xml ); + } + + if ( seed ) { + // Reintegrate element matches to eliminate the need for sorting + if ( matchedCount > 0 ) { + while ( i-- ) { + if ( !(unmatched[i] || setMatched[i]) ) { + setMatched[i] = pop.call( results ); + } + } + } + + // Discard index placeholder values to get only actual matches + setMatched = condense( setMatched ); + } + + // Add matches to results + push.apply( results, setMatched ); + + // Seedless set matches succeeding multiple successful matchers stipulate sorting + if ( outermost && !seed && setMatched.length > 0 && + ( matchedCount + setMatchers.length ) > 1 ) { + + Sizzle.uniqueSort( results ); + } + } + + // Override manipulation of globals by nested matchers + if ( outermost ) { + dirruns = dirrunsUnique; + outermostContext = contextBackup; + } + + return unmatched; + }; + + return bySet ? + markFunction( superMatcher ) : + superMatcher; +} + +compile = Sizzle.compile = function( selector, match /* Internal Use Only */ ) { + var i, + setMatchers = [], + elementMatchers = [], + cached = compilerCache[ selector + " " ]; + + if ( !cached ) { + // Generate a function of recursive functions that can be used to check each element + if ( !match ) { + match = tokenize( selector ); + } + i = match.length; + while ( i-- ) { + cached = matcherFromTokens( match[i] ); + if ( cached[ expando ] ) { + setMatchers.push( cached ); + } else { + elementMatchers.push( cached ); + } + } + + // Cache the compiled function + cached = compilerCache( selector, matcherFromGroupMatchers( elementMatchers, setMatchers ) ); + + // Save selector and tokenization + cached.selector = selector; + } + return cached; +}; + +/** + * A low-level selection function that works with Sizzle's compiled + * selector functions + * @param {String|Function} selector A selector or a pre-compiled + * selector function built with Sizzle.compile + * @param {Element} context + * @param {Array} [results] + * @param {Array} [seed] A set of elements to match against + */ +select = Sizzle.select = function( selector, context, results, seed ) { + var i, tokens, token, type, find, + compiled = typeof selector === "function" && selector, + match = !seed && tokenize( (selector = compiled.selector || selector) ); + + results = results || []; + + // Try to minimize operations if there is only one selector in the list and no seed + // (the latter of which guarantees us context) + if ( match.length === 1 ) { + + // Reduce context if the leading compound selector is an ID + tokens = match[0] = match[0].slice( 0 ); + if ( tokens.length > 2 && (token = tokens[0]).type === "ID" && + support.getById && context.nodeType === 9 && documentIsHTML && + Expr.relative[ tokens[1].type ] ) { + + context = ( Expr.find["ID"]( token.matches[0].replace(runescape, funescape), context ) || [] )[0]; + if ( !context ) { + return results; + + // Precompiled matchers will still verify ancestry, so step up a level + } else if ( compiled ) { + context = context.parentNode; + } + + selector = selector.slice( tokens.shift().value.length ); + } + + // Fetch a seed set for right-to-left matching + i = matchExpr["needsContext"].test( selector ) ? 0 : tokens.length; + while ( i-- ) { + token = tokens[i]; + + // Abort if we hit a combinator + if ( Expr.relative[ (type = token.type) ] ) { + break; + } + if ( (find = Expr.find[ type ]) ) { + // Search, expanding context for leading sibling combinators + if ( (seed = find( + token.matches[0].replace( runescape, funescape ), + rsibling.test( tokens[0].type ) && testContext( context.parentNode ) || context + )) ) { + + // If seed is empty or no tokens remain, we can return early + tokens.splice( i, 1 ); + selector = seed.length && toSelector( tokens ); + if ( !selector ) { + push.apply( results, seed ); + return results; + } + + break; + } + } + } + } + + // Compile and execute a filtering function if one is not provided + // Provide `match` to avoid retokenization if we modified the selector above + ( compiled || compile( selector, match ) )( + seed, + context, + !documentIsHTML, + results, + !context || rsibling.test( selector ) && testContext( context.parentNode ) || context + ); + return results; +}; + +// One-time assignments + +// Sort stability +support.sortStable = expando.split("").sort( sortOrder ).join("") === expando; + +// Support: Chrome 14-35+ +// Always assume duplicates if they aren't passed to the comparison function +support.detectDuplicates = !!hasDuplicate; + +// Initialize against the default document +setDocument(); + +// Support: Webkit<537.32 - Safari 6.0.3/Chrome 25 (fixed in Chrome 27) +// Detached nodes confoundingly follow *each other* +support.sortDetached = assert(function( el ) { + // Should return 1, but returns 4 (following) + return el.compareDocumentPosition( document.createElement("fieldset") ) & 1; +}); + +// Support: IE<8 +// Prevent attribute/property "interpolation" +// https://msdn.microsoft.com/en-us/library/ms536429%28VS.85%29.aspx +if ( !assert(function( el ) { + el.innerHTML = "<a href='#'></a>"; + return el.firstChild.getAttribute("href") === "#" ; +}) ) { + addHandle( "type|href|height|width", function( elem, name, isXML ) { + if ( !isXML ) { + return elem.getAttribute( name, name.toLowerCase() === "type" ? 1 : 2 ); + } + }); +} + +// Support: IE<9 +// Use defaultValue in place of getAttribute("value") +if ( !support.attributes || !assert(function( el ) { + el.innerHTML = "<input/>"; + el.firstChild.setAttribute( "value", "" ); + return el.firstChild.getAttribute( "value" ) === ""; +}) ) { + addHandle( "value", function( elem, name, isXML ) { + if ( !isXML && elem.nodeName.toLowerCase() === "input" ) { + return elem.defaultValue; + } + }); +} + +// Support: IE<9 +// Use getAttributeNode to fetch booleans when getAttribute lies +if ( !assert(function( el ) { + return el.getAttribute("disabled") == null; +}) ) { + addHandle( booleans, function( elem, name, isXML ) { + var val; + if ( !isXML ) { + return elem[ name ] === true ? name.toLowerCase() : + (val = elem.getAttributeNode( name )) && val.specified ? + val.value : + null; + } + }); +} + +return Sizzle; + +})( window ); + + + +jQuery.find = Sizzle; +jQuery.expr = Sizzle.selectors; + +// Deprecated +jQuery.expr[ ":" ] = jQuery.expr.pseudos; +jQuery.uniqueSort = jQuery.unique = Sizzle.uniqueSort; +jQuery.text = Sizzle.getText; +jQuery.isXMLDoc = Sizzle.isXML; +jQuery.contains = Sizzle.contains; +jQuery.escapeSelector = Sizzle.escape; + + + + +var dir = function( elem, dir, until ) { + var matched = [], + truncate = until !== undefined; + + while ( ( elem = elem[ dir ] ) && elem.nodeType !== 9 ) { + if ( elem.nodeType === 1 ) { + if ( truncate && jQuery( elem ).is( until ) ) { + break; + } + matched.push( elem ); + } + } + return matched; +}; + + +var siblings = function( n, elem ) { + var matched = []; + + for ( ; n; n = n.nextSibling ) { + if ( n.nodeType === 1 && n !== elem ) { + matched.push( n ); + } + } + + return matched; +}; + + +var rneedsContext = jQuery.expr.match.needsContext; + +var rsingleTag = ( /^<([a-z][^\/\0>:\x20\t\r\n\f]*)[\x20\t\r\n\f]*\/?>(?:<\/\1>|)$/i ); + + + +var risSimple = /^.[^:#\[\.,]*$/; + +// Implement the identical functionality for filter and not +function winnow( elements, qualifier, not ) { + if ( jQuery.isFunction( qualifier ) ) { + return jQuery.grep( elements, function( elem, i ) { + return !!qualifier.call( elem, i, elem ) !== not; + } ); + + } + + if ( qualifier.nodeType ) { + return jQuery.grep( elements, function( elem ) { + return ( elem === qualifier ) !== not; + } ); + + } + + if ( typeof qualifier === "string" ) { + if ( risSimple.test( qualifier ) ) { + return jQuery.filter( qualifier, elements, not ); + } + + qualifier = jQuery.filter( qualifier, elements ); + } + + return jQuery.grep( elements, function( elem ) { + return ( indexOf.call( qualifier, elem ) > -1 ) !== not && elem.nodeType === 1; + } ); +} + +jQuery.filter = function( expr, elems, not ) { + var elem = elems[ 0 ]; + + if ( not ) { + expr = ":not(" + expr + ")"; + } + + return elems.length === 1 && elem.nodeType === 1 ? + jQuery.find.matchesSelector( elem, expr ) ? [ elem ] : [] : + jQuery.find.matches( expr, jQuery.grep( elems, function( elem ) { + return elem.nodeType === 1; + } ) ); +}; + +jQuery.fn.extend( { + find: function( selector ) { + var i, ret, + len = this.length, + self = this; + + if ( typeof selector !== "string" ) { + return this.pushStack( jQuery( selector ).filter( function() { + for ( i = 0; i < len; i++ ) { + if ( jQuery.contains( self[ i ], this ) ) { + return true; + } + } + } ) ); + } + + ret = this.pushStack( [] ); + + for ( i = 0; i < len; i++ ) { + jQuery.find( selector, self[ i ], ret ); + } + + return len > 1 ? jQuery.uniqueSort( ret ) : ret; + }, + filter: function( selector ) { + return this.pushStack( winnow( this, selector || [], false ) ); + }, + not: function( selector ) { + return this.pushStack( winnow( this, selector || [], true ) ); + }, + is: function( selector ) { + return !!winnow( + this, + + // If this is a positional/relative selector, check membership in the returned set + // so $("p:first").is("p:last") won't return true for a doc with two "p". + typeof selector === "string" && rneedsContext.test( selector ) ? + jQuery( selector ) : + selector || [], + false + ).length; + } +} ); + + +// Initialize a jQuery object + + +// A central reference to the root jQuery(document) +var rootjQuery, + + // A simple way to check for HTML strings + // Prioritize #id over <tag> to avoid XSS via location.hash (#9521) + // Strict HTML recognition (#11290: must start with <) + // Shortcut simple #id case for speed + rquickExpr = /^(?:\s*(<[\w\W]+>)[^>]*|#([\w-]+))$/, + + init = jQuery.fn.init = function( selector, context, root ) { + var match, elem; + + // HANDLE: $(""), $(null), $(undefined), $(false) + if ( !selector ) { + return this; + } + + // Method init() accepts an alternate rootjQuery + // so migrate can support jQuery.sub (gh-2101) + root = root || rootjQuery; + + // Handle HTML strings + if ( typeof selector === "string" ) { + if ( selector[ 0 ] === "<" && + selector[ selector.length - 1 ] === ">" && + selector.length >= 3 ) { + + // Assume that strings that start and end with <> are HTML and skip the regex check + match = [ null, selector, null ]; + + } else { + match = rquickExpr.exec( selector ); + } + + // Match html or make sure no context is specified for #id + if ( match && ( match[ 1 ] || !context ) ) { + + // HANDLE: $(html) -> $(array) + if ( match[ 1 ] ) { + context = context instanceof jQuery ? context[ 0 ] : context; + + // Option to run scripts is true for back-compat + // Intentionally let the error be thrown if parseHTML is not present + jQuery.merge( this, jQuery.parseHTML( + match[ 1 ], + context && context.nodeType ? context.ownerDocument || context : document, + true + ) ); + + // HANDLE: $(html, props) + if ( rsingleTag.test( match[ 1 ] ) && jQuery.isPlainObject( context ) ) { + for ( match in context ) { + + // Properties of context are called as methods if possible + if ( jQuery.isFunction( this[ match ] ) ) { + this[ match ]( context[ match ] ); + + // ...and otherwise set as attributes + } else { + this.attr( match, context[ match ] ); + } + } + } + + return this; + + // HANDLE: $(#id) + } else { + elem = document.getElementById( match[ 2 ] ); + + if ( elem ) { + + // Inject the element directly into the jQuery object + this[ 0 ] = elem; + this.length = 1; + } + return this; + } + + // HANDLE: $(expr, $(...)) + } else if ( !context || context.jquery ) { + return ( context || root ).find( selector ); + + // HANDLE: $(expr, context) + // (which is just equivalent to: $(context).find(expr) + } else { + return this.constructor( context ).find( selector ); + } + + // HANDLE: $(DOMElement) + } else if ( selector.nodeType ) { + this[ 0 ] = selector; + this.length = 1; + return this; + + // HANDLE: $(function) + // Shortcut for document ready + } else if ( jQuery.isFunction( selector ) ) { + return root.ready !== undefined ? + root.ready( selector ) : + + // Execute immediately if ready is not present + selector( jQuery ); + } + + return jQuery.makeArray( selector, this ); + }; + +// Give the init function the jQuery prototype for later instantiation +init.prototype = jQuery.fn; + +// Initialize central reference +rootjQuery = jQuery( document ); + + +var rparentsprev = /^(?:parents|prev(?:Until|All))/, + + // Methods guaranteed to produce a unique set when starting from a unique set + guaranteedUnique = { + children: true, + contents: true, + next: true, + prev: true + }; + +jQuery.fn.extend( { + has: function( target ) { + var targets = jQuery( target, this ), + l = targets.length; + + return this.filter( function() { + var i = 0; + for ( ; i < l; i++ ) { + if ( jQuery.contains( this, targets[ i ] ) ) { + return true; + } + } + } ); + }, + + closest: function( selectors, context ) { + var cur, + i = 0, + l = this.length, + matched = [], + targets = typeof selectors !== "string" && jQuery( selectors ); + + // Positional selectors never match, since there's no _selection_ context + if ( !rneedsContext.test( selectors ) ) { + for ( ; i < l; i++ ) { + for ( cur = this[ i ]; cur && cur !== context; cur = cur.parentNode ) { + + // Always skip document fragments + if ( cur.nodeType < 11 && ( targets ? + targets.index( cur ) > -1 : + + // Don't pass non-elements to Sizzle + cur.nodeType === 1 && + jQuery.find.matchesSelector( cur, selectors ) ) ) { + + matched.push( cur ); + break; + } + } + } + } + + return this.pushStack( matched.length > 1 ? jQuery.uniqueSort( matched ) : matched ); + }, + + // Determine the position of an element within the set + index: function( elem ) { + + // No argument, return index in parent + if ( !elem ) { + return ( this[ 0 ] && this[ 0 ].parentNode ) ? this.first().prevAll().length : -1; + } + + // Index in selector + if ( typeof elem === "string" ) { + return indexOf.call( jQuery( elem ), this[ 0 ] ); + } + + // Locate the position of the desired element + return indexOf.call( this, + + // If it receives a jQuery object, the first element is used + elem.jquery ? elem[ 0 ] : elem + ); + }, + + add: function( selector, context ) { + return this.pushStack( + jQuery.uniqueSort( + jQuery.merge( this.get(), jQuery( selector, context ) ) + ) + ); + }, + + addBack: function( selector ) { + return this.add( selector == null ? + this.prevObject : this.prevObject.filter( selector ) + ); + } +} ); + +function sibling( cur, dir ) { + while ( ( cur = cur[ dir ] ) && cur.nodeType !== 1 ) {} + return cur; +} + +jQuery.each( { + parent: function( elem ) { + var parent = elem.parentNode; + return parent && parent.nodeType !== 11 ? parent : null; + }, + parents: function( elem ) { + return dir( elem, "parentNode" ); + }, + parentsUntil: function( elem, i, until ) { + return dir( elem, "parentNode", until ); + }, + next: function( elem ) { + return sibling( elem, "nextSibling" ); + }, + prev: function( elem ) { + return sibling( elem, "previousSibling" ); + }, + nextAll: function( elem ) { + return dir( elem, "nextSibling" ); + }, + prevAll: function( elem ) { + return dir( elem, "previousSibling" ); + }, + nextUntil: function( elem, i, until ) { + return dir( elem, "nextSibling", until ); + }, + prevUntil: function( elem, i, until ) { + return dir( elem, "previousSibling", until ); + }, + siblings: function( elem ) { + return siblings( ( elem.parentNode || {} ).firstChild, elem ); + }, + children: function( elem ) { + return siblings( elem.firstChild ); + }, + contents: function( elem ) { + return elem.contentDocument || jQuery.merge( [], elem.childNodes ); + } +}, function( name, fn ) { + jQuery.fn[ name ] = function( until, selector ) { + var matched = jQuery.map( this, fn, until ); + + if ( name.slice( -5 ) !== "Until" ) { + selector = until; + } + + if ( selector && typeof selector === "string" ) { + matched = jQuery.filter( selector, matched ); + } + + if ( this.length > 1 ) { + + // Remove duplicates + if ( !guaranteedUnique[ name ] ) { + jQuery.uniqueSort( matched ); + } + + // Reverse order for parents* and prev-derivatives + if ( rparentsprev.test( name ) ) { + matched.reverse(); + } + } + + return this.pushStack( matched ); + }; +} ); +var rnotwhite = ( /\S+/g ); + + + +// Convert String-formatted options into Object-formatted ones +function createOptions( options ) { + var object = {}; + jQuery.each( options.match( rnotwhite ) || [], function( _, flag ) { + object[ flag ] = true; + } ); + return object; +} + +/* + * Create a callback list using the following parameters: + * + * options: an optional list of space-separated options that will change how + * the callback list behaves or a more traditional option object + * + * By default a callback list will act like an event callback list and can be + * "fired" multiple times. + * + * Possible options: + * + * once: will ensure the callback list can only be fired once (like a Deferred) + * + * memory: will keep track of previous values and will call any callback added + * after the list has been fired right away with the latest "memorized" + * values (like a Deferred) + * + * unique: will ensure a callback can only be added once (no duplicate in the list) + * + * stopOnFalse: interrupt callings when a callback returns false + * + */ +jQuery.Callbacks = function( options ) { + + // Convert options from String-formatted to Object-formatted if needed + // (we check in cache first) + options = typeof options === "string" ? + createOptions( options ) : + jQuery.extend( {}, options ); + + var // Flag to know if list is currently firing + firing, + + // Last fire value for non-forgettable lists + memory, + + // Flag to know if list was already fired + fired, + + // Flag to prevent firing + locked, + + // Actual callback list + list = [], + + // Queue of execution data for repeatable lists + queue = [], + + // Index of currently firing callback (modified by add/remove as needed) + firingIndex = -1, + + // Fire callbacks + fire = function() { + + // Enforce single-firing + locked = options.once; + + // Execute callbacks for all pending executions, + // respecting firingIndex overrides and runtime changes + fired = firing = true; + for ( ; queue.length; firingIndex = -1 ) { + memory = queue.shift(); + while ( ++firingIndex < list.length ) { + + // Run callback and check for early termination + if ( list[ firingIndex ].apply( memory[ 0 ], memory[ 1 ] ) === false && + options.stopOnFalse ) { + + // Jump to end and forget the data so .add doesn't re-fire + firingIndex = list.length; + memory = false; + } + } + } + + // Forget the data if we're done with it + if ( !options.memory ) { + memory = false; + } + + firing = false; + + // Clean up if we're done firing for good + if ( locked ) { + + // Keep an empty list if we have data for future add calls + if ( memory ) { + list = []; + + // Otherwise, this object is spent + } else { + list = ""; + } + } + }, + + // Actual Callbacks object + self = { + + // Add a callback or a collection of callbacks to the list + add: function() { + if ( list ) { + + // If we have memory from a past run, we should fire after adding + if ( memory && !firing ) { + firingIndex = list.length - 1; + queue.push( memory ); + } + + ( function add( args ) { + jQuery.each( args, function( _, arg ) { + if ( jQuery.isFunction( arg ) ) { + if ( !options.unique || !self.has( arg ) ) { + list.push( arg ); + } + } else if ( arg && arg.length && jQuery.type( arg ) !== "string" ) { + + // Inspect recursively + add( arg ); + } + } ); + } )( arguments ); + + if ( memory && !firing ) { + fire(); + } + } + return this; + }, + + // Remove a callback from the list + remove: function() { + jQuery.each( arguments, function( _, arg ) { + var index; + while ( ( index = jQuery.inArray( arg, list, index ) ) > -1 ) { + list.splice( index, 1 ); + + // Handle firing indexes + if ( index <= firingIndex ) { + firingIndex--; + } + } + } ); + return this; + }, + + // Check if a given callback is in the list. + // If no argument is given, return whether or not list has callbacks attached. + has: function( fn ) { + return fn ? + jQuery.inArray( fn, list ) > -1 : + list.length > 0; + }, + + // Remove all callbacks from the list + empty: function() { + if ( list ) { + list = []; + } + return this; + }, + + // Disable .fire and .add + // Abort any current/pending executions + // Clear all callbacks and values + disable: function() { + locked = queue = []; + list = memory = ""; + return this; + }, + disabled: function() { + return !list; + }, + + // Disable .fire + // Also disable .add unless we have memory (since it would have no effect) + // Abort any pending executions + lock: function() { + locked = queue = []; + if ( !memory && !firing ) { + list = memory = ""; + } + return this; + }, + locked: function() { + return !!locked; + }, + + // Call all callbacks with the given context and arguments + fireWith: function( context, args ) { + if ( !locked ) { + args = args || []; + args = [ context, args.slice ? args.slice() : args ]; + queue.push( args ); + if ( !firing ) { + fire(); + } + } + return this; + }, + + // Call all the callbacks with the given arguments + fire: function() { + self.fireWith( this, arguments ); + return this; + }, + + // To know if the callbacks have already been called at least once + fired: function() { + return !!fired; + } + }; + + return self; +}; + + +function Identity( v ) { + return v; +} +function Thrower( ex ) { + throw ex; +} + +function adoptValue( value, resolve, reject ) { + var method; + + try { + + // Check for promise aspect first to privilege synchronous behavior + if ( value && jQuery.isFunction( ( method = value.promise ) ) ) { + method.call( value ).done( resolve ).fail( reject ); + + // Other thenables + } else if ( value && jQuery.isFunction( ( method = value.then ) ) ) { + method.call( value, resolve, reject ); + + // Other non-thenables + } else { + + // Support: Android 4.0 only + // Strict mode functions invoked without .call/.apply get global-object context + resolve.call( undefined, value ); + } + + // For Promises/A+, convert exceptions into rejections + // Since jQuery.when doesn't unwrap thenables, we can skip the extra checks appearing in + // Deferred#then to conditionally suppress rejection. + } catch ( value ) { + + // Support: Android 4.0 only + // Strict mode functions invoked without .call/.apply get global-object context + reject.call( undefined, value ); + } +} + +jQuery.extend( { + + Deferred: function( func ) { + var tuples = [ + + // action, add listener, callbacks, + // ... .then handlers, argument index, [final state] + [ "notify", "progress", jQuery.Callbacks( "memory" ), + jQuery.Callbacks( "memory" ), 2 ], + [ "resolve", "done", jQuery.Callbacks( "once memory" ), + jQuery.Callbacks( "once memory" ), 0, "resolved" ], + [ "reject", "fail", jQuery.Callbacks( "once memory" ), + jQuery.Callbacks( "once memory" ), 1, "rejected" ] + ], + state = "pending", + promise = { + state: function() { + return state; + }, + always: function() { + deferred.done( arguments ).fail( arguments ); + return this; + }, + "catch": function( fn ) { + return promise.then( null, fn ); + }, + + // Keep pipe for back-compat + pipe: function( /* fnDone, fnFail, fnProgress */ ) { + var fns = arguments; + + return jQuery.Deferred( function( newDefer ) { + jQuery.each( tuples, function( i, tuple ) { + + // Map tuples (progress, done, fail) to arguments (done, fail, progress) + var fn = jQuery.isFunction( fns[ tuple[ 4 ] ] ) && fns[ tuple[ 4 ] ]; + + // deferred.progress(function() { bind to newDefer or newDefer.notify }) + // deferred.done(function() { bind to newDefer or newDefer.resolve }) + // deferred.fail(function() { bind to newDefer or newDefer.reject }) + deferred[ tuple[ 1 ] ]( function() { + var returned = fn && fn.apply( this, arguments ); + if ( returned && jQuery.isFunction( returned.promise ) ) { + returned.promise() + .progress( newDefer.notify ) + .done( newDefer.resolve ) + .fail( newDefer.reject ); + } else { + newDefer[ tuple[ 0 ] + "With" ]( + this, + fn ? [ returned ] : arguments + ); + } + } ); + } ); + fns = null; + } ).promise(); + }, + then: function( onFulfilled, onRejected, onProgress ) { + var maxDepth = 0; + function resolve( depth, deferred, handler, special ) { + return function() { + var that = this, + args = arguments, + mightThrow = function() { + var returned, then; + + // Support: Promises/A+ section 2.3.3.3.3 + // https://promisesaplus.com/#point-59 + // Ignore double-resolution attempts + if ( depth < maxDepth ) { + return; + } + + returned = handler.apply( that, args ); + + // Support: Promises/A+ section 2.3.1 + // https://promisesaplus.com/#point-48 + if ( returned === deferred.promise() ) { + throw new TypeError( "Thenable self-resolution" ); + } + + // Support: Promises/A+ sections 2.3.3.1, 3.5 + // https://promisesaplus.com/#point-54 + // https://promisesaplus.com/#point-75 + // Retrieve `then` only once + then = returned && + + // Support: Promises/A+ section 2.3.4 + // https://promisesaplus.com/#point-64 + // Only check objects and functions for thenability + ( typeof returned === "object" || + typeof returned === "function" ) && + returned.then; + + // Handle a returned thenable + if ( jQuery.isFunction( then ) ) { + + // Special processors (notify) just wait for resolution + if ( special ) { + then.call( + returned, + resolve( maxDepth, deferred, Identity, special ), + resolve( maxDepth, deferred, Thrower, special ) + ); + + // Normal processors (resolve) also hook into progress + } else { + + // ...and disregard older resolution values + maxDepth++; + + then.call( + returned, + resolve( maxDepth, deferred, Identity, special ), + resolve( maxDepth, deferred, Thrower, special ), + resolve( maxDepth, deferred, Identity, + deferred.notifyWith ) + ); + } + + // Handle all other returned values + } else { + + // Only substitute handlers pass on context + // and multiple values (non-spec behavior) + if ( handler !== Identity ) { + that = undefined; + args = [ returned ]; + } + + // Process the value(s) + // Default process is resolve + ( special || deferred.resolveWith )( that, args ); + } + }, + + // Only normal processors (resolve) catch and reject exceptions + process = special ? + mightThrow : + function() { + try { + mightThrow(); + } catch ( e ) { + + if ( jQuery.Deferred.exceptionHook ) { + jQuery.Deferred.exceptionHook( e, + process.stackTrace ); + } + + // Support: Promises/A+ section 2.3.3.3.4.1 + // https://promisesaplus.com/#point-61 + // Ignore post-resolution exceptions + if ( depth + 1 >= maxDepth ) { + + // Only substitute handlers pass on context + // and multiple values (non-spec behavior) + if ( handler !== Thrower ) { + that = undefined; + args = [ e ]; + } + + deferred.rejectWith( that, args ); + } + } + }; + + // Support: Promises/A+ section 2.3.3.3.1 + // https://promisesaplus.com/#point-57 + // Re-resolve promises immediately to dodge false rejection from + // subsequent errors + if ( depth ) { + process(); + } else { + + // Call an optional hook to record the stack, in case of exception + // since it's otherwise lost when execution goes async + if ( jQuery.Deferred.getStackHook ) { + process.stackTrace = jQuery.Deferred.getStackHook(); + } + window.setTimeout( process ); + } + }; + } + + return jQuery.Deferred( function( newDefer ) { + + // progress_handlers.add( ... ) + tuples[ 0 ][ 3 ].add( + resolve( + 0, + newDefer, + jQuery.isFunction( onProgress ) ? + onProgress : + Identity, + newDefer.notifyWith + ) + ); + + // fulfilled_handlers.add( ... ) + tuples[ 1 ][ 3 ].add( + resolve( + 0, + newDefer, + jQuery.isFunction( onFulfilled ) ? + onFulfilled : + Identity + ) + ); + + // rejected_handlers.add( ... ) + tuples[ 2 ][ 3 ].add( + resolve( + 0, + newDefer, + jQuery.isFunction( onRejected ) ? + onRejected : + Thrower + ) + ); + } ).promise(); + }, + + // Get a promise for this deferred + // If obj is provided, the promise aspect is added to the object + promise: function( obj ) { + return obj != null ? jQuery.extend( obj, promise ) : promise; + } + }, + deferred = {}; + + // Add list-specific methods + jQuery.each( tuples, function( i, tuple ) { + var list = tuple[ 2 ], + stateString = tuple[ 5 ]; + + // promise.progress = list.add + // promise.done = list.add + // promise.fail = list.add + promise[ tuple[ 1 ] ] = list.add; + + // Handle state + if ( stateString ) { + list.add( + function() { + + // state = "resolved" (i.e., fulfilled) + // state = "rejected" + state = stateString; + }, + + // rejected_callbacks.disable + // fulfilled_callbacks.disable + tuples[ 3 - i ][ 2 ].disable, + + // progress_callbacks.lock + tuples[ 0 ][ 2 ].lock + ); + } + + // progress_handlers.fire + // fulfilled_handlers.fire + // rejected_handlers.fire + list.add( tuple[ 3 ].fire ); + + // deferred.notify = function() { deferred.notifyWith(...) } + // deferred.resolve = function() { deferred.resolveWith(...) } + // deferred.reject = function() { deferred.rejectWith(...) } + deferred[ tuple[ 0 ] ] = function() { + deferred[ tuple[ 0 ] + "With" ]( this === deferred ? undefined : this, arguments ); + return this; + }; + + // deferred.notifyWith = list.fireWith + // deferred.resolveWith = list.fireWith + // deferred.rejectWith = list.fireWith + deferred[ tuple[ 0 ] + "With" ] = list.fireWith; + } ); + + // Make the deferred a promise + promise.promise( deferred ); + + // Call given func if any + if ( func ) { + func.call( deferred, deferred ); + } + + // All done! + return deferred; + }, + + // Deferred helper + when: function( singleValue ) { + var + + // count of uncompleted subordinates + remaining = arguments.length, + + // count of unprocessed arguments + i = remaining, + + // subordinate fulfillment data + resolveContexts = Array( i ), + resolveValues = slice.call( arguments ), + + // the master Deferred + master = jQuery.Deferred(), + + // subordinate callback factory + updateFunc = function( i ) { + return function( value ) { + resolveContexts[ i ] = this; + resolveValues[ i ] = arguments.length > 1 ? slice.call( arguments ) : value; + if ( !( --remaining ) ) { + master.resolveWith( resolveContexts, resolveValues ); + } + }; + }; + + // Single- and empty arguments are adopted like Promise.resolve + if ( remaining <= 1 ) { + adoptValue( singleValue, master.done( updateFunc( i ) ).resolve, master.reject ); + + // Use .then() to unwrap secondary thenables (cf. gh-3000) + if ( master.state() === "pending" || + jQuery.isFunction( resolveValues[ i ] && resolveValues[ i ].then ) ) { + + return master.then(); + } + } + + // Multiple arguments are aggregated like Promise.all array elements + while ( i-- ) { + adoptValue( resolveValues[ i ], updateFunc( i ), master.reject ); + } + + return master.promise(); + } +} ); + + +// These usually indicate a programmer mistake during development, +// warn about them ASAP rather than swallowing them by default. +var rerrorNames = /^(Eval|Internal|Range|Reference|Syntax|Type|URI)Error$/; + +jQuery.Deferred.exceptionHook = function( error, stack ) { + + // Support: IE 8 - 9 only + // Console exists when dev tools are open, which can happen at any time + if ( window.console && window.console.warn && error && rerrorNames.test( error.name ) ) { + window.console.warn( "jQuery.Deferred exception: " + error.message, error.stack, stack ); + } +}; + + + + +jQuery.readyException = function( error ) { + window.setTimeout( function() { + throw error; + } ); +}; + + + + +// The deferred used on DOM ready +var readyList = jQuery.Deferred(); + +jQuery.fn.ready = function( fn ) { + + readyList + .then( fn ) + + // Wrap jQuery.readyException in a function so that the lookup + // happens at the time of error handling instead of callback + // registration. + .catch( function( error ) { + jQuery.readyException( error ); + } ); + + return this; +}; + +jQuery.extend( { + + // Is the DOM ready to be used? Set to true once it occurs. + isReady: false, + + // A counter to track how many items to wait for before + // the ready event fires. See #6781 + readyWait: 1, + + // Hold (or release) the ready event + holdReady: function( hold ) { + if ( hold ) { + jQuery.readyWait++; + } else { + jQuery.ready( true ); + } + }, + + // Handle when the DOM is ready + ready: function( wait ) { + + // Abort if there are pending holds or we're already ready + if ( wait === true ? --jQuery.readyWait : jQuery.isReady ) { + return; + } + + // Remember that the DOM is ready + jQuery.isReady = true; + + // If a normal DOM Ready event fired, decrement, and wait if need be + if ( wait !== true && --jQuery.readyWait > 0 ) { + return; + } + + // If there are functions bound, to execute + readyList.resolveWith( document, [ jQuery ] ); + } +} ); + +jQuery.ready.then = readyList.then; + +// The ready event handler and self cleanup method +function completed() { + document.removeEventListener( "DOMContentLoaded", completed ); + window.removeEventListener( "load", completed ); + jQuery.ready(); +} + +// Catch cases where $(document).ready() is called +// after the browser event has already occurred. +// Support: IE <=9 - 10 only +// Older IE sometimes signals "interactive" too soon +if ( document.readyState === "complete" || + ( document.readyState !== "loading" && !document.documentElement.doScroll ) ) { + + // Handle it asynchronously to allow scripts the opportunity to delay ready + window.setTimeout( jQuery.ready ); + +} else { + + // Use the handy event callback + document.addEventListener( "DOMContentLoaded", completed ); + + // A fallback to window.onload, that will always work + window.addEventListener( "load", completed ); +} + + + + +// Multifunctional method to get and set values of a collection +// The value/s can optionally be executed if it's a function +var access = function( elems, fn, key, value, chainable, emptyGet, raw ) { + var i = 0, + len = elems.length, + bulk = key == null; + + // Sets many values + if ( jQuery.type( key ) === "object" ) { + chainable = true; + for ( i in key ) { + access( elems, fn, i, key[ i ], true, emptyGet, raw ); + } + + // Sets one value + } else if ( value !== undefined ) { + chainable = true; + + if ( !jQuery.isFunction( value ) ) { + raw = true; + } + + if ( bulk ) { + + // Bulk operations run against the entire set + if ( raw ) { + fn.call( elems, value ); + fn = null; + + // ...except when executing function values + } else { + bulk = fn; + fn = function( elem, key, value ) { + return bulk.call( jQuery( elem ), value ); + }; + } + } + + if ( fn ) { + for ( ; i < len; i++ ) { + fn( + elems[ i ], key, raw ? + value : + value.call( elems[ i ], i, fn( elems[ i ], key ) ) + ); + } + } + } + + return chainable ? + elems : + + // Gets + bulk ? + fn.call( elems ) : + len ? fn( elems[ 0 ], key ) : emptyGet; +}; +var acceptData = function( owner ) { + + // Accepts only: + // - Node + // - Node.ELEMENT_NODE + // - Node.DOCUMENT_NODE + // - Object + // - Any + return owner.nodeType === 1 || owner.nodeType === 9 || !( +owner.nodeType ); +}; + + + + +function Data() { + this.expando = jQuery.expando + Data.uid++; +} + +Data.uid = 1; + +Data.prototype = { + + cache: function( owner ) { + + // Check if the owner object already has a cache + var value = owner[ this.expando ]; + + // If not, create one + if ( !value ) { + value = {}; + + // We can accept data for non-element nodes in modern browsers, + // but we should not, see #8335. + // Always return an empty object. + if ( acceptData( owner ) ) { + + // If it is a node unlikely to be stringify-ed or looped over + // use plain assignment + if ( owner.nodeType ) { + owner[ this.expando ] = value; + + // Otherwise secure it in a non-enumerable property + // configurable must be true to allow the property to be + // deleted when data is removed + } else { + Object.defineProperty( owner, this.expando, { + value: value, + configurable: true + } ); + } + } + } + + return value; + }, + set: function( owner, data, value ) { + var prop, + cache = this.cache( owner ); + + // Handle: [ owner, key, value ] args + // Always use camelCase key (gh-2257) + if ( typeof data === "string" ) { + cache[ jQuery.camelCase( data ) ] = value; + + // Handle: [ owner, { properties } ] args + } else { + + // Copy the properties one-by-one to the cache object + for ( prop in data ) { + cache[ jQuery.camelCase( prop ) ] = data[ prop ]; + } + } + return cache; + }, + get: function( owner, key ) { + return key === undefined ? + this.cache( owner ) : + + // Always use camelCase key (gh-2257) + owner[ this.expando ] && owner[ this.expando ][ jQuery.camelCase( key ) ]; + }, + access: function( owner, key, value ) { + + // In cases where either: + // + // 1. No key was specified + // 2. A string key was specified, but no value provided + // + // Take the "read" path and allow the get method to determine + // which value to return, respectively either: + // + // 1. The entire cache object + // 2. The data stored at the key + // + if ( key === undefined || + ( ( key && typeof key === "string" ) && value === undefined ) ) { + + return this.get( owner, key ); + } + + // When the key is not a string, or both a key and value + // are specified, set or extend (existing objects) with either: + // + // 1. An object of properties + // 2. A key and value + // + this.set( owner, key, value ); + + // Since the "set" path can have two possible entry points + // return the expected data based on which path was taken[*] + return value !== undefined ? value : key; + }, + remove: function( owner, key ) { + var i, + cache = owner[ this.expando ]; + + if ( cache === undefined ) { + return; + } + + if ( key !== undefined ) { + + // Support array or space separated string of keys + if ( jQuery.isArray( key ) ) { + + // If key is an array of keys... + // We always set camelCase keys, so remove that. + key = key.map( jQuery.camelCase ); + } else { + key = jQuery.camelCase( key ); + + // If a key with the spaces exists, use it. + // Otherwise, create an array by matching non-whitespace + key = key in cache ? + [ key ] : + ( key.match( rnotwhite ) || [] ); + } + + i = key.length; + + while ( i-- ) { + delete cache[ key[ i ] ]; + } + } + + // Remove the expando if there's no more data + if ( key === undefined || jQuery.isEmptyObject( cache ) ) { + + // Support: Chrome <=35 - 45 + // Webkit & Blink performance suffers when deleting properties + // from DOM nodes, so set to undefined instead + // https://bugs.chromium.org/p/chromium/issues/detail?id=378607 (bug restricted) + if ( owner.nodeType ) { + owner[ this.expando ] = undefined; + } else { + delete owner[ this.expando ]; + } + } + }, + hasData: function( owner ) { + var cache = owner[ this.expando ]; + return cache !== undefined && !jQuery.isEmptyObject( cache ); + } +}; +var dataPriv = new Data(); + +var dataUser = new Data(); + + + +// Implementation Summary +// +// 1. Enforce API surface and semantic compatibility with 1.9.x branch +// 2. Improve the module's maintainability by reducing the storage +// paths to a single mechanism. +// 3. Use the same single mechanism to support "private" and "user" data. +// 4. _Never_ expose "private" data to user code (TODO: Drop _data, _removeData) +// 5. Avoid exposing implementation details on user objects (eg. expando properties) +// 6. Provide a clear path for implementation upgrade to WeakMap in 2014 + +var rbrace = /^(?:\{[\w\W]*\}|\[[\w\W]*\])$/, + rmultiDash = /[A-Z]/g; + +function dataAttr( elem, key, data ) { + var name; + + // If nothing was found internally, try to fetch any + // data from the HTML5 data-* attribute + if ( data === undefined && elem.nodeType === 1 ) { + name = "data-" + key.replace( rmultiDash, "-$&" ).toLowerCase(); + data = elem.getAttribute( name ); + + if ( typeof data === "string" ) { + try { + data = data === "true" ? true : + data === "false" ? false : + data === "null" ? null : + + // Only convert to a number if it doesn't change the string + +data + "" === data ? +data : + rbrace.test( data ) ? JSON.parse( data ) : + data; + } catch ( e ) {} + + // Make sure we set the data so it isn't changed later + dataUser.set( elem, key, data ); + } else { + data = undefined; + } + } + return data; +} + +jQuery.extend( { + hasData: function( elem ) { + return dataUser.hasData( elem ) || dataPriv.hasData( elem ); + }, + + data: function( elem, name, data ) { + return dataUser.access( elem, name, data ); + }, + + removeData: function( elem, name ) { + dataUser.remove( elem, name ); + }, + + // TODO: Now that all calls to _data and _removeData have been replaced + // with direct calls to dataPriv methods, these can be deprecated. + _data: function( elem, name, data ) { + return dataPriv.access( elem, name, data ); + }, + + _removeData: function( elem, name ) { + dataPriv.remove( elem, name ); + } +} ); + +jQuery.fn.extend( { + data: function( key, value ) { + var i, name, data, + elem = this[ 0 ], + attrs = elem && elem.attributes; + + // Gets all values + if ( key === undefined ) { + if ( this.length ) { + data = dataUser.get( elem ); + + if ( elem.nodeType === 1 && !dataPriv.get( elem, "hasDataAttrs" ) ) { + i = attrs.length; + while ( i-- ) { + + // Support: IE 11 only + // The attrs elements can be null (#14894) + if ( attrs[ i ] ) { + name = attrs[ i ].name; + if ( name.indexOf( "data-" ) === 0 ) { + name = jQuery.camelCase( name.slice( 5 ) ); + dataAttr( elem, name, data[ name ] ); + } + } + } + dataPriv.set( elem, "hasDataAttrs", true ); + } + } + + return data; + } + + // Sets multiple values + if ( typeof key === "object" ) { + return this.each( function() { + dataUser.set( this, key ); + } ); + } + + return access( this, function( value ) { + var data; + + // The calling jQuery object (element matches) is not empty + // (and therefore has an element appears at this[ 0 ]) and the + // `value` parameter was not undefined. An empty jQuery object + // will result in `undefined` for elem = this[ 0 ] which will + // throw an exception if an attempt to read a data cache is made. + if ( elem && value === undefined ) { + + // Attempt to get data from the cache + // The key will always be camelCased in Data + data = dataUser.get( elem, key ); + if ( data !== undefined ) { + return data; + } + + // Attempt to "discover" the data in + // HTML5 custom data-* attrs + data = dataAttr( elem, key ); + if ( data !== undefined ) { + return data; + } + + // We tried really hard, but the data doesn't exist. + return; + } + + // Set the data... + this.each( function() { + + // We always store the camelCased key + dataUser.set( this, key, value ); + } ); + }, null, value, arguments.length > 1, null, true ); + }, + + removeData: function( key ) { + return this.each( function() { + dataUser.remove( this, key ); + } ); + } +} ); + + +jQuery.extend( { + queue: function( elem, type, data ) { + var queue; + + if ( elem ) { + type = ( type || "fx" ) + "queue"; + queue = dataPriv.get( elem, type ); + + // Speed up dequeue by getting out quickly if this is just a lookup + if ( data ) { + if ( !queue || jQuery.isArray( data ) ) { + queue = dataPriv.access( elem, type, jQuery.makeArray( data ) ); + } else { + queue.push( data ); + } + } + return queue || []; + } + }, + + dequeue: function( elem, type ) { + type = type || "fx"; + + var queue = jQuery.queue( elem, type ), + startLength = queue.length, + fn = queue.shift(), + hooks = jQuery._queueHooks( elem, type ), + next = function() { + jQuery.dequeue( elem, type ); + }; + + // If the fx queue is dequeued, always remove the progress sentinel + if ( fn === "inprogress" ) { + fn = queue.shift(); + startLength--; + } + + if ( fn ) { + + // Add a progress sentinel to prevent the fx queue from being + // automatically dequeued + if ( type === "fx" ) { + queue.unshift( "inprogress" ); + } + + // Clear up the last queue stop function + delete hooks.stop; + fn.call( elem, next, hooks ); + } + + if ( !startLength && hooks ) { + hooks.empty.fire(); + } + }, + + // Not public - generate a queueHooks object, or return the current one + _queueHooks: function( elem, type ) { + var key = type + "queueHooks"; + return dataPriv.get( elem, key ) || dataPriv.access( elem, key, { + empty: jQuery.Callbacks( "once memory" ).add( function() { + dataPriv.remove( elem, [ type + "queue", key ] ); + } ) + } ); + } +} ); + +jQuery.fn.extend( { + queue: function( type, data ) { + var setter = 2; + + if ( typeof type !== "string" ) { + data = type; + type = "fx"; + setter--; + } + + if ( arguments.length < setter ) { + return jQuery.queue( this[ 0 ], type ); + } + + return data === undefined ? + this : + this.each( function() { + var queue = jQuery.queue( this, type, data ); + + // Ensure a hooks for this queue + jQuery._queueHooks( this, type ); + + if ( type === "fx" && queue[ 0 ] !== "inprogress" ) { + jQuery.dequeue( this, type ); + } + } ); + }, + dequeue: function( type ) { + return this.each( function() { + jQuery.dequeue( this, type ); + } ); + }, + clearQueue: function( type ) { + return this.queue( type || "fx", [] ); + }, + + // Get a promise resolved when queues of a certain type + // are emptied (fx is the type by default) + promise: function( type, obj ) { + var tmp, + count = 1, + defer = jQuery.Deferred(), + elements = this, + i = this.length, + resolve = function() { + if ( !( --count ) ) { + defer.resolveWith( elements, [ elements ] ); + } + }; + + if ( typeof type !== "string" ) { + obj = type; + type = undefined; + } + type = type || "fx"; + + while ( i-- ) { + tmp = dataPriv.get( elements[ i ], type + "queueHooks" ); + if ( tmp && tmp.empty ) { + count++; + tmp.empty.add( resolve ); + } + } + resolve(); + return defer.promise( obj ); + } +} ); +var pnum = ( /[+-]?(?:\d*\.|)\d+(?:[eE][+-]?\d+|)/ ).source; + +var rcssNum = new RegExp( "^(?:([+-])=|)(" + pnum + ")([a-z%]*)$", "i" ); + + +var cssExpand = [ "Top", "Right", "Bottom", "Left" ]; + +var isHiddenWithinTree = function( elem, el ) { + + // isHiddenWithinTree might be called from jQuery#filter function; + // in that case, element will be second argument + elem = el || elem; + + // Inline style trumps all + return elem.style.display === "none" || + elem.style.display === "" && + + // Otherwise, check computed style + // Support: Firefox <=43 - 45 + // Disconnected elements can have computed display: none, so first confirm that elem is + // in the document. + jQuery.contains( elem.ownerDocument, elem ) && + + jQuery.css( elem, "display" ) === "none"; + }; + +var swap = function( elem, options, callback, args ) { + var ret, name, + old = {}; + + // Remember the old values, and insert the new ones + for ( name in options ) { + old[ name ] = elem.style[ name ]; + elem.style[ name ] = options[ name ]; + } + + ret = callback.apply( elem, args || [] ); + + // Revert the old values + for ( name in options ) { + elem.style[ name ] = old[ name ]; + } + + return ret; +}; + + + + +function adjustCSS( elem, prop, valueParts, tween ) { + var adjusted, + scale = 1, + maxIterations = 20, + currentValue = tween ? + function() { + return tween.cur(); + } : + function() { + return jQuery.css( elem, prop, "" ); + }, + initial = currentValue(), + unit = valueParts && valueParts[ 3 ] || ( jQuery.cssNumber[ prop ] ? "" : "px" ), + + // Starting value computation is required for potential unit mismatches + initialInUnit = ( jQuery.cssNumber[ prop ] || unit !== "px" && +initial ) && + rcssNum.exec( jQuery.css( elem, prop ) ); + + if ( initialInUnit && initialInUnit[ 3 ] !== unit ) { + + // Trust units reported by jQuery.css + unit = unit || initialInUnit[ 3 ]; + + // Make sure we update the tween properties later on + valueParts = valueParts || []; + + // Iteratively approximate from a nonzero starting point + initialInUnit = +initial || 1; + + do { + + // If previous iteration zeroed out, double until we get *something*. + // Use string for doubling so we don't accidentally see scale as unchanged below + scale = scale || ".5"; + + // Adjust and apply + initialInUnit = initialInUnit / scale; + jQuery.style( elem, prop, initialInUnit + unit ); + + // Update scale, tolerating zero or NaN from tween.cur() + // Break the loop if scale is unchanged or perfect, or if we've just had enough. + } while ( + scale !== ( scale = currentValue() / initial ) && scale !== 1 && --maxIterations + ); + } + + if ( valueParts ) { + initialInUnit = +initialInUnit || +initial || 0; + + // Apply relative offset (+=/-=) if specified + adjusted = valueParts[ 1 ] ? + initialInUnit + ( valueParts[ 1 ] + 1 ) * valueParts[ 2 ] : + +valueParts[ 2 ]; + if ( tween ) { + tween.unit = unit; + tween.start = initialInUnit; + tween.end = adjusted; + } + } + return adjusted; +} + + +var defaultDisplayMap = {}; + +function getDefaultDisplay( elem ) { + var temp, + doc = elem.ownerDocument, + nodeName = elem.nodeName, + display = defaultDisplayMap[ nodeName ]; + + if ( display ) { + return display; + } + + temp = doc.body.appendChild( doc.createElement( nodeName ) ), + display = jQuery.css( temp, "display" ); + + temp.parentNode.removeChild( temp ); + + if ( display === "none" ) { + display = "block"; + } + defaultDisplayMap[ nodeName ] = display; + + return display; +} + +function showHide( elements, show ) { + var display, elem, + values = [], + index = 0, + length = elements.length; + + // Determine new display value for elements that need to change + for ( ; index < length; index++ ) { + elem = elements[ index ]; + if ( !elem.style ) { + continue; + } + + display = elem.style.display; + if ( show ) { + + // Since we force visibility upon cascade-hidden elements, an immediate (and slow) + // check is required in this first loop unless we have a nonempty display value (either + // inline or about-to-be-restored) + if ( display === "none" ) { + values[ index ] = dataPriv.get( elem, "display" ) || null; + if ( !values[ index ] ) { + elem.style.display = ""; + } + } + if ( elem.style.display === "" && isHiddenWithinTree( elem ) ) { + values[ index ] = getDefaultDisplay( elem ); + } + } else { + if ( display !== "none" ) { + values[ index ] = "none"; + + // Remember what we're overwriting + dataPriv.set( elem, "display", display ); + } + } + } + + // Set the display of the elements in a second loop to avoid constant reflow + for ( index = 0; index < length; index++ ) { + if ( values[ index ] != null ) { + elements[ index ].style.display = values[ index ]; + } + } + + return elements; +} + +jQuery.fn.extend( { + show: function() { + return showHide( this, true ); + }, + hide: function() { + return showHide( this ); + }, + toggle: function( state ) { + if ( typeof state === "boolean" ) { + return state ? this.show() : this.hide(); + } + + return this.each( function() { + if ( isHiddenWithinTree( this ) ) { + jQuery( this ).show(); + } else { + jQuery( this ).hide(); + } + } ); + } +} ); +var rcheckableType = ( /^(?:checkbox|radio)$/i ); + +var rtagName = ( /<([a-z][^\/\0>\x20\t\r\n\f]+)/i ); + +var rscriptType = ( /^$|\/(?:java|ecma)script/i ); + + + +// We have to close these tags to support XHTML (#13200) +var wrapMap = { + + // Support: IE <=9 only + option: [ 1, "<select multiple='multiple'>", "</select>" ], + + // XHTML parsers do not magically insert elements in the + // same way that tag soup parsers do. So we cannot shorten + // this by omitting <tbody> or other required elements. + thead: [ 1, "<table>", "</table>" ], + col: [ 2, "<table><colgroup>", "</colgroup></table>" ], + tr: [ 2, "<table><tbody>", "</tbody></table>" ], + td: [ 3, "<table><tbody><tr>", "</tr></tbody></table>" ], + + _default: [ 0, "", "" ] +}; + +// Support: IE <=9 only +wrapMap.optgroup = wrapMap.option; + +wrapMap.tbody = wrapMap.tfoot = wrapMap.colgroup = wrapMap.caption = wrapMap.thead; +wrapMap.th = wrapMap.td; + + +function getAll( context, tag ) { + + // Support: IE <=9 - 11 only + // Use typeof to avoid zero-argument method invocation on host objects (#15151) + var ret = typeof context.getElementsByTagName !== "undefined" ? + context.getElementsByTagName( tag || "*" ) : + typeof context.querySelectorAll !== "undefined" ? + context.querySelectorAll( tag || "*" ) : + []; + + return tag === undefined || tag && jQuery.nodeName( context, tag ) ? + jQuery.merge( [ context ], ret ) : + ret; +} + + +// Mark scripts as having already been evaluated +function setGlobalEval( elems, refElements ) { + var i = 0, + l = elems.length; + + for ( ; i < l; i++ ) { + dataPriv.set( + elems[ i ], + "globalEval", + !refElements || dataPriv.get( refElements[ i ], "globalEval" ) + ); + } +} + + +var rhtml = /<|&#?\w+;/; + +function buildFragment( elems, context, scripts, selection, ignored ) { + var elem, tmp, tag, wrap, contains, j, + fragment = context.createDocumentFragment(), + nodes = [], + i = 0, + l = elems.length; + + for ( ; i < l; i++ ) { + elem = elems[ i ]; + + if ( elem || elem === 0 ) { + + // Add nodes directly + if ( jQuery.type( elem ) === "object" ) { + + // Support: Android <=4.0 only, PhantomJS 1 only + // push.apply(_, arraylike) throws on ancient WebKit + jQuery.merge( nodes, elem.nodeType ? [ elem ] : elem ); + + // Convert non-html into a text node + } else if ( !rhtml.test( elem ) ) { + nodes.push( context.createTextNode( elem ) ); + + // Convert html into DOM nodes + } else { + tmp = tmp || fragment.appendChild( context.createElement( "div" ) ); + + // Deserialize a standard representation + tag = ( rtagName.exec( elem ) || [ "", "" ] )[ 1 ].toLowerCase(); + wrap = wrapMap[ tag ] || wrapMap._default; + tmp.innerHTML = wrap[ 1 ] + jQuery.htmlPrefilter( elem ) + wrap[ 2 ]; + + // Descend through wrappers to the right content + j = wrap[ 0 ]; + while ( j-- ) { + tmp = tmp.lastChild; + } + + // Support: Android <=4.0 only, PhantomJS 1 only + // push.apply(_, arraylike) throws on ancient WebKit + jQuery.merge( nodes, tmp.childNodes ); + + // Remember the top-level container + tmp = fragment.firstChild; + + // Ensure the created nodes are orphaned (#12392) + tmp.textContent = ""; + } + } + } + + // Remove wrapper from fragment + fragment.textContent = ""; + + i = 0; + while ( ( elem = nodes[ i++ ] ) ) { + + // Skip elements already in the context collection (trac-4087) + if ( selection && jQuery.inArray( elem, selection ) > -1 ) { + if ( ignored ) { + ignored.push( elem ); + } + continue; + } + + contains = jQuery.contains( elem.ownerDocument, elem ); + + // Append to fragment + tmp = getAll( fragment.appendChild( elem ), "script" ); + + // Preserve script evaluation history + if ( contains ) { + setGlobalEval( tmp ); + } + + // Capture executables + if ( scripts ) { + j = 0; + while ( ( elem = tmp[ j++ ] ) ) { + if ( rscriptType.test( elem.type || "" ) ) { + scripts.push( elem ); + } + } + } + } + + return fragment; +} + + +( function() { + var fragment = document.createDocumentFragment(), + div = fragment.appendChild( document.createElement( "div" ) ), + input = document.createElement( "input" ); + + // Support: Android 4.0 - 4.3 only + // Check state lost if the name is set (#11217) + // Support: Windows Web Apps (WWA) + // `name` and `type` must use .setAttribute for WWA (#14901) + input.setAttribute( "type", "radio" ); + input.setAttribute( "checked", "checked" ); + input.setAttribute( "name", "t" ); + + div.appendChild( input ); + + // Support: Android <=4.1 only + // Older WebKit doesn't clone checked state correctly in fragments + support.checkClone = div.cloneNode( true ).cloneNode( true ).lastChild.checked; + + // Support: IE <=11 only + // Make sure textarea (and checkbox) defaultValue is properly cloned + div.innerHTML = "<textarea>x</textarea>"; + support.noCloneChecked = !!div.cloneNode( true ).lastChild.defaultValue; +} )(); +var documentElement = document.documentElement; + + + +var + rkeyEvent = /^key/, + rmouseEvent = /^(?:mouse|pointer|contextmenu|drag|drop)|click/, + rtypenamespace = /^([^.]*)(?:\.(.+)|)/; + +function returnTrue() { + return true; +} + +function returnFalse() { + return false; +} + +// Support: IE <=9 only +// See #13393 for more info +function safeActiveElement() { + try { + return document.activeElement; + } catch ( err ) { } +} + +function on( elem, types, selector, data, fn, one ) { + var origFn, type; + + // Types can be a map of types/handlers + if ( typeof types === "object" ) { + + // ( types-Object, selector, data ) + if ( typeof selector !== "string" ) { + + // ( types-Object, data ) + data = data || selector; + selector = undefined; + } + for ( type in types ) { + on( elem, type, selector, data, types[ type ], one ); + } + return elem; + } + + if ( data == null && fn == null ) { + + // ( types, fn ) + fn = selector; + data = selector = undefined; + } else if ( fn == null ) { + if ( typeof selector === "string" ) { + + // ( types, selector, fn ) + fn = data; + data = undefined; + } else { + + // ( types, data, fn ) + fn = data; + data = selector; + selector = undefined; + } + } + if ( fn === false ) { + fn = returnFalse; + } else if ( !fn ) { + return elem; + } + + if ( one === 1 ) { + origFn = fn; + fn = function( event ) { + + // Can use an empty set, since event contains the info + jQuery().off( event ); + return origFn.apply( this, arguments ); + }; + + // Use same guid so caller can remove using origFn + fn.guid = origFn.guid || ( origFn.guid = jQuery.guid++ ); + } + return elem.each( function() { + jQuery.event.add( this, types, fn, data, selector ); + } ); +} + +/* + * Helper functions for managing events -- not part of the public interface. + * Props to Dean Edwards' addEvent library for many of the ideas. + */ +jQuery.event = { + + global: {}, + + add: function( elem, types, handler, data, selector ) { + + var handleObjIn, eventHandle, tmp, + events, t, handleObj, + special, handlers, type, namespaces, origType, + elemData = dataPriv.get( elem ); + + // Don't attach events to noData or text/comment nodes (but allow plain objects) + if ( !elemData ) { + return; + } + + // Caller can pass in an object of custom data in lieu of the handler + if ( handler.handler ) { + handleObjIn = handler; + handler = handleObjIn.handler; + selector = handleObjIn.selector; + } + + // Ensure that invalid selectors throw exceptions at attach time + // Evaluate against documentElement in case elem is a non-element node (e.g., document) + if ( selector ) { + jQuery.find.matchesSelector( documentElement, selector ); + } + + // Make sure that the handler has a unique ID, used to find/remove it later + if ( !handler.guid ) { + handler.guid = jQuery.guid++; + } + + // Init the element's event structure and main handler, if this is the first + if ( !( events = elemData.events ) ) { + events = elemData.events = {}; + } + if ( !( eventHandle = elemData.handle ) ) { + eventHandle = elemData.handle = function( e ) { + + // Discard the second event of a jQuery.event.trigger() and + // when an event is called after a page has unloaded + return typeof jQuery !== "undefined" && jQuery.event.triggered !== e.type ? + jQuery.event.dispatch.apply( elem, arguments ) : undefined; + }; + } + + // Handle multiple events separated by a space + types = ( types || "" ).match( rnotwhite ) || [ "" ]; + t = types.length; + while ( t-- ) { + tmp = rtypenamespace.exec( types[ t ] ) || []; + type = origType = tmp[ 1 ]; + namespaces = ( tmp[ 2 ] || "" ).split( "." ).sort(); + + // There *must* be a type, no attaching namespace-only handlers + if ( !type ) { + continue; + } + + // If event changes its type, use the special event handlers for the changed type + special = jQuery.event.special[ type ] || {}; + + // If selector defined, determine special event api type, otherwise given type + type = ( selector ? special.delegateType : special.bindType ) || type; + + // Update special based on newly reset type + special = jQuery.event.special[ type ] || {}; + + // handleObj is passed to all event handlers + handleObj = jQuery.extend( { + type: type, + origType: origType, + data: data, + handler: handler, + guid: handler.guid, + selector: selector, + needsContext: selector && jQuery.expr.match.needsContext.test( selector ), + namespace: namespaces.join( "." ) + }, handleObjIn ); + + // Init the event handler queue if we're the first + if ( !( handlers = events[ type ] ) ) { + handlers = events[ type ] = []; + handlers.delegateCount = 0; + + // Only use addEventListener if the special events handler returns false + if ( !special.setup || + special.setup.call( elem, data, namespaces, eventHandle ) === false ) { + + if ( elem.addEventListener ) { + elem.addEventListener( type, eventHandle ); + } + } + } + + if ( special.add ) { + special.add.call( elem, handleObj ); + + if ( !handleObj.handler.guid ) { + handleObj.handler.guid = handler.guid; + } + } + + // Add to the element's handler list, delegates in front + if ( selector ) { + handlers.splice( handlers.delegateCount++, 0, handleObj ); + } else { + handlers.push( handleObj ); + } + + // Keep track of which events have ever been used, for event optimization + jQuery.event.global[ type ] = true; + } + + }, + + // Detach an event or set of events from an element + remove: function( elem, types, handler, selector, mappedTypes ) { + + var j, origCount, tmp, + events, t, handleObj, + special, handlers, type, namespaces, origType, + elemData = dataPriv.hasData( elem ) && dataPriv.get( elem ); + + if ( !elemData || !( events = elemData.events ) ) { + return; + } + + // Once for each type.namespace in types; type may be omitted + types = ( types || "" ).match( rnotwhite ) || [ "" ]; + t = types.length; + while ( t-- ) { + tmp = rtypenamespace.exec( types[ t ] ) || []; + type = origType = tmp[ 1 ]; + namespaces = ( tmp[ 2 ] || "" ).split( "." ).sort(); + + // Unbind all events (on this namespace, if provided) for the element + if ( !type ) { + for ( type in events ) { + jQuery.event.remove( elem, type + types[ t ], handler, selector, true ); + } + continue; + } + + special = jQuery.event.special[ type ] || {}; + type = ( selector ? special.delegateType : special.bindType ) || type; + handlers = events[ type ] || []; + tmp = tmp[ 2 ] && + new RegExp( "(^|\\.)" + namespaces.join( "\\.(?:.*\\.|)" ) + "(\\.|$)" ); + + // Remove matching events + origCount = j = handlers.length; + while ( j-- ) { + handleObj = handlers[ j ]; + + if ( ( mappedTypes || origType === handleObj.origType ) && + ( !handler || handler.guid === handleObj.guid ) && + ( !tmp || tmp.test( handleObj.namespace ) ) && + ( !selector || selector === handleObj.selector || + selector === "**" && handleObj.selector ) ) { + handlers.splice( j, 1 ); + + if ( handleObj.selector ) { + handlers.delegateCount--; + } + if ( special.remove ) { + special.remove.call( elem, handleObj ); + } + } + } + + // Remove generic event handler if we removed something and no more handlers exist + // (avoids potential for endless recursion during removal of special event handlers) + if ( origCount && !handlers.length ) { + if ( !special.teardown || + special.teardown.call( elem, namespaces, elemData.handle ) === false ) { + + jQuery.removeEvent( elem, type, elemData.handle ); + } + + delete events[ type ]; + } + } + + // Remove data and the expando if it's no longer used + if ( jQuery.isEmptyObject( events ) ) { + dataPriv.remove( elem, "handle events" ); + } + }, + + dispatch: function( nativeEvent ) { + + // Make a writable jQuery.Event from the native event object + var event = jQuery.event.fix( nativeEvent ); + + var i, j, ret, matched, handleObj, handlerQueue, + args = new Array( arguments.length ), + handlers = ( dataPriv.get( this, "events" ) || {} )[ event.type ] || [], + special = jQuery.event.special[ event.type ] || {}; + + // Use the fix-ed jQuery.Event rather than the (read-only) native event + args[ 0 ] = event; + + for ( i = 1; i < arguments.length; i++ ) { + args[ i ] = arguments[ i ]; + } + + event.delegateTarget = this; + + // Call the preDispatch hook for the mapped type, and let it bail if desired + if ( special.preDispatch && special.preDispatch.call( this, event ) === false ) { + return; + } + + // Determine handlers + handlerQueue = jQuery.event.handlers.call( this, event, handlers ); + + // Run delegates first; they may want to stop propagation beneath us + i = 0; + while ( ( matched = handlerQueue[ i++ ] ) && !event.isPropagationStopped() ) { + event.currentTarget = matched.elem; + + j = 0; + while ( ( handleObj = matched.handlers[ j++ ] ) && + !event.isImmediatePropagationStopped() ) { + + // Triggered event must either 1) have no namespace, or 2) have namespace(s) + // a subset or equal to those in the bound event (both can have no namespace). + if ( !event.rnamespace || event.rnamespace.test( handleObj.namespace ) ) { + + event.handleObj = handleObj; + event.data = handleObj.data; + + ret = ( ( jQuery.event.special[ handleObj.origType ] || {} ).handle || + handleObj.handler ).apply( matched.elem, args ); + + if ( ret !== undefined ) { + if ( ( event.result = ret ) === false ) { + event.preventDefault(); + event.stopPropagation(); + } + } + } + } + } + + // Call the postDispatch hook for the mapped type + if ( special.postDispatch ) { + special.postDispatch.call( this, event ); + } + + return event.result; + }, + + handlers: function( event, handlers ) { + var i, matches, sel, handleObj, + handlerQueue = [], + delegateCount = handlers.delegateCount, + cur = event.target; + + // Support: IE <=9 + // Find delegate handlers + // Black-hole SVG <use> instance trees (#13180) + // + // Support: Firefox <=42 + // Avoid non-left-click in FF but don't block IE radio events (#3861, gh-2343) + if ( delegateCount && cur.nodeType && + ( event.type !== "click" || isNaN( event.button ) || event.button < 1 ) ) { + + for ( ; cur !== this; cur = cur.parentNode || this ) { + + // Don't check non-elements (#13208) + // Don't process clicks on disabled elements (#6911, #8165, #11382, #11764) + if ( cur.nodeType === 1 && ( cur.disabled !== true || event.type !== "click" ) ) { + matches = []; + for ( i = 0; i < delegateCount; i++ ) { + handleObj = handlers[ i ]; + + // Don't conflict with Object.prototype properties (#13203) + sel = handleObj.selector + " "; + + if ( matches[ sel ] === undefined ) { + matches[ sel ] = handleObj.needsContext ? + jQuery( sel, this ).index( cur ) > -1 : + jQuery.find( sel, this, null, [ cur ] ).length; + } + if ( matches[ sel ] ) { + matches.push( handleObj ); + } + } + if ( matches.length ) { + handlerQueue.push( { elem: cur, handlers: matches } ); + } + } + } + } + + // Add the remaining (directly-bound) handlers + if ( delegateCount < handlers.length ) { + handlerQueue.push( { elem: this, handlers: handlers.slice( delegateCount ) } ); + } + + return handlerQueue; + }, + + addProp: function( name, hook ) { + Object.defineProperty( jQuery.Event.prototype, name, { + enumerable: true, + configurable: true, + + get: jQuery.isFunction( hook ) ? + function() { + if ( this.originalEvent ) { + return hook( this.originalEvent ); + } + } : + function() { + if ( this.originalEvent ) { + return this.originalEvent[ name ]; + } + }, + + set: function( value ) { + Object.defineProperty( this, name, { + enumerable: true, + configurable: true, + writable: true, + value: value + } ); + } + } ); + }, + + fix: function( originalEvent ) { + return originalEvent[ jQuery.expando ] ? + originalEvent : + new jQuery.Event( originalEvent ); + }, + + special: { + load: { + + // Prevent triggered image.load events from bubbling to window.load + noBubble: true + }, + focus: { + + // Fire native event if possible so blur/focus sequence is correct + trigger: function() { + if ( this !== safeActiveElement() && this.focus ) { + this.focus(); + return false; + } + }, + delegateType: "focusin" + }, + blur: { + trigger: function() { + if ( this === safeActiveElement() && this.blur ) { + this.blur(); + return false; + } + }, + delegateType: "focusout" + }, + click: { + + // For checkbox, fire native event so checked state will be right + trigger: function() { + if ( this.type === "checkbox" && this.click && jQuery.nodeName( this, "input" ) ) { + this.click(); + return false; + } + }, + + // For cross-browser consistency, don't fire native .click() on links + _default: function( event ) { + return jQuery.nodeName( event.target, "a" ); + } + }, + + beforeunload: { + postDispatch: function( event ) { + + // Support: Firefox 20+ + // Firefox doesn't alert if the returnValue field is not set. + if ( event.result !== undefined && event.originalEvent ) { + event.originalEvent.returnValue = event.result; + } + } + } + } +}; + +jQuery.removeEvent = function( elem, type, handle ) { + + // This "if" is needed for plain objects + if ( elem.removeEventListener ) { + elem.removeEventListener( type, handle ); + } +}; + +jQuery.Event = function( src, props ) { + + // Allow instantiation without the 'new' keyword + if ( !( this instanceof jQuery.Event ) ) { + return new jQuery.Event( src, props ); + } + + // Event object + if ( src && src.type ) { + this.originalEvent = src; + this.type = src.type; + + // Events bubbling up the document may have been marked as prevented + // by a handler lower down the tree; reflect the correct value. + this.isDefaultPrevented = src.defaultPrevented || + src.defaultPrevented === undefined && + + // Support: Android <=2.3 only + src.returnValue === false ? + returnTrue : + returnFalse; + + // Create target properties + // Support: Safari <=6 - 7 only + // Target should not be a text node (#504, #13143) + this.target = ( src.target && src.target.nodeType === 3 ) ? + src.target.parentNode : + src.target; + + this.currentTarget = src.currentTarget; + this.relatedTarget = src.relatedTarget; + + // Event type + } else { + this.type = src; + } + + // Put explicitly provided properties onto the event object + if ( props ) { + jQuery.extend( this, props ); + } + + // Create a timestamp if incoming event doesn't have one + this.timeStamp = src && src.timeStamp || jQuery.now(); + + // Mark it as fixed + this[ jQuery.expando ] = true; +}; + +// jQuery.Event is based on DOM3 Events as specified by the ECMAScript Language Binding +// https://www.w3.org/TR/2003/WD-DOM-Level-3-Events-20030331/ecma-script-binding.html +jQuery.Event.prototype = { + constructor: jQuery.Event, + isDefaultPrevented: returnFalse, + isPropagationStopped: returnFalse, + isImmediatePropagationStopped: returnFalse, + isSimulated: false, + + preventDefault: function() { + var e = this.originalEvent; + + this.isDefaultPrevented = returnTrue; + + if ( e && !this.isSimulated ) { + e.preventDefault(); + } + }, + stopPropagation: function() { + var e = this.originalEvent; + + this.isPropagationStopped = returnTrue; + + if ( e && !this.isSimulated ) { + e.stopPropagation(); + } + }, + stopImmediatePropagation: function() { + var e = this.originalEvent; + + this.isImmediatePropagationStopped = returnTrue; + + if ( e && !this.isSimulated ) { + e.stopImmediatePropagation(); + } + + this.stopPropagation(); + } +}; + +// Includes all common event props including KeyEvent and MouseEvent specific props +jQuery.each( { + altKey: true, + bubbles: true, + cancelable: true, + changedTouches: true, + ctrlKey: true, + detail: true, + eventPhase: true, + metaKey: true, + pageX: true, + pageY: true, + shiftKey: true, + view: true, + "char": true, + charCode: true, + key: true, + keyCode: true, + button: true, + buttons: true, + clientX: true, + clientY: true, + offsetX: true, + offsetY: true, + pointerId: true, + pointerType: true, + screenX: true, + screenY: true, + targetTouches: true, + toElement: true, + touches: true, + + which: function( event ) { + var button = event.button; + + // Add which for key events + if ( event.which == null && rkeyEvent.test( event.type ) ) { + return event.charCode != null ? event.charCode : event.keyCode; + } + + // Add which for click: 1 === left; 2 === middle; 3 === right + if ( !event.which && button !== undefined && rmouseEvent.test( event.type ) ) { + return ( button & 1 ? 1 : ( button & 2 ? 3 : ( button & 4 ? 2 : 0 ) ) ); + } + + return event.which; + } +}, jQuery.event.addProp ); + +// Create mouseenter/leave events using mouseover/out and event-time checks +// so that event delegation works in jQuery. +// Do the same for pointerenter/pointerleave and pointerover/pointerout +// +// Support: Safari 7 only +// Safari sends mouseenter too often; see: +// https://bugs.chromium.org/p/chromium/issues/detail?id=470258 +// for the description of the bug (it existed in older Chrome versions as well). +jQuery.each( { + mouseenter: "mouseover", + mouseleave: "mouseout", + pointerenter: "pointerover", + pointerleave: "pointerout" +}, function( orig, fix ) { + jQuery.event.special[ orig ] = { + delegateType: fix, + bindType: fix, + + handle: function( event ) { + var ret, + target = this, + related = event.relatedTarget, + handleObj = event.handleObj; + + // For mouseenter/leave call the handler if related is outside the target. + // NB: No relatedTarget if the mouse left/entered the browser window + if ( !related || ( related !== target && !jQuery.contains( target, related ) ) ) { + event.type = handleObj.origType; + ret = handleObj.handler.apply( this, arguments ); + event.type = fix; + } + return ret; + } + }; +} ); + +jQuery.fn.extend( { + + on: function( types, selector, data, fn ) { + return on( this, types, selector, data, fn ); + }, + one: function( types, selector, data, fn ) { + return on( this, types, selector, data, fn, 1 ); + }, + off: function( types, selector, fn ) { + var handleObj, type; + if ( types && types.preventDefault && types.handleObj ) { + + // ( event ) dispatched jQuery.Event + handleObj = types.handleObj; + jQuery( types.delegateTarget ).off( + handleObj.namespace ? + handleObj.origType + "." + handleObj.namespace : + handleObj.origType, + handleObj.selector, + handleObj.handler + ); + return this; + } + if ( typeof types === "object" ) { + + // ( types-object [, selector] ) + for ( type in types ) { + this.off( type, selector, types[ type ] ); + } + return this; + } + if ( selector === false || typeof selector === "function" ) { + + // ( types [, fn] ) + fn = selector; + selector = undefined; + } + if ( fn === false ) { + fn = returnFalse; + } + return this.each( function() { + jQuery.event.remove( this, types, fn, selector ); + } ); + } +} ); + + +var + + /* eslint-disable max-len */ + + // See https://github.com/eslint/eslint/issues/3229 + rxhtmlTag = /<(?!area|br|col|embed|hr|img|input|link|meta|param)(([a-z][^\/\0>\x20\t\r\n\f]*)[^>]*)\/>/gi, + + /* eslint-enable */ + + // Support: IE <=10 - 11, Edge 12 - 13 + // In IE/Edge using regex groups here causes severe slowdowns. + // See https://connect.microsoft.com/IE/feedback/details/1736512/ + rnoInnerhtml = /<script|<style|<link/i, + + // checked="checked" or checked + rchecked = /checked\s*(?:[^=]|=\s*.checked.)/i, + rscriptTypeMasked = /^true\/(.*)/, + rcleanScript = /^\s*<!(?:\[CDATA\[|--)|(?:\]\]|--)>\s*$/g; + +function manipulationTarget( elem, content ) { + if ( jQuery.nodeName( elem, "table" ) && + jQuery.nodeName( content.nodeType !== 11 ? content : content.firstChild, "tr" ) ) { + + return elem.getElementsByTagName( "tbody" )[ 0 ] || elem; + } + + return elem; +} + +// Replace/restore the type attribute of script elements for safe DOM manipulation +function disableScript( elem ) { + elem.type = ( elem.getAttribute( "type" ) !== null ) + "/" + elem.type; + return elem; +} +function restoreScript( elem ) { + var match = rscriptTypeMasked.exec( elem.type ); + + if ( match ) { + elem.type = match[ 1 ]; + } else { + elem.removeAttribute( "type" ); + } + + return elem; +} + +function cloneCopyEvent( src, dest ) { + var i, l, type, pdataOld, pdataCur, udataOld, udataCur, events; + + if ( dest.nodeType !== 1 ) { + return; + } + + // 1. Copy private data: events, handlers, etc. + if ( dataPriv.hasData( src ) ) { + pdataOld = dataPriv.access( src ); + pdataCur = dataPriv.set( dest, pdataOld ); + events = pdataOld.events; + + if ( events ) { + delete pdataCur.handle; + pdataCur.events = {}; + + for ( type in events ) { + for ( i = 0, l = events[ type ].length; i < l; i++ ) { + jQuery.event.add( dest, type, events[ type ][ i ] ); + } + } + } + } + + // 2. Copy user data + if ( dataUser.hasData( src ) ) { + udataOld = dataUser.access( src ); + udataCur = jQuery.extend( {}, udataOld ); + + dataUser.set( dest, udataCur ); + } +} + +// Fix IE bugs, see support tests +function fixInput( src, dest ) { + var nodeName = dest.nodeName.toLowerCase(); + + // Fails to persist the checked state of a cloned checkbox or radio button. + if ( nodeName === "input" && rcheckableType.test( src.type ) ) { + dest.checked = src.checked; + + // Fails to return the selected option to the default selected state when cloning options + } else if ( nodeName === "input" || nodeName === "textarea" ) { + dest.defaultValue = src.defaultValue; + } +} + +function domManip( collection, args, callback, ignored ) { + + // Flatten any nested arrays + args = concat.apply( [], args ); + + var fragment, first, scripts, hasScripts, node, doc, + i = 0, + l = collection.length, + iNoClone = l - 1, + value = args[ 0 ], + isFunction = jQuery.isFunction( value ); + + // We can't cloneNode fragments that contain checked, in WebKit + if ( isFunction || + ( l > 1 && typeof value === "string" && + !support.checkClone && rchecked.test( value ) ) ) { + return collection.each( function( index ) { + var self = collection.eq( index ); + if ( isFunction ) { + args[ 0 ] = value.call( this, index, self.html() ); + } + domManip( self, args, callback, ignored ); + } ); + } + + if ( l ) { + fragment = buildFragment( args, collection[ 0 ].ownerDocument, false, collection, ignored ); + first = fragment.firstChild; + + if ( fragment.childNodes.length === 1 ) { + fragment = first; + } + + // Require either new content or an interest in ignored elements to invoke the callback + if ( first || ignored ) { + scripts = jQuery.map( getAll( fragment, "script" ), disableScript ); + hasScripts = scripts.length; + + // Use the original fragment for the last item + // instead of the first because it can end up + // being emptied incorrectly in certain situations (#8070). + for ( ; i < l; i++ ) { + node = fragment; + + if ( i !== iNoClone ) { + node = jQuery.clone( node, true, true ); + + // Keep references to cloned scripts for later restoration + if ( hasScripts ) { + + // Support: Android <=4.0 only, PhantomJS 1 only + // push.apply(_, arraylike) throws on ancient WebKit + jQuery.merge( scripts, getAll( node, "script" ) ); + } + } + + callback.call( collection[ i ], node, i ); + } + + if ( hasScripts ) { + doc = scripts[ scripts.length - 1 ].ownerDocument; + + // Reenable scripts + jQuery.map( scripts, restoreScript ); + + // Evaluate executable scripts on first document insertion + for ( i = 0; i < hasScripts; i++ ) { + node = scripts[ i ]; + if ( rscriptType.test( node.type || "" ) && + !dataPriv.access( node, "globalEval" ) && + jQuery.contains( doc, node ) ) { + + if ( node.src ) { + + // Optional AJAX dependency, but won't run scripts if not present + if ( jQuery._evalUrl ) { + jQuery._evalUrl( node.src ); + } + } else { + DOMEval( node.textContent.replace( rcleanScript, "" ), doc ); + } + } + } + } + } + } + + return collection; +} + +function remove( elem, selector, keepData ) { + var node, + nodes = selector ? jQuery.filter( selector, elem ) : elem, + i = 0; + + for ( ; ( node = nodes[ i ] ) != null; i++ ) { + if ( !keepData && node.nodeType === 1 ) { + jQuery.cleanData( getAll( node ) ); + } + + if ( node.parentNode ) { + if ( keepData && jQuery.contains( node.ownerDocument, node ) ) { + setGlobalEval( getAll( node, "script" ) ); + } + node.parentNode.removeChild( node ); + } + } + + return elem; +} + +jQuery.extend( { + htmlPrefilter: function( html ) { + return html.replace( rxhtmlTag, "<$1></$2>" ); + }, + + clone: function( elem, dataAndEvents, deepDataAndEvents ) { + var i, l, srcElements, destElements, + clone = elem.cloneNode( true ), + inPage = jQuery.contains( elem.ownerDocument, elem ); + + // Fix IE cloning issues + if ( !support.noCloneChecked && ( elem.nodeType === 1 || elem.nodeType === 11 ) && + !jQuery.isXMLDoc( elem ) ) { + + // We eschew Sizzle here for performance reasons: https://jsperf.com/getall-vs-sizzle/2 + destElements = getAll( clone ); + srcElements = getAll( elem ); + + for ( i = 0, l = srcElements.length; i < l; i++ ) { + fixInput( srcElements[ i ], destElements[ i ] ); + } + } + + // Copy the events from the original to the clone + if ( dataAndEvents ) { + if ( deepDataAndEvents ) { + srcElements = srcElements || getAll( elem ); + destElements = destElements || getAll( clone ); + + for ( i = 0, l = srcElements.length; i < l; i++ ) { + cloneCopyEvent( srcElements[ i ], destElements[ i ] ); + } + } else { + cloneCopyEvent( elem, clone ); + } + } + + // Preserve script evaluation history + destElements = getAll( clone, "script" ); + if ( destElements.length > 0 ) { + setGlobalEval( destElements, !inPage && getAll( elem, "script" ) ); + } + + // Return the cloned set + return clone; + }, + + cleanData: function( elems ) { + var data, elem, type, + special = jQuery.event.special, + i = 0; + + for ( ; ( elem = elems[ i ] ) !== undefined; i++ ) { + if ( acceptData( elem ) ) { + if ( ( data = elem[ dataPriv.expando ] ) ) { + if ( data.events ) { + for ( type in data.events ) { + if ( special[ type ] ) { + jQuery.event.remove( elem, type ); + + // This is a shortcut to avoid jQuery.event.remove's overhead + } else { + jQuery.removeEvent( elem, type, data.handle ); + } + } + } + + // Support: Chrome <=35 - 45+ + // Assign undefined instead of using delete, see Data#remove + elem[ dataPriv.expando ] = undefined; + } + if ( elem[ dataUser.expando ] ) { + + // Support: Chrome <=35 - 45+ + // Assign undefined instead of using delete, see Data#remove + elem[ dataUser.expando ] = undefined; + } + } + } + } +} ); + +jQuery.fn.extend( { + detach: function( selector ) { + return remove( this, selector, true ); + }, + + remove: function( selector ) { + return remove( this, selector ); + }, + + text: function( value ) { + return access( this, function( value ) { + return value === undefined ? + jQuery.text( this ) : + this.empty().each( function() { + if ( this.nodeType === 1 || this.nodeType === 11 || this.nodeType === 9 ) { + this.textContent = value; + } + } ); + }, null, value, arguments.length ); + }, + + append: function() { + return domManip( this, arguments, function( elem ) { + if ( this.nodeType === 1 || this.nodeType === 11 || this.nodeType === 9 ) { + var target = manipulationTarget( this, elem ); + target.appendChild( elem ); + } + } ); + }, + + prepend: function() { + return domManip( this, arguments, function( elem ) { + if ( this.nodeType === 1 || this.nodeType === 11 || this.nodeType === 9 ) { + var target = manipulationTarget( this, elem ); + target.insertBefore( elem, target.firstChild ); + } + } ); + }, + + before: function() { + return domManip( this, arguments, function( elem ) { + if ( this.parentNode ) { + this.parentNode.insertBefore( elem, this ); + } + } ); + }, + + after: function() { + return domManip( this, arguments, function( elem ) { + if ( this.parentNode ) { + this.parentNode.insertBefore( elem, this.nextSibling ); + } + } ); + }, + + empty: function() { + var elem, + i = 0; + + for ( ; ( elem = this[ i ] ) != null; i++ ) { + if ( elem.nodeType === 1 ) { + + // Prevent memory leaks + jQuery.cleanData( getAll( elem, false ) ); + + // Remove any remaining nodes + elem.textContent = ""; + } + } + + return this; + }, + + clone: function( dataAndEvents, deepDataAndEvents ) { + dataAndEvents = dataAndEvents == null ? false : dataAndEvents; + deepDataAndEvents = deepDataAndEvents == null ? dataAndEvents : deepDataAndEvents; + + return this.map( function() { + return jQuery.clone( this, dataAndEvents, deepDataAndEvents ); + } ); + }, + + html: function( value ) { + return access( this, function( value ) { + var elem = this[ 0 ] || {}, + i = 0, + l = this.length; + + if ( value === undefined && elem.nodeType === 1 ) { + return elem.innerHTML; + } + + // See if we can take a shortcut and just use innerHTML + if ( typeof value === "string" && !rnoInnerhtml.test( value ) && + !wrapMap[ ( rtagName.exec( value ) || [ "", "" ] )[ 1 ].toLowerCase() ] ) { + + value = jQuery.htmlPrefilter( value ); + + try { + for ( ; i < l; i++ ) { + elem = this[ i ] || {}; + + // Remove element nodes and prevent memory leaks + if ( elem.nodeType === 1 ) { + jQuery.cleanData( getAll( elem, false ) ); + elem.innerHTML = value; + } + } + + elem = 0; + + // If using innerHTML throws an exception, use the fallback method + } catch ( e ) {} + } + + if ( elem ) { + this.empty().append( value ); + } + }, null, value, arguments.length ); + }, + + replaceWith: function() { + var ignored = []; + + // Make the changes, replacing each non-ignored context element with the new content + return domManip( this, arguments, function( elem ) { + var parent = this.parentNode; + + if ( jQuery.inArray( this, ignored ) < 0 ) { + jQuery.cleanData( getAll( this ) ); + if ( parent ) { + parent.replaceChild( elem, this ); + } + } + + // Force callback invocation + }, ignored ); + } +} ); + +jQuery.each( { + appendTo: "append", + prependTo: "prepend", + insertBefore: "before", + insertAfter: "after", + replaceAll: "replaceWith" +}, function( name, original ) { + jQuery.fn[ name ] = function( selector ) { + var elems, + ret = [], + insert = jQuery( selector ), + last = insert.length - 1, + i = 0; + + for ( ; i <= last; i++ ) { + elems = i === last ? this : this.clone( true ); + jQuery( insert[ i ] )[ original ]( elems ); + + // Support: Android <=4.0 only, PhantomJS 1 only + // .get() because push.apply(_, arraylike) throws on ancient WebKit + push.apply( ret, elems.get() ); + } + + return this.pushStack( ret ); + }; +} ); +var rmargin = ( /^margin/ ); + +var rnumnonpx = new RegExp( "^(" + pnum + ")(?!px)[a-z%]+$", "i" ); + +var getStyles = function( elem ) { + + // Support: IE <=11 only, Firefox <=30 (#15098, #14150) + // IE throws on elements created in popups + // FF meanwhile throws on frame elements through "defaultView.getComputedStyle" + var view = elem.ownerDocument.defaultView; + + if ( !view || !view.opener ) { + view = window; + } + + return view.getComputedStyle( elem ); + }; + + + +( function() { + + // Executing both pixelPosition & boxSizingReliable tests require only one layout + // so they're executed at the same time to save the second computation. + function computeStyleTests() { + + // This is a singleton, we need to execute it only once + if ( !div ) { + return; + } + + div.style.cssText = + "box-sizing:border-box;" + + "position:relative;display:block;" + + "margin:auto;border:1px;padding:1px;" + + "top:1%;width:50%"; + div.innerHTML = ""; + documentElement.appendChild( container ); + + var divStyle = window.getComputedStyle( div ); + pixelPositionVal = divStyle.top !== "1%"; + + // Support: Android 4.0 - 4.3 only, Firefox <=3 - 44 + reliableMarginLeftVal = divStyle.marginLeft === "2px"; + boxSizingReliableVal = divStyle.width === "4px"; + + // Support: Android 4.0 - 4.3 only + // Some styles come back with percentage values, even though they shouldn't + div.style.marginRight = "50%"; + pixelMarginRightVal = divStyle.marginRight === "4px"; + + documentElement.removeChild( container ); + + // Nullify the div so it wouldn't be stored in the memory and + // it will also be a sign that checks already performed + div = null; + } + + var pixelPositionVal, boxSizingReliableVal, pixelMarginRightVal, reliableMarginLeftVal, + container = document.createElement( "div" ), + div = document.createElement( "div" ); + + // Finish early in limited (non-browser) environments + if ( !div.style ) { + return; + } + + // Support: IE <=9 - 11 only + // Style of cloned element affects source element cloned (#8908) + div.style.backgroundClip = "content-box"; + div.cloneNode( true ).style.backgroundClip = ""; + support.clearCloneStyle = div.style.backgroundClip === "content-box"; + + container.style.cssText = "border:0;width:8px;height:0;top:0;left:-9999px;" + + "padding:0;margin-top:1px;position:absolute"; + container.appendChild( div ); + + jQuery.extend( support, { + pixelPosition: function() { + computeStyleTests(); + return pixelPositionVal; + }, + boxSizingReliable: function() { + computeStyleTests(); + return boxSizingReliableVal; + }, + pixelMarginRight: function() { + computeStyleTests(); + return pixelMarginRightVal; + }, + reliableMarginLeft: function() { + computeStyleTests(); + return reliableMarginLeftVal; + } + } ); +} )(); + + +function curCSS( elem, name, computed ) { + var width, minWidth, maxWidth, ret, + style = elem.style; + + computed = computed || getStyles( elem ); + + // Support: IE <=9 only + // getPropertyValue is only needed for .css('filter') (#12537) + if ( computed ) { + ret = computed.getPropertyValue( name ) || computed[ name ]; + + if ( ret === "" && !jQuery.contains( elem.ownerDocument, elem ) ) { + ret = jQuery.style( elem, name ); + } + + // A tribute to the "awesome hack by Dean Edwards" + // Android Browser returns percentage for some values, + // but width seems to be reliably pixels. + // This is against the CSSOM draft spec: + // https://drafts.csswg.org/cssom/#resolved-values + if ( !support.pixelMarginRight() && rnumnonpx.test( ret ) && rmargin.test( name ) ) { + + // Remember the original values + width = style.width; + minWidth = style.minWidth; + maxWidth = style.maxWidth; + + // Put in the new values to get a computed value out + style.minWidth = style.maxWidth = style.width = ret; + ret = computed.width; + + // Revert the changed values + style.width = width; + style.minWidth = minWidth; + style.maxWidth = maxWidth; + } + } + + return ret !== undefined ? + + // Support: IE <=9 - 11 only + // IE returns zIndex value as an integer. + ret + "" : + ret; +} + + +function addGetHookIf( conditionFn, hookFn ) { + + // Define the hook, we'll check on the first run if it's really needed. + return { + get: function() { + if ( conditionFn() ) { + + // Hook not needed (or it's not possible to use it due + // to missing dependency), remove it. + delete this.get; + return; + } + + // Hook needed; redefine it so that the support test is not executed again. + return ( this.get = hookFn ).apply( this, arguments ); + } + }; +} + + +var + + // Swappable if display is none or starts with table + // except "table", "table-cell", or "table-caption" + // See here for display values: https://developer.mozilla.org/en-US/docs/CSS/display + rdisplayswap = /^(none|table(?!-c[ea]).+)/, + cssShow = { position: "absolute", visibility: "hidden", display: "block" }, + cssNormalTransform = { + letterSpacing: "0", + fontWeight: "400" + }, + + cssPrefixes = [ "Webkit", "Moz", "ms" ], + emptyStyle = document.createElement( "div" ).style; + +// Return a css property mapped to a potentially vendor prefixed property +function vendorPropName( name ) { + + // Shortcut for names that are not vendor prefixed + if ( name in emptyStyle ) { + return name; + } + + // Check for vendor prefixed names + var capName = name[ 0 ].toUpperCase() + name.slice( 1 ), + i = cssPrefixes.length; + + while ( i-- ) { + name = cssPrefixes[ i ] + capName; + if ( name in emptyStyle ) { + return name; + } + } +} + +function setPositiveNumber( elem, value, subtract ) { + + // Any relative (+/-) values have already been + // normalized at this point + var matches = rcssNum.exec( value ); + return matches ? + + // Guard against undefined "subtract", e.g., when used as in cssHooks + Math.max( 0, matches[ 2 ] - ( subtract || 0 ) ) + ( matches[ 3 ] || "px" ) : + value; +} + +function augmentWidthOrHeight( elem, name, extra, isBorderBox, styles ) { + var i = extra === ( isBorderBox ? "border" : "content" ) ? + + // If we already have the right measurement, avoid augmentation + 4 : + + // Otherwise initialize for horizontal or vertical properties + name === "width" ? 1 : 0, + + val = 0; + + for ( ; i < 4; i += 2 ) { + + // Both box models exclude margin, so add it if we want it + if ( extra === "margin" ) { + val += jQuery.css( elem, extra + cssExpand[ i ], true, styles ); + } + + if ( isBorderBox ) { + + // border-box includes padding, so remove it if we want content + if ( extra === "content" ) { + val -= jQuery.css( elem, "padding" + cssExpand[ i ], true, styles ); + } + + // At this point, extra isn't border nor margin, so remove border + if ( extra !== "margin" ) { + val -= jQuery.css( elem, "border" + cssExpand[ i ] + "Width", true, styles ); + } + } else { + + // At this point, extra isn't content, so add padding + val += jQuery.css( elem, "padding" + cssExpand[ i ], true, styles ); + + // At this point, extra isn't content nor padding, so add border + if ( extra !== "padding" ) { + val += jQuery.css( elem, "border" + cssExpand[ i ] + "Width", true, styles ); + } + } + } + + return val; +} + +function getWidthOrHeight( elem, name, extra ) { + + // Start with offset property, which is equivalent to the border-box value + var val, + valueIsBorderBox = true, + styles = getStyles( elem ), + isBorderBox = jQuery.css( elem, "boxSizing", false, styles ) === "border-box"; + + // Support: IE <=11 only + // Running getBoundingClientRect on a disconnected node + // in IE throws an error. + if ( elem.getClientRects().length ) { + val = elem.getBoundingClientRect()[ name ]; + } + + // Some non-html elements return undefined for offsetWidth, so check for null/undefined + // svg - https://bugzilla.mozilla.org/show_bug.cgi?id=649285 + // MathML - https://bugzilla.mozilla.org/show_bug.cgi?id=491668 + if ( val <= 0 || val == null ) { + + // Fall back to computed then uncomputed css if necessary + val = curCSS( elem, name, styles ); + if ( val < 0 || val == null ) { + val = elem.style[ name ]; + } + + // Computed unit is not pixels. Stop here and return. + if ( rnumnonpx.test( val ) ) { + return val; + } + + // Check for style in case a browser which returns unreliable values + // for getComputedStyle silently falls back to the reliable elem.style + valueIsBorderBox = isBorderBox && + ( support.boxSizingReliable() || val === elem.style[ name ] ); + + // Normalize "", auto, and prepare for extra + val = parseFloat( val ) || 0; + } + + // Use the active box-sizing model to add/subtract irrelevant styles + return ( val + + augmentWidthOrHeight( + elem, + name, + extra || ( isBorderBox ? "border" : "content" ), + valueIsBorderBox, + styles + ) + ) + "px"; +} + +jQuery.extend( { + + // Add in style property hooks for overriding the default + // behavior of getting and setting a style property + cssHooks: { + opacity: { + get: function( elem, computed ) { + if ( computed ) { + + // We should always get a number back from opacity + var ret = curCSS( elem, "opacity" ); + return ret === "" ? "1" : ret; + } + } + } + }, + + // Don't automatically add "px" to these possibly-unitless properties + cssNumber: { + "animationIterationCount": true, + "columnCount": true, + "fillOpacity": true, + "flexGrow": true, + "flexShrink": true, + "fontWeight": true, + "lineHeight": true, + "opacity": true, + "order": true, + "orphans": true, + "widows": true, + "zIndex": true, + "zoom": true + }, + + // Add in properties whose names you wish to fix before + // setting or getting the value + cssProps: { + "float": "cssFloat" + }, + + // Get and set the style property on a DOM Node + style: function( elem, name, value, extra ) { + + // Don't set styles on text and comment nodes + if ( !elem || elem.nodeType === 3 || elem.nodeType === 8 || !elem.style ) { + return; + } + + // Make sure that we're working with the right name + var ret, type, hooks, + origName = jQuery.camelCase( name ), + style = elem.style; + + name = jQuery.cssProps[ origName ] || + ( jQuery.cssProps[ origName ] = vendorPropName( origName ) || origName ); + + // Gets hook for the prefixed version, then unprefixed version + hooks = jQuery.cssHooks[ name ] || jQuery.cssHooks[ origName ]; + + // Check if we're setting a value + if ( value !== undefined ) { + type = typeof value; + + // Convert "+=" or "-=" to relative numbers (#7345) + if ( type === "string" && ( ret = rcssNum.exec( value ) ) && ret[ 1 ] ) { + value = adjustCSS( elem, name, ret ); + + // Fixes bug #9237 + type = "number"; + } + + // Make sure that null and NaN values aren't set (#7116) + if ( value == null || value !== value ) { + return; + } + + // If a number was passed in, add the unit (except for certain CSS properties) + if ( type === "number" ) { + value += ret && ret[ 3 ] || ( jQuery.cssNumber[ origName ] ? "" : "px" ); + } + + // background-* props affect original clone's values + if ( !support.clearCloneStyle && value === "" && name.indexOf( "background" ) === 0 ) { + style[ name ] = "inherit"; + } + + // If a hook was provided, use that value, otherwise just set the specified value + if ( !hooks || !( "set" in hooks ) || + ( value = hooks.set( elem, value, extra ) ) !== undefined ) { + + style[ name ] = value; + } + + } else { + + // If a hook was provided get the non-computed value from there + if ( hooks && "get" in hooks && + ( ret = hooks.get( elem, false, extra ) ) !== undefined ) { + + return ret; + } + + // Otherwise just get the value from the style object + return style[ name ]; + } + }, + + css: function( elem, name, extra, styles ) { + var val, num, hooks, + origName = jQuery.camelCase( name ); + + // Make sure that we're working with the right name + name = jQuery.cssProps[ origName ] || + ( jQuery.cssProps[ origName ] = vendorPropName( origName ) || origName ); + + // Try prefixed name followed by the unprefixed name + hooks = jQuery.cssHooks[ name ] || jQuery.cssHooks[ origName ]; + + // If a hook was provided get the computed value from there + if ( hooks && "get" in hooks ) { + val = hooks.get( elem, true, extra ); + } + + // Otherwise, if a way to get the computed value exists, use that + if ( val === undefined ) { + val = curCSS( elem, name, styles ); + } + + // Convert "normal" to computed value + if ( val === "normal" && name in cssNormalTransform ) { + val = cssNormalTransform[ name ]; + } + + // Make numeric if forced or a qualifier was provided and val looks numeric + if ( extra === "" || extra ) { + num = parseFloat( val ); + return extra === true || isFinite( num ) ? num || 0 : val; + } + return val; + } +} ); + +jQuery.each( [ "height", "width" ], function( i, name ) { + jQuery.cssHooks[ name ] = { + get: function( elem, computed, extra ) { + if ( computed ) { + + // Certain elements can have dimension info if we invisibly show them + // but it must have a current display style that would benefit + return rdisplayswap.test( jQuery.css( elem, "display" ) ) && + + // Support: Safari 8+ + // Table columns in Safari have non-zero offsetWidth & zero + // getBoundingClientRect().width unless display is changed. + // Support: IE <=11 only + // Running getBoundingClientRect on a disconnected node + // in IE throws an error. + ( !elem.getClientRects().length || !elem.getBoundingClientRect().width ) ? + swap( elem, cssShow, function() { + return getWidthOrHeight( elem, name, extra ); + } ) : + getWidthOrHeight( elem, name, extra ); + } + }, + + set: function( elem, value, extra ) { + var matches, + styles = extra && getStyles( elem ), + subtract = extra && augmentWidthOrHeight( + elem, + name, + extra, + jQuery.css( elem, "boxSizing", false, styles ) === "border-box", + styles + ); + + // Convert to pixels if value adjustment is needed + if ( subtract && ( matches = rcssNum.exec( value ) ) && + ( matches[ 3 ] || "px" ) !== "px" ) { + + elem.style[ name ] = value; + value = jQuery.css( elem, name ); + } + + return setPositiveNumber( elem, value, subtract ); + } + }; +} ); + +jQuery.cssHooks.marginLeft = addGetHookIf( support.reliableMarginLeft, + function( elem, computed ) { + if ( computed ) { + return ( parseFloat( curCSS( elem, "marginLeft" ) ) || + elem.getBoundingClientRect().left - + swap( elem, { marginLeft: 0 }, function() { + return elem.getBoundingClientRect().left; + } ) + ) + "px"; + } + } +); + +// These hooks are used by animate to expand properties +jQuery.each( { + margin: "", + padding: "", + border: "Width" +}, function( prefix, suffix ) { + jQuery.cssHooks[ prefix + suffix ] = { + expand: function( value ) { + var i = 0, + expanded = {}, + + // Assumes a single number if not a string + parts = typeof value === "string" ? value.split( " " ) : [ value ]; + + for ( ; i < 4; i++ ) { + expanded[ prefix + cssExpand[ i ] + suffix ] = + parts[ i ] || parts[ i - 2 ] || parts[ 0 ]; + } + + return expanded; + } + }; + + if ( !rmargin.test( prefix ) ) { + jQuery.cssHooks[ prefix + suffix ].set = setPositiveNumber; + } +} ); + +jQuery.fn.extend( { + css: function( name, value ) { + return access( this, function( elem, name, value ) { + var styles, len, + map = {}, + i = 0; + + if ( jQuery.isArray( name ) ) { + styles = getStyles( elem ); + len = name.length; + + for ( ; i < len; i++ ) { + map[ name[ i ] ] = jQuery.css( elem, name[ i ], false, styles ); + } + + return map; + } + + return value !== undefined ? + jQuery.style( elem, name, value ) : + jQuery.css( elem, name ); + }, name, value, arguments.length > 1 ); + } +} ); + + +function Tween( elem, options, prop, end, easing ) { + return new Tween.prototype.init( elem, options, prop, end, easing ); +} +jQuery.Tween = Tween; + +Tween.prototype = { + constructor: Tween, + init: function( elem, options, prop, end, easing, unit ) { + this.elem = elem; + this.prop = prop; + this.easing = easing || jQuery.easing._default; + this.options = options; + this.start = this.now = this.cur(); + this.end = end; + this.unit = unit || ( jQuery.cssNumber[ prop ] ? "" : "px" ); + }, + cur: function() { + var hooks = Tween.propHooks[ this.prop ]; + + return hooks && hooks.get ? + hooks.get( this ) : + Tween.propHooks._default.get( this ); + }, + run: function( percent ) { + var eased, + hooks = Tween.propHooks[ this.prop ]; + + if ( this.options.duration ) { + this.pos = eased = jQuery.easing[ this.easing ]( + percent, this.options.duration * percent, 0, 1, this.options.duration + ); + } else { + this.pos = eased = percent; + } + this.now = ( this.end - this.start ) * eased + this.start; + + if ( this.options.step ) { + this.options.step.call( this.elem, this.now, this ); + } + + if ( hooks && hooks.set ) { + hooks.set( this ); + } else { + Tween.propHooks._default.set( this ); + } + return this; + } +}; + +Tween.prototype.init.prototype = Tween.prototype; + +Tween.propHooks = { + _default: { + get: function( tween ) { + var result; + + // Use a property on the element directly when it is not a DOM element, + // or when there is no matching style property that exists. + if ( tween.elem.nodeType !== 1 || + tween.elem[ tween.prop ] != null && tween.elem.style[ tween.prop ] == null ) { + return tween.elem[ tween.prop ]; + } + + // Passing an empty string as a 3rd parameter to .css will automatically + // attempt a parseFloat and fallback to a string if the parse fails. + // Simple values such as "10px" are parsed to Float; + // complex values such as "rotate(1rad)" are returned as-is. + result = jQuery.css( tween.elem, tween.prop, "" ); + + // Empty strings, null, undefined and "auto" are converted to 0. + return !result || result === "auto" ? 0 : result; + }, + set: function( tween ) { + + // Use step hook for back compat. + // Use cssHook if its there. + // Use .style if available and use plain properties where available. + if ( jQuery.fx.step[ tween.prop ] ) { + jQuery.fx.step[ tween.prop ]( tween ); + } else if ( tween.elem.nodeType === 1 && + ( tween.elem.style[ jQuery.cssProps[ tween.prop ] ] != null || + jQuery.cssHooks[ tween.prop ] ) ) { + jQuery.style( tween.elem, tween.prop, tween.now + tween.unit ); + } else { + tween.elem[ tween.prop ] = tween.now; + } + } + } +}; + +// Support: IE <=9 only +// Panic based approach to setting things on disconnected nodes +Tween.propHooks.scrollTop = Tween.propHooks.scrollLeft = { + set: function( tween ) { + if ( tween.elem.nodeType && tween.elem.parentNode ) { + tween.elem[ tween.prop ] = tween.now; + } + } +}; + +jQuery.easing = { + linear: function( p ) { + return p; + }, + swing: function( p ) { + return 0.5 - Math.cos( p * Math.PI ) / 2; + }, + _default: "swing" +}; + +jQuery.fx = Tween.prototype.init; + +// Back compat <1.8 extension point +jQuery.fx.step = {}; + + + + +var + fxNow, timerId, + rfxtypes = /^(?:toggle|show|hide)$/, + rrun = /queueHooks$/; + +function raf() { + if ( timerId ) { + window.requestAnimationFrame( raf ); + jQuery.fx.tick(); + } +} + +// Animations created synchronously will run synchronously +function createFxNow() { + window.setTimeout( function() { + fxNow = undefined; + } ); + return ( fxNow = jQuery.now() ); +} + +// Generate parameters to create a standard animation +function genFx( type, includeWidth ) { + var which, + i = 0, + attrs = { height: type }; + + // If we include width, step value is 1 to do all cssExpand values, + // otherwise step value is 2 to skip over Left and Right + includeWidth = includeWidth ? 1 : 0; + for ( ; i < 4; i += 2 - includeWidth ) { + which = cssExpand[ i ]; + attrs[ "margin" + which ] = attrs[ "padding" + which ] = type; + } + + if ( includeWidth ) { + attrs.opacity = attrs.width = type; + } + + return attrs; +} + +function createTween( value, prop, animation ) { + var tween, + collection = ( Animation.tweeners[ prop ] || [] ).concat( Animation.tweeners[ "*" ] ), + index = 0, + length = collection.length; + for ( ; index < length; index++ ) { + if ( ( tween = collection[ index ].call( animation, prop, value ) ) ) { + + // We're done with this property + return tween; + } + } +} + +function defaultPrefilter( elem, props, opts ) { + var prop, value, toggle, hooks, oldfire, propTween, restoreDisplay, display, + isBox = "width" in props || "height" in props, + anim = this, + orig = {}, + style = elem.style, + hidden = elem.nodeType && isHiddenWithinTree( elem ), + dataShow = dataPriv.get( elem, "fxshow" ); + + // Queue-skipping animations hijack the fx hooks + if ( !opts.queue ) { + hooks = jQuery._queueHooks( elem, "fx" ); + if ( hooks.unqueued == null ) { + hooks.unqueued = 0; + oldfire = hooks.empty.fire; + hooks.empty.fire = function() { + if ( !hooks.unqueued ) { + oldfire(); + } + }; + } + hooks.unqueued++; + + anim.always( function() { + + // Ensure the complete handler is called before this completes + anim.always( function() { + hooks.unqueued--; + if ( !jQuery.queue( elem, "fx" ).length ) { + hooks.empty.fire(); + } + } ); + } ); + } + + // Detect show/hide animations + for ( prop in props ) { + value = props[ prop ]; + if ( rfxtypes.test( value ) ) { + delete props[ prop ]; + toggle = toggle || value === "toggle"; + if ( value === ( hidden ? "hide" : "show" ) ) { + + // Pretend to be hidden if this is a "show" and + // there is still data from a stopped show/hide + if ( value === "show" && dataShow && dataShow[ prop ] !== undefined ) { + hidden = true; + + // Ignore all other no-op show/hide data + } else { + continue; + } + } + orig[ prop ] = dataShow && dataShow[ prop ] || jQuery.style( elem, prop ); + } + } + + // Bail out if this is a no-op like .hide().hide() + propTween = !jQuery.isEmptyObject( props ); + if ( !propTween && jQuery.isEmptyObject( orig ) ) { + return; + } + + // Restrict "overflow" and "display" styles during box animations + if ( isBox && elem.nodeType === 1 ) { + + // Support: IE <=9 - 11, Edge 12 - 13 + // Record all 3 overflow attributes because IE does not infer the shorthand + // from identically-valued overflowX and overflowY + opts.overflow = [ style.overflow, style.overflowX, style.overflowY ]; + + // Identify a display type, preferring old show/hide data over the CSS cascade + restoreDisplay = dataShow && dataShow.display; + if ( restoreDisplay == null ) { + restoreDisplay = dataPriv.get( elem, "display" ); + } + display = jQuery.css( elem, "display" ); + if ( display === "none" ) { + if ( restoreDisplay ) { + display = restoreDisplay; + } else { + + // Get nonempty value(s) by temporarily forcing visibility + showHide( [ elem ], true ); + restoreDisplay = elem.style.display || restoreDisplay; + display = jQuery.css( elem, "display" ); + showHide( [ elem ] ); + } + } + + // Animate inline elements as inline-block + if ( display === "inline" || display === "inline-block" && restoreDisplay != null ) { + if ( jQuery.css( elem, "float" ) === "none" ) { + + // Restore the original display value at the end of pure show/hide animations + if ( !propTween ) { + anim.done( function() { + style.display = restoreDisplay; + } ); + if ( restoreDisplay == null ) { + display = style.display; + restoreDisplay = display === "none" ? "" : display; + } + } + style.display = "inline-block"; + } + } + } + + if ( opts.overflow ) { + style.overflow = "hidden"; + anim.always( function() { + style.overflow = opts.overflow[ 0 ]; + style.overflowX = opts.overflow[ 1 ]; + style.overflowY = opts.overflow[ 2 ]; + } ); + } + + // Implement show/hide animations + propTween = false; + for ( prop in orig ) { + + // General show/hide setup for this element animation + if ( !propTween ) { + if ( dataShow ) { + if ( "hidden" in dataShow ) { + hidden = dataShow.hidden; + } + } else { + dataShow = dataPriv.access( elem, "fxshow", { display: restoreDisplay } ); + } + + // Store hidden/visible for toggle so `.stop().toggle()` "reverses" + if ( toggle ) { + dataShow.hidden = !hidden; + } + + // Show elements before animating them + if ( hidden ) { + showHide( [ elem ], true ); + } + + /* eslint-disable no-loop-func */ + + anim.done( function() { + + /* eslint-enable no-loop-func */ + + // The final step of a "hide" animation is actually hiding the element + if ( !hidden ) { + showHide( [ elem ] ); + } + dataPriv.remove( elem, "fxshow" ); + for ( prop in orig ) { + jQuery.style( elem, prop, orig[ prop ] ); + } + } ); + } + + // Per-property setup + propTween = createTween( hidden ? dataShow[ prop ] : 0, prop, anim ); + if ( !( prop in dataShow ) ) { + dataShow[ prop ] = propTween.start; + if ( hidden ) { + propTween.end = propTween.start; + propTween.start = 0; + } + } + } +} + +function propFilter( props, specialEasing ) { + var index, name, easing, value, hooks; + + // camelCase, specialEasing and expand cssHook pass + for ( index in props ) { + name = jQuery.camelCase( index ); + easing = specialEasing[ name ]; + value = props[ index ]; + if ( jQuery.isArray( value ) ) { + easing = value[ 1 ]; + value = props[ index ] = value[ 0 ]; + } + + if ( index !== name ) { + props[ name ] = value; + delete props[ index ]; + } + + hooks = jQuery.cssHooks[ name ]; + if ( hooks && "expand" in hooks ) { + value = hooks.expand( value ); + delete props[ name ]; + + // Not quite $.extend, this won't overwrite existing keys. + // Reusing 'index' because we have the correct "name" + for ( index in value ) { + if ( !( index in props ) ) { + props[ index ] = value[ index ]; + specialEasing[ index ] = easing; + } + } + } else { + specialEasing[ name ] = easing; + } + } +} + +function Animation( elem, properties, options ) { + var result, + stopped, + index = 0, + length = Animation.prefilters.length, + deferred = jQuery.Deferred().always( function() { + + // Don't match elem in the :animated selector + delete tick.elem; + } ), + tick = function() { + if ( stopped ) { + return false; + } + var currentTime = fxNow || createFxNow(), + remaining = Math.max( 0, animation.startTime + animation.duration - currentTime ), + + // Support: Android 2.3 only + // Archaic crash bug won't allow us to use `1 - ( 0.5 || 0 )` (#12497) + temp = remaining / animation.duration || 0, + percent = 1 - temp, + index = 0, + length = animation.tweens.length; + + for ( ; index < length; index++ ) { + animation.tweens[ index ].run( percent ); + } + + deferred.notifyWith( elem, [ animation, percent, remaining ] ); + + if ( percent < 1 && length ) { + return remaining; + } else { + deferred.resolveWith( elem, [ animation ] ); + return false; + } + }, + animation = deferred.promise( { + elem: elem, + props: jQuery.extend( {}, properties ), + opts: jQuery.extend( true, { + specialEasing: {}, + easing: jQuery.easing._default + }, options ), + originalProperties: properties, + originalOptions: options, + startTime: fxNow || createFxNow(), + duration: options.duration, + tweens: [], + createTween: function( prop, end ) { + var tween = jQuery.Tween( elem, animation.opts, prop, end, + animation.opts.specialEasing[ prop ] || animation.opts.easing ); + animation.tweens.push( tween ); + return tween; + }, + stop: function( gotoEnd ) { + var index = 0, + + // If we are going to the end, we want to run all the tweens + // otherwise we skip this part + length = gotoEnd ? animation.tweens.length : 0; + if ( stopped ) { + return this; + } + stopped = true; + for ( ; index < length; index++ ) { + animation.tweens[ index ].run( 1 ); + } + + // Resolve when we played the last frame; otherwise, reject + if ( gotoEnd ) { + deferred.notifyWith( elem, [ animation, 1, 0 ] ); + deferred.resolveWith( elem, [ animation, gotoEnd ] ); + } else { + deferred.rejectWith( elem, [ animation, gotoEnd ] ); + } + return this; + } + } ), + props = animation.props; + + propFilter( props, animation.opts.specialEasing ); + + for ( ; index < length; index++ ) { + result = Animation.prefilters[ index ].call( animation, elem, props, animation.opts ); + if ( result ) { + if ( jQuery.isFunction( result.stop ) ) { + jQuery._queueHooks( animation.elem, animation.opts.queue ).stop = + jQuery.proxy( result.stop, result ); + } + return result; + } + } + + jQuery.map( props, createTween, animation ); + + if ( jQuery.isFunction( animation.opts.start ) ) { + animation.opts.start.call( elem, animation ); + } + + jQuery.fx.timer( + jQuery.extend( tick, { + elem: elem, + anim: animation, + queue: animation.opts.queue + } ) + ); + + // attach callbacks from options + return animation.progress( animation.opts.progress ) + .done( animation.opts.done, animation.opts.complete ) + .fail( animation.opts.fail ) + .always( animation.opts.always ); +} + +jQuery.Animation = jQuery.extend( Animation, { + + tweeners: { + "*": [ function( prop, value ) { + var tween = this.createTween( prop, value ); + adjustCSS( tween.elem, prop, rcssNum.exec( value ), tween ); + return tween; + } ] + }, + + tweener: function( props, callback ) { + if ( jQuery.isFunction( props ) ) { + callback = props; + props = [ "*" ]; + } else { + props = props.match( rnotwhite ); + } + + var prop, + index = 0, + length = props.length; + + for ( ; index < length; index++ ) { + prop = props[ index ]; + Animation.tweeners[ prop ] = Animation.tweeners[ prop ] || []; + Animation.tweeners[ prop ].unshift( callback ); + } + }, + + prefilters: [ defaultPrefilter ], + + prefilter: function( callback, prepend ) { + if ( prepend ) { + Animation.prefilters.unshift( callback ); + } else { + Animation.prefilters.push( callback ); + } + } +} ); + +jQuery.speed = function( speed, easing, fn ) { + var opt = speed && typeof speed === "object" ? jQuery.extend( {}, speed ) : { + complete: fn || !fn && easing || + jQuery.isFunction( speed ) && speed, + duration: speed, + easing: fn && easing || easing && !jQuery.isFunction( easing ) && easing + }; + + // Go to the end state if fx are off or if document is hidden + if ( jQuery.fx.off || document.hidden ) { + opt.duration = 0; + + } else { + opt.duration = typeof opt.duration === "number" ? + opt.duration : opt.duration in jQuery.fx.speeds ? + jQuery.fx.speeds[ opt.duration ] : jQuery.fx.speeds._default; + } + + // Normalize opt.queue - true/undefined/null -> "fx" + if ( opt.queue == null || opt.queue === true ) { + opt.queue = "fx"; + } + + // Queueing + opt.old = opt.complete; + + opt.complete = function() { + if ( jQuery.isFunction( opt.old ) ) { + opt.old.call( this ); + } + + if ( opt.queue ) { + jQuery.dequeue( this, opt.queue ); + } + }; + + return opt; +}; + +jQuery.fn.extend( { + fadeTo: function( speed, to, easing, callback ) { + + // Show any hidden elements after setting opacity to 0 + return this.filter( isHiddenWithinTree ).css( "opacity", 0 ).show() + + // Animate to the value specified + .end().animate( { opacity: to }, speed, easing, callback ); + }, + animate: function( prop, speed, easing, callback ) { + var empty = jQuery.isEmptyObject( prop ), + optall = jQuery.speed( speed, easing, callback ), + doAnimation = function() { + + // Operate on a copy of prop so per-property easing won't be lost + var anim = Animation( this, jQuery.extend( {}, prop ), optall ); + + // Empty animations, or finishing resolves immediately + if ( empty || dataPriv.get( this, "finish" ) ) { + anim.stop( true ); + } + }; + doAnimation.finish = doAnimation; + + return empty || optall.queue === false ? + this.each( doAnimation ) : + this.queue( optall.queue, doAnimation ); + }, + stop: function( type, clearQueue, gotoEnd ) { + var stopQueue = function( hooks ) { + var stop = hooks.stop; + delete hooks.stop; + stop( gotoEnd ); + }; + + if ( typeof type !== "string" ) { + gotoEnd = clearQueue; + clearQueue = type; + type = undefined; + } + if ( clearQueue && type !== false ) { + this.queue( type || "fx", [] ); + } + + return this.each( function() { + var dequeue = true, + index = type != null && type + "queueHooks", + timers = jQuery.timers, + data = dataPriv.get( this ); + + if ( index ) { + if ( data[ index ] && data[ index ].stop ) { + stopQueue( data[ index ] ); + } + } else { + for ( index in data ) { + if ( data[ index ] && data[ index ].stop && rrun.test( index ) ) { + stopQueue( data[ index ] ); + } + } + } + + for ( index = timers.length; index--; ) { + if ( timers[ index ].elem === this && + ( type == null || timers[ index ].queue === type ) ) { + + timers[ index ].anim.stop( gotoEnd ); + dequeue = false; + timers.splice( index, 1 ); + } + } + + // Start the next in the queue if the last step wasn't forced. + // Timers currently will call their complete callbacks, which + // will dequeue but only if they were gotoEnd. + if ( dequeue || !gotoEnd ) { + jQuery.dequeue( this, type ); + } + } ); + }, + finish: function( type ) { + if ( type !== false ) { + type = type || "fx"; + } + return this.each( function() { + var index, + data = dataPriv.get( this ), + queue = data[ type + "queue" ], + hooks = data[ type + "queueHooks" ], + timers = jQuery.timers, + length = queue ? queue.length : 0; + + // Enable finishing flag on private data + data.finish = true; + + // Empty the queue first + jQuery.queue( this, type, [] ); + + if ( hooks && hooks.stop ) { + hooks.stop.call( this, true ); + } + + // Look for any active animations, and finish them + for ( index = timers.length; index--; ) { + if ( timers[ index ].elem === this && timers[ index ].queue === type ) { + timers[ index ].anim.stop( true ); + timers.splice( index, 1 ); + } + } + + // Look for any animations in the old queue and finish them + for ( index = 0; index < length; index++ ) { + if ( queue[ index ] && queue[ index ].finish ) { + queue[ index ].finish.call( this ); + } + } + + // Turn off finishing flag + delete data.finish; + } ); + } +} ); + +jQuery.each( [ "toggle", "show", "hide" ], function( i, name ) { + var cssFn = jQuery.fn[ name ]; + jQuery.fn[ name ] = function( speed, easing, callback ) { + return speed == null || typeof speed === "boolean" ? + cssFn.apply( this, arguments ) : + this.animate( genFx( name, true ), speed, easing, callback ); + }; +} ); + +// Generate shortcuts for custom animations +jQuery.each( { + slideDown: genFx( "show" ), + slideUp: genFx( "hide" ), + slideToggle: genFx( "toggle" ), + fadeIn: { opacity: "show" }, + fadeOut: { opacity: "hide" }, + fadeToggle: { opacity: "toggle" } +}, function( name, props ) { + jQuery.fn[ name ] = function( speed, easing, callback ) { + return this.animate( props, speed, easing, callback ); + }; +} ); + +jQuery.timers = []; +jQuery.fx.tick = function() { + var timer, + i = 0, + timers = jQuery.timers; + + fxNow = jQuery.now(); + + for ( ; i < timers.length; i++ ) { + timer = timers[ i ]; + + // Checks the timer has not already been removed + if ( !timer() && timers[ i ] === timer ) { + timers.splice( i--, 1 ); + } + } + + if ( !timers.length ) { + jQuery.fx.stop(); + } + fxNow = undefined; +}; + +jQuery.fx.timer = function( timer ) { + jQuery.timers.push( timer ); + if ( timer() ) { + jQuery.fx.start(); + } else { + jQuery.timers.pop(); + } +}; + +jQuery.fx.interval = 13; +jQuery.fx.start = function() { + if ( !timerId ) { + timerId = window.requestAnimationFrame ? + window.requestAnimationFrame( raf ) : + window.setInterval( jQuery.fx.tick, jQuery.fx.interval ); + } +}; + +jQuery.fx.stop = function() { + if ( window.cancelAnimationFrame ) { + window.cancelAnimationFrame( timerId ); + } else { + window.clearInterval( timerId ); + } + + timerId = null; +}; + +jQuery.fx.speeds = { + slow: 600, + fast: 200, + + // Default speed + _default: 400 +}; + + +// Based off of the plugin by Clint Helfers, with permission. +// https://web.archive.org/web/20100324014747/http://blindsignals.com/index.php/2009/07/jquery-delay/ +jQuery.fn.delay = function( time, type ) { + time = jQuery.fx ? jQuery.fx.speeds[ time ] || time : time; + type = type || "fx"; + + return this.queue( type, function( next, hooks ) { + var timeout = window.setTimeout( next, time ); + hooks.stop = function() { + window.clearTimeout( timeout ); + }; + } ); +}; + + +( function() { + var input = document.createElement( "input" ), + select = document.createElement( "select" ), + opt = select.appendChild( document.createElement( "option" ) ); + + input.type = "checkbox"; + + // Support: Android <=4.3 only + // Default value for a checkbox should be "on" + support.checkOn = input.value !== ""; + + // Support: IE <=11 only + // Must access selectedIndex to make default options select + support.optSelected = opt.selected; + + // Support: IE <=11 only + // An input loses its value after becoming a radio + input = document.createElement( "input" ); + input.value = "t"; + input.type = "radio"; + support.radioValue = input.value === "t"; +} )(); + + +var boolHook, + attrHandle = jQuery.expr.attrHandle; + +jQuery.fn.extend( { + attr: function( name, value ) { + return access( this, jQuery.attr, name, value, arguments.length > 1 ); + }, + + removeAttr: function( name ) { + return this.each( function() { + jQuery.removeAttr( this, name ); + } ); + } +} ); + +jQuery.extend( { + attr: function( elem, name, value ) { + var ret, hooks, + nType = elem.nodeType; + + // Don't get/set attributes on text, comment and attribute nodes + if ( nType === 3 || nType === 8 || nType === 2 ) { + return; + } + + // Fallback to prop when attributes are not supported + if ( typeof elem.getAttribute === "undefined" ) { + return jQuery.prop( elem, name, value ); + } + + // Attribute hooks are determined by the lowercase version + // Grab necessary hook if one is defined + if ( nType !== 1 || !jQuery.isXMLDoc( elem ) ) { + hooks = jQuery.attrHooks[ name.toLowerCase() ] || + ( jQuery.expr.match.bool.test( name ) ? boolHook : undefined ); + } + + if ( value !== undefined ) { + if ( value === null ) { + jQuery.removeAttr( elem, name ); + return; + } + + if ( hooks && "set" in hooks && + ( ret = hooks.set( elem, value, name ) ) !== undefined ) { + return ret; + } + + elem.setAttribute( name, value + "" ); + return value; + } + + if ( hooks && "get" in hooks && ( ret = hooks.get( elem, name ) ) !== null ) { + return ret; + } + + ret = jQuery.find.attr( elem, name ); + + // Non-existent attributes return null, we normalize to undefined + return ret == null ? undefined : ret; + }, + + attrHooks: { + type: { + set: function( elem, value ) { + if ( !support.radioValue && value === "radio" && + jQuery.nodeName( elem, "input" ) ) { + var val = elem.value; + elem.setAttribute( "type", value ); + if ( val ) { + elem.value = val; + } + return value; + } + } + } + }, + + removeAttr: function( elem, value ) { + var name, + i = 0, + attrNames = value && value.match( rnotwhite ); + + if ( attrNames && elem.nodeType === 1 ) { + while ( ( name = attrNames[ i++ ] ) ) { + elem.removeAttribute( name ); + } + } + } +} ); + +// Hooks for boolean attributes +boolHook = { + set: function( elem, value, name ) { + if ( value === false ) { + + // Remove boolean attributes when set to false + jQuery.removeAttr( elem, name ); + } else { + elem.setAttribute( name, name ); + } + return name; + } +}; + +jQuery.each( jQuery.expr.match.bool.source.match( /\w+/g ), function( i, name ) { + var getter = attrHandle[ name ] || jQuery.find.attr; + + attrHandle[ name ] = function( elem, name, isXML ) { + var ret, handle, + lowercaseName = name.toLowerCase(); + + if ( !isXML ) { + + // Avoid an infinite loop by temporarily removing this function from the getter + handle = attrHandle[ lowercaseName ]; + attrHandle[ lowercaseName ] = ret; + ret = getter( elem, name, isXML ) != null ? + lowercaseName : + null; + attrHandle[ lowercaseName ] = handle; + } + return ret; + }; +} ); + + + + +var rfocusable = /^(?:input|select|textarea|button)$/i, + rclickable = /^(?:a|area)$/i; + +jQuery.fn.extend( { + prop: function( name, value ) { + return access( this, jQuery.prop, name, value, arguments.length > 1 ); + }, + + removeProp: function( name ) { + return this.each( function() { + delete this[ jQuery.propFix[ name ] || name ]; + } ); + } +} ); + +jQuery.extend( { + prop: function( elem, name, value ) { + var ret, hooks, + nType = elem.nodeType; + + // Don't get/set properties on text, comment and attribute nodes + if ( nType === 3 || nType === 8 || nType === 2 ) { + return; + } + + if ( nType !== 1 || !jQuery.isXMLDoc( elem ) ) { + + // Fix name and attach hooks + name = jQuery.propFix[ name ] || name; + hooks = jQuery.propHooks[ name ]; + } + + if ( value !== undefined ) { + if ( hooks && "set" in hooks && + ( ret = hooks.set( elem, value, name ) ) !== undefined ) { + return ret; + } + + return ( elem[ name ] = value ); + } + + if ( hooks && "get" in hooks && ( ret = hooks.get( elem, name ) ) !== null ) { + return ret; + } + + return elem[ name ]; + }, + + propHooks: { + tabIndex: { + get: function( elem ) { + + // Support: IE <=9 - 11 only + // elem.tabIndex doesn't always return the + // correct value when it hasn't been explicitly set + // https://web.archive.org/web/20141116233347/http://fluidproject.org/blog/2008/01/09/getting-setting-and-removing-tabindex-values-with-javascript/ + // Use proper attribute retrieval(#12072) + var tabindex = jQuery.find.attr( elem, "tabindex" ); + + return tabindex ? + parseInt( tabindex, 10 ) : + rfocusable.test( elem.nodeName ) || + rclickable.test( elem.nodeName ) && elem.href ? + 0 : + -1; + } + } + }, + + propFix: { + "for": "htmlFor", + "class": "className" + } +} ); + +// Support: IE <=11 only +// Accessing the selectedIndex property +// forces the browser to respect setting selected +// on the option +// The getter ensures a default option is selected +// when in an optgroup +if ( !support.optSelected ) { + jQuery.propHooks.selected = { + get: function( elem ) { + var parent = elem.parentNode; + if ( parent && parent.parentNode ) { + parent.parentNode.selectedIndex; + } + return null; + }, + set: function( elem ) { + var parent = elem.parentNode; + if ( parent ) { + parent.selectedIndex; + + if ( parent.parentNode ) { + parent.parentNode.selectedIndex; + } + } + } + }; +} + +jQuery.each( [ + "tabIndex", + "readOnly", + "maxLength", + "cellSpacing", + "cellPadding", + "rowSpan", + "colSpan", + "useMap", + "frameBorder", + "contentEditable" +], function() { + jQuery.propFix[ this.toLowerCase() ] = this; +} ); + + + + +var rclass = /[\t\r\n\f]/g; + +function getClass( elem ) { + return elem.getAttribute && elem.getAttribute( "class" ) || ""; +} + +jQuery.fn.extend( { + addClass: function( value ) { + var classes, elem, cur, curValue, clazz, j, finalValue, + i = 0; + + if ( jQuery.isFunction( value ) ) { + return this.each( function( j ) { + jQuery( this ).addClass( value.call( this, j, getClass( this ) ) ); + } ); + } + + if ( typeof value === "string" && value ) { + classes = value.match( rnotwhite ) || []; + + while ( ( elem = this[ i++ ] ) ) { + curValue = getClass( elem ); + cur = elem.nodeType === 1 && + ( " " + curValue + " " ).replace( rclass, " " ); + + if ( cur ) { + j = 0; + while ( ( clazz = classes[ j++ ] ) ) { + if ( cur.indexOf( " " + clazz + " " ) < 0 ) { + cur += clazz + " "; + } + } + + // Only assign if different to avoid unneeded rendering. + finalValue = jQuery.trim( cur ); + if ( curValue !== finalValue ) { + elem.setAttribute( "class", finalValue ); + } + } + } + } + + return this; + }, + + removeClass: function( value ) { + var classes, elem, cur, curValue, clazz, j, finalValue, + i = 0; + + if ( jQuery.isFunction( value ) ) { + return this.each( function( j ) { + jQuery( this ).removeClass( value.call( this, j, getClass( this ) ) ); + } ); + } + + if ( !arguments.length ) { + return this.attr( "class", "" ); + } + + if ( typeof value === "string" && value ) { + classes = value.match( rnotwhite ) || []; + + while ( ( elem = this[ i++ ] ) ) { + curValue = getClass( elem ); + + // This expression is here for better compressibility (see addClass) + cur = elem.nodeType === 1 && + ( " " + curValue + " " ).replace( rclass, " " ); + + if ( cur ) { + j = 0; + while ( ( clazz = classes[ j++ ] ) ) { + + // Remove *all* instances + while ( cur.indexOf( " " + clazz + " " ) > -1 ) { + cur = cur.replace( " " + clazz + " ", " " ); + } + } + + // Only assign if different to avoid unneeded rendering. + finalValue = jQuery.trim( cur ); + if ( curValue !== finalValue ) { + elem.setAttribute( "class", finalValue ); + } + } + } + } + + return this; + }, + + toggleClass: function( value, stateVal ) { + var type = typeof value; + + if ( typeof stateVal === "boolean" && type === "string" ) { + return stateVal ? this.addClass( value ) : this.removeClass( value ); + } + + if ( jQuery.isFunction( value ) ) { + return this.each( function( i ) { + jQuery( this ).toggleClass( + value.call( this, i, getClass( this ), stateVal ), + stateVal + ); + } ); + } + + return this.each( function() { + var className, i, self, classNames; + + if ( type === "string" ) { + + // Toggle individual class names + i = 0; + self = jQuery( this ); + classNames = value.match( rnotwhite ) || []; + + while ( ( className = classNames[ i++ ] ) ) { + + // Check each className given, space separated list + if ( self.hasClass( className ) ) { + self.removeClass( className ); + } else { + self.addClass( className ); + } + } + + // Toggle whole class name + } else if ( value === undefined || type === "boolean" ) { + className = getClass( this ); + if ( className ) { + + // Store className if set + dataPriv.set( this, "__className__", className ); + } + + // If the element has a class name or if we're passed `false`, + // then remove the whole classname (if there was one, the above saved it). + // Otherwise bring back whatever was previously saved (if anything), + // falling back to the empty string if nothing was stored. + if ( this.setAttribute ) { + this.setAttribute( "class", + className || value === false ? + "" : + dataPriv.get( this, "__className__" ) || "" + ); + } + } + } ); + }, + + hasClass: function( selector ) { + var className, elem, + i = 0; + + className = " " + selector + " "; + while ( ( elem = this[ i++ ] ) ) { + if ( elem.nodeType === 1 && + ( " " + getClass( elem ) + " " ).replace( rclass, " " ) + .indexOf( className ) > -1 + ) { + return true; + } + } + + return false; + } +} ); + + + + +var rreturn = /\r/g, + rspaces = /[\x20\t\r\n\f]+/g; + +jQuery.fn.extend( { + val: function( value ) { + var hooks, ret, isFunction, + elem = this[ 0 ]; + + if ( !arguments.length ) { + if ( elem ) { + hooks = jQuery.valHooks[ elem.type ] || + jQuery.valHooks[ elem.nodeName.toLowerCase() ]; + + if ( hooks && + "get" in hooks && + ( ret = hooks.get( elem, "value" ) ) !== undefined + ) { + return ret; + } + + ret = elem.value; + + return typeof ret === "string" ? + + // Handle most common string cases + ret.replace( rreturn, "" ) : + + // Handle cases where value is null/undef or number + ret == null ? "" : ret; + } + + return; + } + + isFunction = jQuery.isFunction( value ); + + return this.each( function( i ) { + var val; + + if ( this.nodeType !== 1 ) { + return; + } + + if ( isFunction ) { + val = value.call( this, i, jQuery( this ).val() ); + } else { + val = value; + } + + // Treat null/undefined as ""; convert numbers to string + if ( val == null ) { + val = ""; + + } else if ( typeof val === "number" ) { + val += ""; + + } else if ( jQuery.isArray( val ) ) { + val = jQuery.map( val, function( value ) { + return value == null ? "" : value + ""; + } ); + } + + hooks = jQuery.valHooks[ this.type ] || jQuery.valHooks[ this.nodeName.toLowerCase() ]; + + // If set returns undefined, fall back to normal setting + if ( !hooks || !( "set" in hooks ) || hooks.set( this, val, "value" ) === undefined ) { + this.value = val; + } + } ); + } +} ); + +jQuery.extend( { + valHooks: { + option: { + get: function( elem ) { + + var val = jQuery.find.attr( elem, "value" ); + return val != null ? + val : + + // Support: IE <=10 - 11 only + // option.text throws exceptions (#14686, #14858) + // Strip and collapse whitespace + // https://html.spec.whatwg.org/#strip-and-collapse-whitespace + jQuery.trim( jQuery.text( elem ) ).replace( rspaces, " " ); + } + }, + select: { + get: function( elem ) { + var value, option, + options = elem.options, + index = elem.selectedIndex, + one = elem.type === "select-one", + values = one ? null : [], + max = one ? index + 1 : options.length, + i = index < 0 ? + max : + one ? index : 0; + + // Loop through all the selected options + for ( ; i < max; i++ ) { + option = options[ i ]; + + // Support: IE <=9 only + // IE8-9 doesn't update selected after form reset (#2551) + if ( ( option.selected || i === index ) && + + // Don't return options that are disabled or in a disabled optgroup + !option.disabled && + ( !option.parentNode.disabled || + !jQuery.nodeName( option.parentNode, "optgroup" ) ) ) { + + // Get the specific value for the option + value = jQuery( option ).val(); + + // We don't need an array for one selects + if ( one ) { + return value; + } + + // Multi-Selects return an array + values.push( value ); + } + } + + return values; + }, + + set: function( elem, value ) { + var optionSet, option, + options = elem.options, + values = jQuery.makeArray( value ), + i = options.length; + + while ( i-- ) { + option = options[ i ]; + + /* eslint-disable no-cond-assign */ + + if ( option.selected = + jQuery.inArray( jQuery.valHooks.option.get( option ), values ) > -1 + ) { + optionSet = true; + } + + /* eslint-enable no-cond-assign */ + } + + // Force browsers to behave consistently when non-matching value is set + if ( !optionSet ) { + elem.selectedIndex = -1; + } + return values; + } + } + } +} ); + +// Radios and checkboxes getter/setter +jQuery.each( [ "radio", "checkbox" ], function() { + jQuery.valHooks[ this ] = { + set: function( elem, value ) { + if ( jQuery.isArray( value ) ) { + return ( elem.checked = jQuery.inArray( jQuery( elem ).val(), value ) > -1 ); + } + } + }; + if ( !support.checkOn ) { + jQuery.valHooks[ this ].get = function( elem ) { + return elem.getAttribute( "value" ) === null ? "on" : elem.value; + }; + } +} ); + + + + +// Return jQuery for attributes-only inclusion + + +var rfocusMorph = /^(?:focusinfocus|focusoutblur)$/; + +jQuery.extend( jQuery.event, { + + trigger: function( event, data, elem, onlyHandlers ) { + + var i, cur, tmp, bubbleType, ontype, handle, special, + eventPath = [ elem || document ], + type = hasOwn.call( event, "type" ) ? event.type : event, + namespaces = hasOwn.call( event, "namespace" ) ? event.namespace.split( "." ) : []; + + cur = tmp = elem = elem || document; + + // Don't do events on text and comment nodes + if ( elem.nodeType === 3 || elem.nodeType === 8 ) { + return; + } + + // focus/blur morphs to focusin/out; ensure we're not firing them right now + if ( rfocusMorph.test( type + jQuery.event.triggered ) ) { + return; + } + + if ( type.indexOf( "." ) > -1 ) { + + // Namespaced trigger; create a regexp to match event type in handle() + namespaces = type.split( "." ); + type = namespaces.shift(); + namespaces.sort(); + } + ontype = type.indexOf( ":" ) < 0 && "on" + type; + + // Caller can pass in a jQuery.Event object, Object, or just an event type string + event = event[ jQuery.expando ] ? + event : + new jQuery.Event( type, typeof event === "object" && event ); + + // Trigger bitmask: & 1 for native handlers; & 2 for jQuery (always true) + event.isTrigger = onlyHandlers ? 2 : 3; + event.namespace = namespaces.join( "." ); + event.rnamespace = event.namespace ? + new RegExp( "(^|\\.)" + namespaces.join( "\\.(?:.*\\.|)" ) + "(\\.|$)" ) : + null; + + // Clean up the event in case it is being reused + event.result = undefined; + if ( !event.target ) { + event.target = elem; + } + + // Clone any incoming data and prepend the event, creating the handler arg list + data = data == null ? + [ event ] : + jQuery.makeArray( data, [ event ] ); + + // Allow special events to draw outside the lines + special = jQuery.event.special[ type ] || {}; + if ( !onlyHandlers && special.trigger && special.trigger.apply( elem, data ) === false ) { + return; + } + + // Determine event propagation path in advance, per W3C events spec (#9951) + // Bubble up to document, then to window; watch for a global ownerDocument var (#9724) + if ( !onlyHandlers && !special.noBubble && !jQuery.isWindow( elem ) ) { + + bubbleType = special.delegateType || type; + if ( !rfocusMorph.test( bubbleType + type ) ) { + cur = cur.parentNode; + } + for ( ; cur; cur = cur.parentNode ) { + eventPath.push( cur ); + tmp = cur; + } + + // Only add window if we got to document (e.g., not plain obj or detached DOM) + if ( tmp === ( elem.ownerDocument || document ) ) { + eventPath.push( tmp.defaultView || tmp.parentWindow || window ); + } + } + + // Fire handlers on the event path + i = 0; + while ( ( cur = eventPath[ i++ ] ) && !event.isPropagationStopped() ) { + + event.type = i > 1 ? + bubbleType : + special.bindType || type; + + // jQuery handler + handle = ( dataPriv.get( cur, "events" ) || {} )[ event.type ] && + dataPriv.get( cur, "handle" ); + if ( handle ) { + handle.apply( cur, data ); + } + + // Native handler + handle = ontype && cur[ ontype ]; + if ( handle && handle.apply && acceptData( cur ) ) { + event.result = handle.apply( cur, data ); + if ( event.result === false ) { + event.preventDefault(); + } + } + } + event.type = type; + + // If nobody prevented the default action, do it now + if ( !onlyHandlers && !event.isDefaultPrevented() ) { + + if ( ( !special._default || + special._default.apply( eventPath.pop(), data ) === false ) && + acceptData( elem ) ) { + + // Call a native DOM method on the target with the same name as the event. + // Don't do default actions on window, that's where global variables be (#6170) + if ( ontype && jQuery.isFunction( elem[ type ] ) && !jQuery.isWindow( elem ) ) { + + // Don't re-trigger an onFOO event when we call its FOO() method + tmp = elem[ ontype ]; + + if ( tmp ) { + elem[ ontype ] = null; + } + + // Prevent re-triggering of the same event, since we already bubbled it above + jQuery.event.triggered = type; + elem[ type ](); + jQuery.event.triggered = undefined; + + if ( tmp ) { + elem[ ontype ] = tmp; + } + } + } + } + + return event.result; + }, + + // Piggyback on a donor event to simulate a different one + // Used only for `focus(in | out)` events + simulate: function( type, elem, event ) { + var e = jQuery.extend( + new jQuery.Event(), + event, + { + type: type, + isSimulated: true + } + ); + + jQuery.event.trigger( e, null, elem ); + } + +} ); + +jQuery.fn.extend( { + + trigger: function( type, data ) { + return this.each( function() { + jQuery.event.trigger( type, data, this ); + } ); + }, + triggerHandler: function( type, data ) { + var elem = this[ 0 ]; + if ( elem ) { + return jQuery.event.trigger( type, data, elem, true ); + } + } +} ); + + +jQuery.each( ( "blur focus focusin focusout resize scroll click dblclick " + + "mousedown mouseup mousemove mouseover mouseout mouseenter mouseleave " + + "change select submit keydown keypress keyup contextmenu" ).split( " " ), + function( i, name ) { + + // Handle event binding + jQuery.fn[ name ] = function( data, fn ) { + return arguments.length > 0 ? + this.on( name, null, data, fn ) : + this.trigger( name ); + }; +} ); + +jQuery.fn.extend( { + hover: function( fnOver, fnOut ) { + return this.mouseenter( fnOver ).mouseleave( fnOut || fnOver ); + } +} ); + + + + +support.focusin = "onfocusin" in window; + + +// Support: Firefox <=44 +// Firefox doesn't have focus(in | out) events +// Related ticket - https://bugzilla.mozilla.org/show_bug.cgi?id=687787 +// +// Support: Chrome <=48 - 49, Safari <=9.0 - 9.1 +// focus(in | out) events fire after focus & blur events, +// which is spec violation - http://www.w3.org/TR/DOM-Level-3-Events/#events-focusevent-event-order +// Related ticket - https://bugs.chromium.org/p/chromium/issues/detail?id=449857 +if ( !support.focusin ) { + jQuery.each( { focus: "focusin", blur: "focusout" }, function( orig, fix ) { + + // Attach a single capturing handler on the document while someone wants focusin/focusout + var handler = function( event ) { + jQuery.event.simulate( fix, event.target, jQuery.event.fix( event ) ); + }; + + jQuery.event.special[ fix ] = { + setup: function() { + var doc = this.ownerDocument || this, + attaches = dataPriv.access( doc, fix ); + + if ( !attaches ) { + doc.addEventListener( orig, handler, true ); + } + dataPriv.access( doc, fix, ( attaches || 0 ) + 1 ); + }, + teardown: function() { + var doc = this.ownerDocument || this, + attaches = dataPriv.access( doc, fix ) - 1; + + if ( !attaches ) { + doc.removeEventListener( orig, handler, true ); + dataPriv.remove( doc, fix ); + + } else { + dataPriv.access( doc, fix, attaches ); + } + } + }; + } ); +} +var location = window.location; + +var nonce = jQuery.now(); + +var rquery = ( /\?/ ); + + + +// Cross-browser xml parsing +jQuery.parseXML = function( data ) { + var xml; + if ( !data || typeof data !== "string" ) { + return null; + } + + // Support: IE 9 - 11 only + // IE throws on parseFromString with invalid input. + try { + xml = ( new window.DOMParser() ).parseFromString( data, "text/xml" ); + } catch ( e ) { + xml = undefined; + } + + if ( !xml || xml.getElementsByTagName( "parsererror" ).length ) { + jQuery.error( "Invalid XML: " + data ); + } + return xml; +}; + + +var + rbracket = /\[\]$/, + rCRLF = /\r?\n/g, + rsubmitterTypes = /^(?:submit|button|image|reset|file)$/i, + rsubmittable = /^(?:input|select|textarea|keygen)/i; + +function buildParams( prefix, obj, traditional, add ) { + var name; + + if ( jQuery.isArray( obj ) ) { + + // Serialize array item. + jQuery.each( obj, function( i, v ) { + if ( traditional || rbracket.test( prefix ) ) { + + // Treat each array item as a scalar. + add( prefix, v ); + + } else { + + // Item is non-scalar (array or object), encode its numeric index. + buildParams( + prefix + "[" + ( typeof v === "object" && v != null ? i : "" ) + "]", + v, + traditional, + add + ); + } + } ); + + } else if ( !traditional && jQuery.type( obj ) === "object" ) { + + // Serialize object item. + for ( name in obj ) { + buildParams( prefix + "[" + name + "]", obj[ name ], traditional, add ); + } + + } else { + + // Serialize scalar item. + add( prefix, obj ); + } +} + +// Serialize an array of form elements or a set of +// key/values into a query string +jQuery.param = function( a, traditional ) { + var prefix, + s = [], + add = function( key, valueOrFunction ) { + + // If value is a function, invoke it and use its return value + var value = jQuery.isFunction( valueOrFunction ) ? + valueOrFunction() : + valueOrFunction; + + s[ s.length ] = encodeURIComponent( key ) + "=" + + encodeURIComponent( value == null ? "" : value ); + }; + + // If an array was passed in, assume that it is an array of form elements. + if ( jQuery.isArray( a ) || ( a.jquery && !jQuery.isPlainObject( a ) ) ) { + + // Serialize the form elements + jQuery.each( a, function() { + add( this.name, this.value ); + } ); + + } else { + + // If traditional, encode the "old" way (the way 1.3.2 or older + // did it), otherwise encode params recursively. + for ( prefix in a ) { + buildParams( prefix, a[ prefix ], traditional, add ); + } + } + + // Return the resulting serialization + return s.join( "&" ); +}; + +jQuery.fn.extend( { + serialize: function() { + return jQuery.param( this.serializeArray() ); + }, + serializeArray: function() { + return this.map( function() { + + // Can add propHook for "elements" to filter or add form elements + var elements = jQuery.prop( this, "elements" ); + return elements ? jQuery.makeArray( elements ) : this; + } ) + .filter( function() { + var type = this.type; + + // Use .is( ":disabled" ) so that fieldset[disabled] works + return this.name && !jQuery( this ).is( ":disabled" ) && + rsubmittable.test( this.nodeName ) && !rsubmitterTypes.test( type ) && + ( this.checked || !rcheckableType.test( type ) ); + } ) + .map( function( i, elem ) { + var val = jQuery( this ).val(); + + return val == null ? + null : + jQuery.isArray( val ) ? + jQuery.map( val, function( val ) { + return { name: elem.name, value: val.replace( rCRLF, "\r\n" ) }; + } ) : + { name: elem.name, value: val.replace( rCRLF, "\r\n" ) }; + } ).get(); + } +} ); + + +var + r20 = /%20/g, + rhash = /#.*$/, + rts = /([?&])_=[^&]*/, + rheaders = /^(.*?):[ \t]*([^\r\n]*)$/mg, + + // #7653, #8125, #8152: local protocol detection + rlocalProtocol = /^(?:about|app|app-storage|.+-extension|file|res|widget):$/, + rnoContent = /^(?:GET|HEAD)$/, + rprotocol = /^\/\//, + + /* Prefilters + * 1) They are useful to introduce custom dataTypes (see ajax/jsonp.js for an example) + * 2) These are called: + * - BEFORE asking for a transport + * - AFTER param serialization (s.data is a string if s.processData is true) + * 3) key is the dataType + * 4) the catchall symbol "*" can be used + * 5) execution will start with transport dataType and THEN continue down to "*" if needed + */ + prefilters = {}, + + /* Transports bindings + * 1) key is the dataType + * 2) the catchall symbol "*" can be used + * 3) selection will start with transport dataType and THEN go to "*" if needed + */ + transports = {}, + + // Avoid comment-prolog char sequence (#10098); must appease lint and evade compression + allTypes = "*/".concat( "*" ), + + // Anchor tag for parsing the document origin + originAnchor = document.createElement( "a" ); + originAnchor.href = location.href; + +// Base "constructor" for jQuery.ajaxPrefilter and jQuery.ajaxTransport +function addToPrefiltersOrTransports( structure ) { + + // dataTypeExpression is optional and defaults to "*" + return function( dataTypeExpression, func ) { + + if ( typeof dataTypeExpression !== "string" ) { + func = dataTypeExpression; + dataTypeExpression = "*"; + } + + var dataType, + i = 0, + dataTypes = dataTypeExpression.toLowerCase().match( rnotwhite ) || []; + + if ( jQuery.isFunction( func ) ) { + + // For each dataType in the dataTypeExpression + while ( ( dataType = dataTypes[ i++ ] ) ) { + + // Prepend if requested + if ( dataType[ 0 ] === "+" ) { + dataType = dataType.slice( 1 ) || "*"; + ( structure[ dataType ] = structure[ dataType ] || [] ).unshift( func ); + + // Otherwise append + } else { + ( structure[ dataType ] = structure[ dataType ] || [] ).push( func ); + } + } + } + }; +} + +// Base inspection function for prefilters and transports +function inspectPrefiltersOrTransports( structure, options, originalOptions, jqXHR ) { + + var inspected = {}, + seekingTransport = ( structure === transports ); + + function inspect( dataType ) { + var selected; + inspected[ dataType ] = true; + jQuery.each( structure[ dataType ] || [], function( _, prefilterOrFactory ) { + var dataTypeOrTransport = prefilterOrFactory( options, originalOptions, jqXHR ); + if ( typeof dataTypeOrTransport === "string" && + !seekingTransport && !inspected[ dataTypeOrTransport ] ) { + + options.dataTypes.unshift( dataTypeOrTransport ); + inspect( dataTypeOrTransport ); + return false; + } else if ( seekingTransport ) { + return !( selected = dataTypeOrTransport ); + } + } ); + return selected; + } + + return inspect( options.dataTypes[ 0 ] ) || !inspected[ "*" ] && inspect( "*" ); +} + +// A special extend for ajax options +// that takes "flat" options (not to be deep extended) +// Fixes #9887 +function ajaxExtend( target, src ) { + var key, deep, + flatOptions = jQuery.ajaxSettings.flatOptions || {}; + + for ( key in src ) { + if ( src[ key ] !== undefined ) { + ( flatOptions[ key ] ? target : ( deep || ( deep = {} ) ) )[ key ] = src[ key ]; + } + } + if ( deep ) { + jQuery.extend( true, target, deep ); + } + + return target; +} + +/* Handles responses to an ajax request: + * - finds the right dataType (mediates between content-type and expected dataType) + * - returns the corresponding response + */ +function ajaxHandleResponses( s, jqXHR, responses ) { + + var ct, type, finalDataType, firstDataType, + contents = s.contents, + dataTypes = s.dataTypes; + + // Remove auto dataType and get content-type in the process + while ( dataTypes[ 0 ] === "*" ) { + dataTypes.shift(); + if ( ct === undefined ) { + ct = s.mimeType || jqXHR.getResponseHeader( "Content-Type" ); + } + } + + // Check if we're dealing with a known content-type + if ( ct ) { + for ( type in contents ) { + if ( contents[ type ] && contents[ type ].test( ct ) ) { + dataTypes.unshift( type ); + break; + } + } + } + + // Check to see if we have a response for the expected dataType + if ( dataTypes[ 0 ] in responses ) { + finalDataType = dataTypes[ 0 ]; + } else { + + // Try convertible dataTypes + for ( type in responses ) { + if ( !dataTypes[ 0 ] || s.converters[ type + " " + dataTypes[ 0 ] ] ) { + finalDataType = type; + break; + } + if ( !firstDataType ) { + firstDataType = type; + } + } + + // Or just use first one + finalDataType = finalDataType || firstDataType; + } + + // If we found a dataType + // We add the dataType to the list if needed + // and return the corresponding response + if ( finalDataType ) { + if ( finalDataType !== dataTypes[ 0 ] ) { + dataTypes.unshift( finalDataType ); + } + return responses[ finalDataType ]; + } +} + +/* Chain conversions given the request and the original response + * Also sets the responseXXX fields on the jqXHR instance + */ +function ajaxConvert( s, response, jqXHR, isSuccess ) { + var conv2, current, conv, tmp, prev, + converters = {}, + + // Work with a copy of dataTypes in case we need to modify it for conversion + dataTypes = s.dataTypes.slice(); + + // Create converters map with lowercased keys + if ( dataTypes[ 1 ] ) { + for ( conv in s.converters ) { + converters[ conv.toLowerCase() ] = s.converters[ conv ]; + } + } + + current = dataTypes.shift(); + + // Convert to each sequential dataType + while ( current ) { + + if ( s.responseFields[ current ] ) { + jqXHR[ s.responseFields[ current ] ] = response; + } + + // Apply the dataFilter if provided + if ( !prev && isSuccess && s.dataFilter ) { + response = s.dataFilter( response, s.dataType ); + } + + prev = current; + current = dataTypes.shift(); + + if ( current ) { + + // There's only work to do if current dataType is non-auto + if ( current === "*" ) { + + current = prev; + + // Convert response if prev dataType is non-auto and differs from current + } else if ( prev !== "*" && prev !== current ) { + + // Seek a direct converter + conv = converters[ prev + " " + current ] || converters[ "* " + current ]; + + // If none found, seek a pair + if ( !conv ) { + for ( conv2 in converters ) { + + // If conv2 outputs current + tmp = conv2.split( " " ); + if ( tmp[ 1 ] === current ) { + + // If prev can be converted to accepted input + conv = converters[ prev + " " + tmp[ 0 ] ] || + converters[ "* " + tmp[ 0 ] ]; + if ( conv ) { + + // Condense equivalence converters + if ( conv === true ) { + conv = converters[ conv2 ]; + + // Otherwise, insert the intermediate dataType + } else if ( converters[ conv2 ] !== true ) { + current = tmp[ 0 ]; + dataTypes.unshift( tmp[ 1 ] ); + } + break; + } + } + } + } + + // Apply converter (if not an equivalence) + if ( conv !== true ) { + + // Unless errors are allowed to bubble, catch and return them + if ( conv && s.throws ) { + response = conv( response ); + } else { + try { + response = conv( response ); + } catch ( e ) { + return { + state: "parsererror", + error: conv ? e : "No conversion from " + prev + " to " + current + }; + } + } + } + } + } + } + + return { state: "success", data: response }; +} + +jQuery.extend( { + + // Counter for holding the number of active queries + active: 0, + + // Last-Modified header cache for next request + lastModified: {}, + etag: {}, + + ajaxSettings: { + url: location.href, + type: "GET", + isLocal: rlocalProtocol.test( location.protocol ), + global: true, + processData: true, + async: true, + contentType: "application/x-www-form-urlencoded; charset=UTF-8", + + /* + timeout: 0, + data: null, + dataType: null, + username: null, + password: null, + cache: null, + throws: false, + traditional: false, + headers: {}, + */ + + accepts: { + "*": allTypes, + text: "text/plain", + html: "text/html", + xml: "application/xml, text/xml", + json: "application/json, text/javascript" + }, + + contents: { + xml: /\bxml\b/, + html: /\bhtml/, + json: /\bjson\b/ + }, + + responseFields: { + xml: "responseXML", + text: "responseText", + json: "responseJSON" + }, + + // Data converters + // Keys separate source (or catchall "*") and destination types with a single space + converters: { + + // Convert anything to text + "* text": String, + + // Text to html (true = no transformation) + "text html": true, + + // Evaluate text as a json expression + "text json": JSON.parse, + + // Parse text as xml + "text xml": jQuery.parseXML + }, + + // For options that shouldn't be deep extended: + // you can add your own custom options here if + // and when you create one that shouldn't be + // deep extended (see ajaxExtend) + flatOptions: { + url: true, + context: true + } + }, + + // Creates a full fledged settings object into target + // with both ajaxSettings and settings fields. + // If target is omitted, writes into ajaxSettings. + ajaxSetup: function( target, settings ) { + return settings ? + + // Building a settings object + ajaxExtend( ajaxExtend( target, jQuery.ajaxSettings ), settings ) : + + // Extending ajaxSettings + ajaxExtend( jQuery.ajaxSettings, target ); + }, + + ajaxPrefilter: addToPrefiltersOrTransports( prefilters ), + ajaxTransport: addToPrefiltersOrTransports( transports ), + + // Main method + ajax: function( url, options ) { + + // If url is an object, simulate pre-1.5 signature + if ( typeof url === "object" ) { + options = url; + url = undefined; + } + + // Force options to be an object + options = options || {}; + + var transport, + + // URL without anti-cache param + cacheURL, + + // Response headers + responseHeadersString, + responseHeaders, + + // timeout handle + timeoutTimer, + + // Url cleanup var + urlAnchor, + + // Request state (becomes false upon send and true upon completion) + completed, + + // To know if global events are to be dispatched + fireGlobals, + + // Loop variable + i, + + // uncached part of the url + uncached, + + // Create the final options object + s = jQuery.ajaxSetup( {}, options ), + + // Callbacks context + callbackContext = s.context || s, + + // Context for global events is callbackContext if it is a DOM node or jQuery collection + globalEventContext = s.context && + ( callbackContext.nodeType || callbackContext.jquery ) ? + jQuery( callbackContext ) : + jQuery.event, + + // Deferreds + deferred = jQuery.Deferred(), + completeDeferred = jQuery.Callbacks( "once memory" ), + + // Status-dependent callbacks + statusCode = s.statusCode || {}, + + // Headers (they are sent all at once) + requestHeaders = {}, + requestHeadersNames = {}, + + // Default abort message + strAbort = "canceled", + + // Fake xhr + jqXHR = { + readyState: 0, + + // Builds headers hashtable if needed + getResponseHeader: function( key ) { + var match; + if ( completed ) { + if ( !responseHeaders ) { + responseHeaders = {}; + while ( ( match = rheaders.exec( responseHeadersString ) ) ) { + responseHeaders[ match[ 1 ].toLowerCase() ] = match[ 2 ]; + } + } + match = responseHeaders[ key.toLowerCase() ]; + } + return match == null ? null : match; + }, + + // Raw string + getAllResponseHeaders: function() { + return completed ? responseHeadersString : null; + }, + + // Caches the header + setRequestHeader: function( name, value ) { + if ( completed == null ) { + name = requestHeadersNames[ name.toLowerCase() ] = + requestHeadersNames[ name.toLowerCase() ] || name; + requestHeaders[ name ] = value; + } + return this; + }, + + // Overrides response content-type header + overrideMimeType: function( type ) { + if ( completed == null ) { + s.mimeType = type; + } + return this; + }, + + // Status-dependent callbacks + statusCode: function( map ) { + var code; + if ( map ) { + if ( completed ) { + + // Execute the appropriate callbacks + jqXHR.always( map[ jqXHR.status ] ); + } else { + + // Lazy-add the new callbacks in a way that preserves old ones + for ( code in map ) { + statusCode[ code ] = [ statusCode[ code ], map[ code ] ]; + } + } + } + return this; + }, + + // Cancel the request + abort: function( statusText ) { + var finalText = statusText || strAbort; + if ( transport ) { + transport.abort( finalText ); + } + done( 0, finalText ); + return this; + } + }; + + // Attach deferreds + deferred.promise( jqXHR ); + + // Add protocol if not provided (prefilters might expect it) + // Handle falsy url in the settings object (#10093: consistency with old signature) + // We also use the url parameter if available + s.url = ( ( url || s.url || location.href ) + "" ) + .replace( rprotocol, location.protocol + "//" ); + + // Alias method option to type as per ticket #12004 + s.type = options.method || options.type || s.method || s.type; + + // Extract dataTypes list + s.dataTypes = ( s.dataType || "*" ).toLowerCase().match( rnotwhite ) || [ "" ]; + + // A cross-domain request is in order when the origin doesn't match the current origin. + if ( s.crossDomain == null ) { + urlAnchor = document.createElement( "a" ); + + // Support: IE <=8 - 11, Edge 12 - 13 + // IE throws exception on accessing the href property if url is malformed, + // e.g. http://example.com:80x/ + try { + urlAnchor.href = s.url; + + // Support: IE <=8 - 11 only + // Anchor's host property isn't correctly set when s.url is relative + urlAnchor.href = urlAnchor.href; + s.crossDomain = originAnchor.protocol + "//" + originAnchor.host !== + urlAnchor.protocol + "//" + urlAnchor.host; + } catch ( e ) { + + // If there is an error parsing the URL, assume it is crossDomain, + // it can be rejected by the transport if it is invalid + s.crossDomain = true; + } + } + + // Convert data if not already a string + if ( s.data && s.processData && typeof s.data !== "string" ) { + s.data = jQuery.param( s.data, s.traditional ); + } + + // Apply prefilters + inspectPrefiltersOrTransports( prefilters, s, options, jqXHR ); + + // If request was aborted inside a prefilter, stop there + if ( completed ) { + return jqXHR; + } + + // We can fire global events as of now if asked to + // Don't fire events if jQuery.event is undefined in an AMD-usage scenario (#15118) + fireGlobals = jQuery.event && s.global; + + // Watch for a new set of requests + if ( fireGlobals && jQuery.active++ === 0 ) { + jQuery.event.trigger( "ajaxStart" ); + } + + // Uppercase the type + s.type = s.type.toUpperCase(); + + // Determine if request has content + s.hasContent = !rnoContent.test( s.type ); + + // Save the URL in case we're toying with the If-Modified-Since + // and/or If-None-Match header later on + // Remove hash to simplify url manipulation + cacheURL = s.url.replace( rhash, "" ); + + // More options handling for requests with no content + if ( !s.hasContent ) { + + // Remember the hash so we can put it back + uncached = s.url.slice( cacheURL.length ); + + // If data is available, append data to url + if ( s.data ) { + cacheURL += ( rquery.test( cacheURL ) ? "&" : "?" ) + s.data; + + // #9682: remove data so that it's not used in an eventual retry + delete s.data; + } + + // Add anti-cache in uncached url if needed + if ( s.cache === false ) { + cacheURL = cacheURL.replace( rts, "" ); + uncached = ( rquery.test( cacheURL ) ? "&" : "?" ) + "_=" + ( nonce++ ) + uncached; + } + + // Put hash and anti-cache on the URL that will be requested (gh-1732) + s.url = cacheURL + uncached; + + // Change '%20' to '+' if this is encoded form body content (gh-2658) + } else if ( s.data && s.processData && + ( s.contentType || "" ).indexOf( "application/x-www-form-urlencoded" ) === 0 ) { + s.data = s.data.replace( r20, "+" ); + } + + // Set the If-Modified-Since and/or If-None-Match header, if in ifModified mode. + if ( s.ifModified ) { + if ( jQuery.lastModified[ cacheURL ] ) { + jqXHR.setRequestHeader( "If-Modified-Since", jQuery.lastModified[ cacheURL ] ); + } + if ( jQuery.etag[ cacheURL ] ) { + jqXHR.setRequestHeader( "If-None-Match", jQuery.etag[ cacheURL ] ); + } + } + + // Set the correct header, if data is being sent + if ( s.data && s.hasContent && s.contentType !== false || options.contentType ) { + jqXHR.setRequestHeader( "Content-Type", s.contentType ); + } + + // Set the Accepts header for the server, depending on the dataType + jqXHR.setRequestHeader( + "Accept", + s.dataTypes[ 0 ] && s.accepts[ s.dataTypes[ 0 ] ] ? + s.accepts[ s.dataTypes[ 0 ] ] + + ( s.dataTypes[ 0 ] !== "*" ? ", " + allTypes + "; q=0.01" : "" ) : + s.accepts[ "*" ] + ); + + // Check for headers option + for ( i in s.headers ) { + jqXHR.setRequestHeader( i, s.headers[ i ] ); + } + + // Allow custom headers/mimetypes and early abort + if ( s.beforeSend && + ( s.beforeSend.call( callbackContext, jqXHR, s ) === false || completed ) ) { + + // Abort if not done already and return + return jqXHR.abort(); + } + + // Aborting is no longer a cancellation + strAbort = "abort"; + + // Install callbacks on deferreds + completeDeferred.add( s.complete ); + jqXHR.done( s.success ); + jqXHR.fail( s.error ); + + // Get transport + transport = inspectPrefiltersOrTransports( transports, s, options, jqXHR ); + + // If no transport, we auto-abort + if ( !transport ) { + done( -1, "No Transport" ); + } else { + jqXHR.readyState = 1; + + // Send global event + if ( fireGlobals ) { + globalEventContext.trigger( "ajaxSend", [ jqXHR, s ] ); + } + + // If request was aborted inside ajaxSend, stop there + if ( completed ) { + return jqXHR; + } + + // Timeout + if ( s.async && s.timeout > 0 ) { + timeoutTimer = window.setTimeout( function() { + jqXHR.abort( "timeout" ); + }, s.timeout ); + } + + try { + completed = false; + transport.send( requestHeaders, done ); + } catch ( e ) { + + // Rethrow post-completion exceptions + if ( completed ) { + throw e; + } + + // Propagate others as results + done( -1, e ); + } + } + + // Callback for when everything is done + function done( status, nativeStatusText, responses, headers ) { + var isSuccess, success, error, response, modified, + statusText = nativeStatusText; + + // Ignore repeat invocations + if ( completed ) { + return; + } + + completed = true; + + // Clear timeout if it exists + if ( timeoutTimer ) { + window.clearTimeout( timeoutTimer ); + } + + // Dereference transport for early garbage collection + // (no matter how long the jqXHR object will be used) + transport = undefined; + + // Cache response headers + responseHeadersString = headers || ""; + + // Set readyState + jqXHR.readyState = status > 0 ? 4 : 0; + + // Determine if successful + isSuccess = status >= 200 && status < 300 || status === 304; + + // Get response data + if ( responses ) { + response = ajaxHandleResponses( s, jqXHR, responses ); + } + + // Convert no matter what (that way responseXXX fields are always set) + response = ajaxConvert( s, response, jqXHR, isSuccess ); + + // If successful, handle type chaining + if ( isSuccess ) { + + // Set the If-Modified-Since and/or If-None-Match header, if in ifModified mode. + if ( s.ifModified ) { + modified = jqXHR.getResponseHeader( "Last-Modified" ); + if ( modified ) { + jQuery.lastModified[ cacheURL ] = modified; + } + modified = jqXHR.getResponseHeader( "etag" ); + if ( modified ) { + jQuery.etag[ cacheURL ] = modified; + } + } + + // if no content + if ( status === 204 || s.type === "HEAD" ) { + statusText = "nocontent"; + + // if not modified + } else if ( status === 304 ) { + statusText = "notmodified"; + + // If we have data, let's convert it + } else { + statusText = response.state; + success = response.data; + error = response.error; + isSuccess = !error; + } + } else { + + // Extract error from statusText and normalize for non-aborts + error = statusText; + if ( status || !statusText ) { + statusText = "error"; + if ( status < 0 ) { + status = 0; + } + } + } + + // Set data for the fake xhr object + jqXHR.status = status; + jqXHR.statusText = ( nativeStatusText || statusText ) + ""; + + // Success/Error + if ( isSuccess ) { + deferred.resolveWith( callbackContext, [ success, statusText, jqXHR ] ); + } else { + deferred.rejectWith( callbackContext, [ jqXHR, statusText, error ] ); + } + + // Status-dependent callbacks + jqXHR.statusCode( statusCode ); + statusCode = undefined; + + if ( fireGlobals ) { + globalEventContext.trigger( isSuccess ? "ajaxSuccess" : "ajaxError", + [ jqXHR, s, isSuccess ? success : error ] ); + } + + // Complete + completeDeferred.fireWith( callbackContext, [ jqXHR, statusText ] ); + + if ( fireGlobals ) { + globalEventContext.trigger( "ajaxComplete", [ jqXHR, s ] ); + + // Handle the global AJAX counter + if ( !( --jQuery.active ) ) { + jQuery.event.trigger( "ajaxStop" ); + } + } + } + + return jqXHR; + }, + + getJSON: function( url, data, callback ) { + return jQuery.get( url, data, callback, "json" ); + }, + + getScript: function( url, callback ) { + return jQuery.get( url, undefined, callback, "script" ); + } +} ); + +jQuery.each( [ "get", "post" ], function( i, method ) { + jQuery[ method ] = function( url, data, callback, type ) { + + // Shift arguments if data argument was omitted + if ( jQuery.isFunction( data ) ) { + type = type || callback; + callback = data; + data = undefined; + } + + // The url can be an options object (which then must have .url) + return jQuery.ajax( jQuery.extend( { + url: url, + type: method, + dataType: type, + data: data, + success: callback + }, jQuery.isPlainObject( url ) && url ) ); + }; +} ); + + +jQuery._evalUrl = function( url ) { + return jQuery.ajax( { + url: url, + + // Make this explicit, since user can override this through ajaxSetup (#11264) + type: "GET", + dataType: "script", + cache: true, + async: false, + global: false, + "throws": true + } ); +}; + + +jQuery.fn.extend( { + wrapAll: function( html ) { + var wrap; + + if ( this[ 0 ] ) { + if ( jQuery.isFunction( html ) ) { + html = html.call( this[ 0 ] ); + } + + // The elements to wrap the target around + wrap = jQuery( html, this[ 0 ].ownerDocument ).eq( 0 ).clone( true ); + + if ( this[ 0 ].parentNode ) { + wrap.insertBefore( this[ 0 ] ); + } + + wrap.map( function() { + var elem = this; + + while ( elem.firstElementChild ) { + elem = elem.firstElementChild; + } + + return elem; + } ).append( this ); + } + + return this; + }, + + wrapInner: function( html ) { + if ( jQuery.isFunction( html ) ) { + return this.each( function( i ) { + jQuery( this ).wrapInner( html.call( this, i ) ); + } ); + } + + return this.each( function() { + var self = jQuery( this ), + contents = self.contents(); + + if ( contents.length ) { + contents.wrapAll( html ); + + } else { + self.append( html ); + } + } ); + }, + + wrap: function( html ) { + var isFunction = jQuery.isFunction( html ); + + return this.each( function( i ) { + jQuery( this ).wrapAll( isFunction ? html.call( this, i ) : html ); + } ); + }, + + unwrap: function( selector ) { + this.parent( selector ).not( "body" ).each( function() { + jQuery( this ).replaceWith( this.childNodes ); + } ); + return this; + } +} ); + + +jQuery.expr.pseudos.hidden = function( elem ) { + return !jQuery.expr.pseudos.visible( elem ); +}; +jQuery.expr.pseudos.visible = function( elem ) { + return !!( elem.offsetWidth || elem.offsetHeight || elem.getClientRects().length ); +}; + + + + +jQuery.ajaxSettings.xhr = function() { + try { + return new window.XMLHttpRequest(); + } catch ( e ) {} +}; + +var xhrSuccessStatus = { + + // File protocol always yields status code 0, assume 200 + 0: 200, + + // Support: IE <=9 only + // #1450: sometimes IE returns 1223 when it should be 204 + 1223: 204 + }, + xhrSupported = jQuery.ajaxSettings.xhr(); + +support.cors = !!xhrSupported && ( "withCredentials" in xhrSupported ); +support.ajax = xhrSupported = !!xhrSupported; + +jQuery.ajaxTransport( function( options ) { + var callback, errorCallback; + + // Cross domain only allowed if supported through XMLHttpRequest + if ( support.cors || xhrSupported && !options.crossDomain ) { + return { + send: function( headers, complete ) { + var i, + xhr = options.xhr(); + + xhr.open( + options.type, + options.url, + options.async, + options.username, + options.password + ); + + // Apply custom fields if provided + if ( options.xhrFields ) { + for ( i in options.xhrFields ) { + xhr[ i ] = options.xhrFields[ i ]; + } + } + + // Override mime type if needed + if ( options.mimeType && xhr.overrideMimeType ) { + xhr.overrideMimeType( options.mimeType ); + } + + // X-Requested-With header + // For cross-domain requests, seeing as conditions for a preflight are + // akin to a jigsaw puzzle, we simply never set it to be sure. + // (it can always be set on a per-request basis or even using ajaxSetup) + // For same-domain requests, won't change header if already provided. + if ( !options.crossDomain && !headers[ "X-Requested-With" ] ) { + headers[ "X-Requested-With" ] = "XMLHttpRequest"; + } + + // Set headers + for ( i in headers ) { + xhr.setRequestHeader( i, headers[ i ] ); + } + + // Callback + callback = function( type ) { + return function() { + if ( callback ) { + callback = errorCallback = xhr.onload = + xhr.onerror = xhr.onabort = xhr.onreadystatechange = null; + + if ( type === "abort" ) { + xhr.abort(); + } else if ( type === "error" ) { + + // Support: IE <=9 only + // On a manual native abort, IE9 throws + // errors on any property access that is not readyState + if ( typeof xhr.status !== "number" ) { + complete( 0, "error" ); + } else { + complete( + + // File: protocol always yields status 0; see #8605, #14207 + xhr.status, + xhr.statusText + ); + } + } else { + complete( + xhrSuccessStatus[ xhr.status ] || xhr.status, + xhr.statusText, + + // Support: IE <=9 only + // IE9 has no XHR2 but throws on binary (trac-11426) + // For XHR2 non-text, let the caller handle it (gh-2498) + ( xhr.responseType || "text" ) !== "text" || + typeof xhr.responseText !== "string" ? + { binary: xhr.response } : + { text: xhr.responseText }, + xhr.getAllResponseHeaders() + ); + } + } + }; + }; + + // Listen to events + xhr.onload = callback(); + errorCallback = xhr.onerror = callback( "error" ); + + // Support: IE 9 only + // Use onreadystatechange to replace onabort + // to handle uncaught aborts + if ( xhr.onabort !== undefined ) { + xhr.onabort = errorCallback; + } else { + xhr.onreadystatechange = function() { + + // Check readyState before timeout as it changes + if ( xhr.readyState === 4 ) { + + // Allow onerror to be called first, + // but that will not handle a native abort + // Also, save errorCallback to a variable + // as xhr.onerror cannot be accessed + window.setTimeout( function() { + if ( callback ) { + errorCallback(); + } + } ); + } + }; + } + + // Create the abort callback + callback = callback( "abort" ); + + try { + + // Do send the request (this may raise an exception) + xhr.send( options.hasContent && options.data || null ); + } catch ( e ) { + + // #14683: Only rethrow if this hasn't been notified as an error yet + if ( callback ) { + throw e; + } + } + }, + + abort: function() { + if ( callback ) { + callback(); + } + } + }; + } +} ); + + + + +// Prevent auto-execution of scripts when no explicit dataType was provided (See gh-2432) +jQuery.ajaxPrefilter( function( s ) { + if ( s.crossDomain ) { + s.contents.script = false; + } +} ); + +// Install script dataType +jQuery.ajaxSetup( { + accepts: { + script: "text/javascript, application/javascript, " + + "application/ecmascript, application/x-ecmascript" + }, + contents: { + script: /\b(?:java|ecma)script\b/ + }, + converters: { + "text script": function( text ) { + jQuery.globalEval( text ); + return text; + } + } +} ); + +// Handle cache's special case and crossDomain +jQuery.ajaxPrefilter( "script", function( s ) { + if ( s.cache === undefined ) { + s.cache = false; + } + if ( s.crossDomain ) { + s.type = "GET"; + } +} ); + +// Bind script tag hack transport +jQuery.ajaxTransport( "script", function( s ) { + + // This transport only deals with cross domain requests + if ( s.crossDomain ) { + var script, callback; + return { + send: function( _, complete ) { + script = jQuery( "<script>" ).prop( { + charset: s.scriptCharset, + src: s.url + } ).on( + "load error", + callback = function( evt ) { + script.remove(); + callback = null; + if ( evt ) { + complete( evt.type === "error" ? 404 : 200, evt.type ); + } + } + ); + + // Use native DOM manipulation to avoid our domManip AJAX trickery + document.head.appendChild( script[ 0 ] ); + }, + abort: function() { + if ( callback ) { + callback(); + } + } + }; + } +} ); + + + + +var oldCallbacks = [], + rjsonp = /(=)\?(?=&|$)|\?\?/; + +// Default jsonp settings +jQuery.ajaxSetup( { + jsonp: "callback", + jsonpCallback: function() { + var callback = oldCallbacks.pop() || ( jQuery.expando + "_" + ( nonce++ ) ); + this[ callback ] = true; + return callback; + } +} ); + +// Detect, normalize options and install callbacks for jsonp requests +jQuery.ajaxPrefilter( "json jsonp", function( s, originalSettings, jqXHR ) { + + var callbackName, overwritten, responseContainer, + jsonProp = s.jsonp !== false && ( rjsonp.test( s.url ) ? + "url" : + typeof s.data === "string" && + ( s.contentType || "" ) + .indexOf( "application/x-www-form-urlencoded" ) === 0 && + rjsonp.test( s.data ) && "data" + ); + + // Handle iff the expected data type is "jsonp" or we have a parameter to set + if ( jsonProp || s.dataTypes[ 0 ] === "jsonp" ) { + + // Get callback name, remembering preexisting value associated with it + callbackName = s.jsonpCallback = jQuery.isFunction( s.jsonpCallback ) ? + s.jsonpCallback() : + s.jsonpCallback; + + // Insert callback into url or form data + if ( jsonProp ) { + s[ jsonProp ] = s[ jsonProp ].replace( rjsonp, "$1" + callbackName ); + } else if ( s.jsonp !== false ) { + s.url += ( rquery.test( s.url ) ? "&" : "?" ) + s.jsonp + "=" + callbackName; + } + + // Use data converter to retrieve json after script execution + s.converters[ "script json" ] = function() { + if ( !responseContainer ) { + jQuery.error( callbackName + " was not called" ); + } + return responseContainer[ 0 ]; + }; + + // Force json dataType + s.dataTypes[ 0 ] = "json"; + + // Install callback + overwritten = window[ callbackName ]; + window[ callbackName ] = function() { + responseContainer = arguments; + }; + + // Clean-up function (fires after converters) + jqXHR.always( function() { + + // If previous value didn't exist - remove it + if ( overwritten === undefined ) { + jQuery( window ).removeProp( callbackName ); + + // Otherwise restore preexisting value + } else { + window[ callbackName ] = overwritten; + } + + // Save back as free + if ( s[ callbackName ] ) { + + // Make sure that re-using the options doesn't screw things around + s.jsonpCallback = originalSettings.jsonpCallback; + + // Save the callback name for future use + oldCallbacks.push( callbackName ); + } + + // Call if it was a function and we have a response + if ( responseContainer && jQuery.isFunction( overwritten ) ) { + overwritten( responseContainer[ 0 ] ); + } + + responseContainer = overwritten = undefined; + } ); + + // Delegate to script + return "script"; + } +} ); + + + + +// Support: Safari 8 only +// In Safari 8 documents created via document.implementation.createHTMLDocument +// collapse sibling forms: the second one becomes a child of the first one. +// Because of that, this security measure has to be disabled in Safari 8. +// https://bugs.webkit.org/show_bug.cgi?id=137337 +support.createHTMLDocument = ( function() { + var body = document.implementation.createHTMLDocument( "" ).body; + body.innerHTML = "<form></form><form></form>"; + return body.childNodes.length === 2; +} )(); + + +// Argument "data" should be string of html +// context (optional): If specified, the fragment will be created in this context, +// defaults to document +// keepScripts (optional): If true, will include scripts passed in the html string +jQuery.parseHTML = function( data, context, keepScripts ) { + if ( typeof data !== "string" ) { + return []; + } + if ( typeof context === "boolean" ) { + keepScripts = context; + context = false; + } + + var base, parsed, scripts; + + if ( !context ) { + + // Stop scripts or inline event handlers from being executed immediately + // by using document.implementation + if ( support.createHTMLDocument ) { + context = document.implementation.createHTMLDocument( "" ); + + // Set the base href for the created document + // so any parsed elements with URLs + // are based on the document's URL (gh-2965) + base = context.createElement( "base" ); + base.href = document.location.href; + context.head.appendChild( base ); + } else { + context = document; + } + } + + parsed = rsingleTag.exec( data ); + scripts = !keepScripts && []; + + // Single tag + if ( parsed ) { + return [ context.createElement( parsed[ 1 ] ) ]; + } + + parsed = buildFragment( [ data ], context, scripts ); + + if ( scripts && scripts.length ) { + jQuery( scripts ).remove(); + } + + return jQuery.merge( [], parsed.childNodes ); +}; + + +/** + * Load a url into a page + */ +jQuery.fn.load = function( url, params, callback ) { + var selector, type, response, + self = this, + off = url.indexOf( " " ); + + if ( off > -1 ) { + selector = jQuery.trim( url.slice( off ) ); + url = url.slice( 0, off ); + } + + // If it's a function + if ( jQuery.isFunction( params ) ) { + + // We assume that it's the callback + callback = params; + params = undefined; + + // Otherwise, build a param string + } else if ( params && typeof params === "object" ) { + type = "POST"; + } + + // If we have elements to modify, make the request + if ( self.length > 0 ) { + jQuery.ajax( { + url: url, + + // If "type" variable is undefined, then "GET" method will be used. + // Make value of this field explicit since + // user can override it through ajaxSetup method + type: type || "GET", + dataType: "html", + data: params + } ).done( function( responseText ) { + + // Save response for use in complete callback + response = arguments; + + self.html( selector ? + + // If a selector was specified, locate the right elements in a dummy div + // Exclude scripts to avoid IE 'Permission Denied' errors + jQuery( "<div>" ).append( jQuery.parseHTML( responseText ) ).find( selector ) : + + // Otherwise use the full result + responseText ); + + // If the request succeeds, this function gets "data", "status", "jqXHR" + // but they are ignored because response was set above. + // If it fails, this function gets "jqXHR", "status", "error" + } ).always( callback && function( jqXHR, status ) { + self.each( function() { + callback.apply( this, response || [ jqXHR.responseText, status, jqXHR ] ); + } ); + } ); + } + + return this; +}; + + + + +// Attach a bunch of functions for handling common AJAX events +jQuery.each( [ + "ajaxStart", + "ajaxStop", + "ajaxComplete", + "ajaxError", + "ajaxSuccess", + "ajaxSend" +], function( i, type ) { + jQuery.fn[ type ] = function( fn ) { + return this.on( type, fn ); + }; +} ); + + + + +jQuery.expr.pseudos.animated = function( elem ) { + return jQuery.grep( jQuery.timers, function( fn ) { + return elem === fn.elem; + } ).length; +}; + + + + +/** + * Gets a window from an element + */ +function getWindow( elem ) { + return jQuery.isWindow( elem ) ? elem : elem.nodeType === 9 && elem.defaultView; +} + +jQuery.offset = { + setOffset: function( elem, options, i ) { + var curPosition, curLeft, curCSSTop, curTop, curOffset, curCSSLeft, calculatePosition, + position = jQuery.css( elem, "position" ), + curElem = jQuery( elem ), + props = {}; + + // Set position first, in-case top/left are set even on static elem + if ( position === "static" ) { + elem.style.position = "relative"; + } + + curOffset = curElem.offset(); + curCSSTop = jQuery.css( elem, "top" ); + curCSSLeft = jQuery.css( elem, "left" ); + calculatePosition = ( position === "absolute" || position === "fixed" ) && + ( curCSSTop + curCSSLeft ).indexOf( "auto" ) > -1; + + // Need to be able to calculate position if either + // top or left is auto and position is either absolute or fixed + if ( calculatePosition ) { + curPosition = curElem.position(); + curTop = curPosition.top; + curLeft = curPosition.left; + + } else { + curTop = parseFloat( curCSSTop ) || 0; + curLeft = parseFloat( curCSSLeft ) || 0; + } + + if ( jQuery.isFunction( options ) ) { + + // Use jQuery.extend here to allow modification of coordinates argument (gh-1848) + options = options.call( elem, i, jQuery.extend( {}, curOffset ) ); + } + + if ( options.top != null ) { + props.top = ( options.top - curOffset.top ) + curTop; + } + if ( options.left != null ) { + props.left = ( options.left - curOffset.left ) + curLeft; + } + + if ( "using" in options ) { + options.using.call( elem, props ); + + } else { + curElem.css( props ); + } + } +}; + +jQuery.fn.extend( { + offset: function( options ) { + + // Preserve chaining for setter + if ( arguments.length ) { + return options === undefined ? + this : + this.each( function( i ) { + jQuery.offset.setOffset( this, options, i ); + } ); + } + + var docElem, win, rect, doc, + elem = this[ 0 ]; + + if ( !elem ) { + return; + } + + // Support: IE <=11 only + // Running getBoundingClientRect on a + // disconnected node in IE throws an error + if ( !elem.getClientRects().length ) { + return { top: 0, left: 0 }; + } + + rect = elem.getBoundingClientRect(); + + // Make sure element is not hidden (display: none) + if ( rect.width || rect.height ) { + doc = elem.ownerDocument; + win = getWindow( doc ); + docElem = doc.documentElement; + + return { + top: rect.top + win.pageYOffset - docElem.clientTop, + left: rect.left + win.pageXOffset - docElem.clientLeft + }; + } + + // Return zeros for disconnected and hidden elements (gh-2310) + return rect; + }, + + position: function() { + if ( !this[ 0 ] ) { + return; + } + + var offsetParent, offset, + elem = this[ 0 ], + parentOffset = { top: 0, left: 0 }; + + // Fixed elements are offset from window (parentOffset = {top:0, left: 0}, + // because it is its only offset parent + if ( jQuery.css( elem, "position" ) === "fixed" ) { + + // Assume getBoundingClientRect is there when computed position is fixed + offset = elem.getBoundingClientRect(); + + } else { + + // Get *real* offsetParent + offsetParent = this.offsetParent(); + + // Get correct offsets + offset = this.offset(); + if ( !jQuery.nodeName( offsetParent[ 0 ], "html" ) ) { + parentOffset = offsetParent.offset(); + } + + // Add offsetParent borders + parentOffset = { + top: parentOffset.top + jQuery.css( offsetParent[ 0 ], "borderTopWidth", true ), + left: parentOffset.left + jQuery.css( offsetParent[ 0 ], "borderLeftWidth", true ) + }; + } + + // Subtract parent offsets and element margins + return { + top: offset.top - parentOffset.top - jQuery.css( elem, "marginTop", true ), + left: offset.left - parentOffset.left - jQuery.css( elem, "marginLeft", true ) + }; + }, + + // This method will return documentElement in the following cases: + // 1) For the element inside the iframe without offsetParent, this method will return + // documentElement of the parent window + // 2) For the hidden or detached element + // 3) For body or html element, i.e. in case of the html node - it will return itself + // + // but those exceptions were never presented as a real life use-cases + // and might be considered as more preferable results. + // + // This logic, however, is not guaranteed and can change at any point in the future + offsetParent: function() { + return this.map( function() { + var offsetParent = this.offsetParent; + + while ( offsetParent && jQuery.css( offsetParent, "position" ) === "static" ) { + offsetParent = offsetParent.offsetParent; + } + + return offsetParent || documentElement; + } ); + } +} ); + +// Create scrollLeft and scrollTop methods +jQuery.each( { scrollLeft: "pageXOffset", scrollTop: "pageYOffset" }, function( method, prop ) { + var top = "pageYOffset" === prop; + + jQuery.fn[ method ] = function( val ) { + return access( this, function( elem, method, val ) { + var win = getWindow( elem ); + + if ( val === undefined ) { + return win ? win[ prop ] : elem[ method ]; + } + + if ( win ) { + win.scrollTo( + !top ? val : win.pageXOffset, + top ? val : win.pageYOffset + ); + + } else { + elem[ method ] = val; + } + }, method, val, arguments.length ); + }; +} ); + +// Support: Safari <=7 - 9.1, Chrome <=37 - 49 +// Add the top/left cssHooks using jQuery.fn.position +// Webkit bug: https://bugs.webkit.org/show_bug.cgi?id=29084 +// Blink bug: https://bugs.chromium.org/p/chromium/issues/detail?id=589347 +// getComputedStyle returns percent when specified for top/left/bottom/right; +// rather than make the css module depend on the offset module, just check for it here +jQuery.each( [ "top", "left" ], function( i, prop ) { + jQuery.cssHooks[ prop ] = addGetHookIf( support.pixelPosition, + function( elem, computed ) { + if ( computed ) { + computed = curCSS( elem, prop ); + + // If curCSS returns percentage, fallback to offset + return rnumnonpx.test( computed ) ? + jQuery( elem ).position()[ prop ] + "px" : + computed; + } + } + ); +} ); + + +// Create innerHeight, innerWidth, height, width, outerHeight and outerWidth methods +jQuery.each( { Height: "height", Width: "width" }, function( name, type ) { + jQuery.each( { padding: "inner" + name, content: type, "": "outer" + name }, + function( defaultExtra, funcName ) { + + // Margin is only for outerHeight, outerWidth + jQuery.fn[ funcName ] = function( margin, value ) { + var chainable = arguments.length && ( defaultExtra || typeof margin !== "boolean" ), + extra = defaultExtra || ( margin === true || value === true ? "margin" : "border" ); + + return access( this, function( elem, type, value ) { + var doc; + + if ( jQuery.isWindow( elem ) ) { + + // $( window ).outerWidth/Height return w/h including scrollbars (gh-1729) + return funcName.indexOf( "outer" ) === 0 ? + elem[ "inner" + name ] : + elem.document.documentElement[ "client" + name ]; + } + + // Get document width or height + if ( elem.nodeType === 9 ) { + doc = elem.documentElement; + + // Either scroll[Width/Height] or offset[Width/Height] or client[Width/Height], + // whichever is greatest + return Math.max( + elem.body[ "scroll" + name ], doc[ "scroll" + name ], + elem.body[ "offset" + name ], doc[ "offset" + name ], + doc[ "client" + name ] + ); + } + + return value === undefined ? + + // Get width or height on the element, requesting but not forcing parseFloat + jQuery.css( elem, type, extra ) : + + // Set width or height on the element + jQuery.style( elem, type, value, extra ); + }, type, chainable ? margin : undefined, chainable ); + }; + } ); +} ); + + +jQuery.fn.extend( { + + bind: function( types, data, fn ) { + return this.on( types, null, data, fn ); + }, + unbind: function( types, fn ) { + return this.off( types, null, fn ); + }, + + delegate: function( selector, types, data, fn ) { + return this.on( types, selector, data, fn ); + }, + undelegate: function( selector, types, fn ) { + + // ( namespace ) or ( selector, types [, fn] ) + return arguments.length === 1 ? + this.off( selector, "**" ) : + this.off( types, selector || "**", fn ); + } +} ); + +jQuery.parseJSON = JSON.parse; + + + + +// Register as a named AMD module, since jQuery can be concatenated with other +// files that may use define, but not via a proper concatenation script that +// understands anonymous AMD modules. A named AMD is safest and most robust +// way to register. Lowercase jquery is used because AMD module names are +// derived from file names, and jQuery is normally delivered in a lowercase +// file name. Do this after creating the global so that if an AMD module wants +// to call noConflict to hide this version of jQuery, it will work. + +// Note that for maximum portability, libraries that are not jQuery should +// declare themselves as anonymous modules, and avoid setting a global if an +// AMD loader is present. jQuery is a special case. For more information, see +// https://github.com/jrburke/requirejs/wiki/Updating-existing-libraries#wiki-anon + +if ( typeof define === "function" && define.amd ) { + define( "jquery", [], function() { + return jQuery; + } ); +} + + + + + +var + + // Map over jQuery in case of overwrite + _jQuery = window.jQuery, + + // Map over the $ in case of overwrite + _$ = window.$; + +jQuery.noConflict = function( deep ) { + if ( window.$ === jQuery ) { + window.$ = _$; + } + + if ( deep && window.jQuery === jQuery ) { + window.jQuery = _jQuery; + } + + return jQuery; +}; + +// Expose jQuery and $ identifiers, even in AMD +// (#7102#comment:10, https://github.com/jquery/jquery/pull/557) +// and CommonJS for browser emulators (#13566) +if ( !noGlobal ) { + window.jQuery = window.$ = jQuery; +} + + +return jQuery; +} ); diff --git a/website/docs/_static/jquery.js b/website/docs/_static/jquery.js new file mode 100644 index 0000000..f6a6a99 --- /dev/null +++ b/website/docs/_static/jquery.js @@ -0,0 +1,4 @@ +/*! jQuery v3.1.0 | (c) jQuery Foundation | jquery.org/license */ +!function(a,b){"use strict";"object"==typeof module&&"object"==typeof module.exports?module.exports=a.document?b(a,!0):function(a){if(!a.document)throw new Error("jQuery requires a window with a document");return b(a)}:b(a)}("undefined"!=typeof window?window:this,function(a,b){"use strict";var c=[],d=a.document,e=Object.getPrototypeOf,f=c.slice,g=c.concat,h=c.push,i=c.indexOf,j={},k=j.toString,l=j.hasOwnProperty,m=l.toString,n=m.call(Object),o={};function p(a,b){b=b||d;var c=b.createElement("script");c.text=a,b.head.appendChild(c).parentNode.removeChild(c)}var q="3.1.0",r=function(a,b){return new r.fn.init(a,b)},s=/^[\s\uFEFF\xA0]+|[\s\uFEFF\xA0]+$/g,t=/^-ms-/,u=/-([a-z])/g,v=function(a,b){return b.toUpperCase()};r.fn=r.prototype={jquery:q,constructor:r,length:0,toArray:function(){return f.call(this)},get:function(a){return null!=a?a<0?this[a+this.length]:this[a]:f.call(this)},pushStack:function(a){var b=r.merge(this.constructor(),a);return b.prevObject=this,b},each:function(a){return r.each(this,a)},map:function(a){return this.pushStack(r.map(this,function(b,c){return a.call(b,c,b)}))},slice:function(){return this.pushStack(f.apply(this,arguments))},first:function(){return this.eq(0)},last:function(){return this.eq(-1)},eq:function(a){var b=this.length,c=+a+(a<0?b:0);return this.pushStack(c>=0&&c<b?[this[c]]:[])},end:function(){return this.prevObject||this.constructor()},push:h,sort:c.sort,splice:c.splice},r.extend=r.fn.extend=function(){var a,b,c,d,e,f,g=arguments[0]||{},h=1,i=arguments.length,j=!1;for("boolean"==typeof g&&(j=g,g=arguments[h]||{},h++),"object"==typeof g||r.isFunction(g)||(g={}),h===i&&(g=this,h--);h<i;h++)if(null!=(a=arguments[h]))for(b in a)c=g[b],d=a[b],g!==d&&(j&&d&&(r.isPlainObject(d)||(e=r.isArray(d)))?(e?(e=!1,f=c&&r.isArray(c)?c:[]):f=c&&r.isPlainObject(c)?c:{},g[b]=r.extend(j,f,d)):void 0!==d&&(g[b]=d));return g},r.extend({expando:"jQuery"+(q+Math.random()).replace(/\D/g,""),isReady:!0,error:function(a){throw new Error(a)},noop:function(){},isFunction:function(a){return"function"===r.type(a)},isArray:Array.isArray,isWindow:function(a){return null!=a&&a===a.window},isNumeric:function(a){var b=r.type(a);return("number"===b||"string"===b)&&!isNaN(a-parseFloat(a))},isPlainObject:function(a){var b,c;return!(!a||"[object Object]"!==k.call(a))&&(!(b=e(a))||(c=l.call(b,"constructor")&&b.constructor,"function"==typeof c&&m.call(c)===n))},isEmptyObject:function(a){var b;for(b in a)return!1;return!0},type:function(a){return null==a?a+"":"object"==typeof a||"function"==typeof a?j[k.call(a)]||"object":typeof a},globalEval:function(a){p(a)},camelCase:function(a){return a.replace(t,"ms-").replace(u,v)},nodeName:function(a,b){return a.nodeName&&a.nodeName.toLowerCase()===b.toLowerCase()},each:function(a,b){var c,d=0;if(w(a)){for(c=a.length;d<c;d++)if(b.call(a[d],d,a[d])===!1)break}else for(d in a)if(b.call(a[d],d,a[d])===!1)break;return a},trim:function(a){return null==a?"":(a+"").replace(s,"")},makeArray:function(a,b){var c=b||[];return null!=a&&(w(Object(a))?r.merge(c,"string"==typeof a?[a]:a):h.call(c,a)),c},inArray:function(a,b,c){return null==b?-1:i.call(b,a,c)},merge:function(a,b){for(var c=+b.length,d=0,e=a.length;d<c;d++)a[e++]=b[d];return a.length=e,a},grep:function(a,b,c){for(var d,e=[],f=0,g=a.length,h=!c;f<g;f++)d=!b(a[f],f),d!==h&&e.push(a[f]);return e},map:function(a,b,c){var d,e,f=0,h=[];if(w(a))for(d=a.length;f<d;f++)e=b(a[f],f,c),null!=e&&h.push(e);else for(f in a)e=b(a[f],f,c),null!=e&&h.push(e);return g.apply([],h)},guid:1,proxy:function(a,b){var c,d,e;if("string"==typeof b&&(c=a[b],b=a,a=c),r.isFunction(a))return d=f.call(arguments,2),e=function(){return a.apply(b||this,d.concat(f.call(arguments)))},e.guid=a.guid=a.guid||r.guid++,e},now:Date.now,support:o}),"function"==typeof Symbol&&(r.fn[Symbol.iterator]=c[Symbol.iterator]),r.each("Boolean Number String Function Array Date RegExp Object Error Symbol".split(" "),function(a,b){j["[object "+b+"]"]=b.toLowerCase()});function w(a){var b=!!a&&"length"in a&&a.length,c=r.type(a);return"function"!==c&&!r.isWindow(a)&&("array"===c||0===b||"number"==typeof b&&b>0&&b-1 in a)}var x=function(a){var b,c,d,e,f,g,h,i,j,k,l,m,n,o,p,q,r,s,t,u="sizzle"+1*new Date,v=a.document,w=0,x=0,y=ha(),z=ha(),A=ha(),B=function(a,b){return a===b&&(l=!0),0},C={}.hasOwnProperty,D=[],E=D.pop,F=D.push,G=D.push,H=D.slice,I=function(a,b){for(var c=0,d=a.length;c<d;c++)if(a[c]===b)return c;return-1},J="checked|selected|async|autofocus|autoplay|controls|defer|disabled|hidden|ismap|loop|multiple|open|readonly|required|scoped",K="[\\x20\\t\\r\\n\\f]",L="(?:\\\\.|[\\w-]|[^\0-\\xa0])+",M="\\["+K+"*("+L+")(?:"+K+"*([*^$|!~]?=)"+K+"*(?:'((?:\\\\.|[^\\\\'])*)'|\"((?:\\\\.|[^\\\\\"])*)\"|("+L+"))|)"+K+"*\\]",N=":("+L+")(?:\\((('((?:\\\\.|[^\\\\'])*)'|\"((?:\\\\.|[^\\\\\"])*)\")|((?:\\\\.|[^\\\\()[\\]]|"+M+")*)|.*)\\)|)",O=new RegExp(K+"+","g"),P=new RegExp("^"+K+"+|((?:^|[^\\\\])(?:\\\\.)*)"+K+"+$","g"),Q=new RegExp("^"+K+"*,"+K+"*"),R=new RegExp("^"+K+"*([>+~]|"+K+")"+K+"*"),S=new RegExp("="+K+"*([^\\]'\"]*?)"+K+"*\\]","g"),T=new RegExp(N),U=new RegExp("^"+L+"$"),V={ID:new RegExp("^#("+L+")"),CLASS:new RegExp("^\\.("+L+")"),TAG:new RegExp("^("+L+"|[*])"),ATTR:new RegExp("^"+M),PSEUDO:new RegExp("^"+N),CHILD:new RegExp("^:(only|first|last|nth|nth-last)-(child|of-type)(?:\\("+K+"*(even|odd|(([+-]|)(\\d*)n|)"+K+"*(?:([+-]|)"+K+"*(\\d+)|))"+K+"*\\)|)","i"),bool:new RegExp("^(?:"+J+")$","i"),needsContext:new RegExp("^"+K+"*[>+~]|:(even|odd|eq|gt|lt|nth|first|last)(?:\\("+K+"*((?:-\\d)?\\d*)"+K+"*\\)|)(?=[^-]|$)","i")},W=/^(?:input|select|textarea|button)$/i,X=/^h\d$/i,Y=/^[^{]+\{\s*\[native \w/,Z=/^(?:#([\w-]+)|(\w+)|\.([\w-]+))$/,$=/[+~]/,_=new RegExp("\\\\([\\da-f]{1,6}"+K+"?|("+K+")|.)","ig"),aa=function(a,b,c){var d="0x"+b-65536;return d!==d||c?b:d<0?String.fromCharCode(d+65536):String.fromCharCode(d>>10|55296,1023&d|56320)},ba=/([\0-\x1f\x7f]|^-?\d)|^-$|[^\x80-\uFFFF\w-]/g,ca=function(a,b){return b?"\0"===a?"\ufffd":a.slice(0,-1)+"\\"+a.charCodeAt(a.length-1).toString(16)+" ":"\\"+a},da=function(){m()},ea=ta(function(a){return a.disabled===!0},{dir:"parentNode",next:"legend"});try{G.apply(D=H.call(v.childNodes),v.childNodes),D[v.childNodes.length].nodeType}catch(fa){G={apply:D.length?function(a,b){F.apply(a,H.call(b))}:function(a,b){var c=a.length,d=0;while(a[c++]=b[d++]);a.length=c-1}}}function ga(a,b,d,e){var f,h,j,k,l,o,r,s=b&&b.ownerDocument,w=b?b.nodeType:9;if(d=d||[],"string"!=typeof a||!a||1!==w&&9!==w&&11!==w)return d;if(!e&&((b?b.ownerDocument||b:v)!==n&&m(b),b=b||n,p)){if(11!==w&&(l=Z.exec(a)))if(f=l[1]){if(9===w){if(!(j=b.getElementById(f)))return d;if(j.id===f)return d.push(j),d}else if(s&&(j=s.getElementById(f))&&t(b,j)&&j.id===f)return d.push(j),d}else{if(l[2])return G.apply(d,b.getElementsByTagName(a)),d;if((f=l[3])&&c.getElementsByClassName&&b.getElementsByClassName)return G.apply(d,b.getElementsByClassName(f)),d}if(c.qsa&&!A[a+" "]&&(!q||!q.test(a))){if(1!==w)s=b,r=a;else if("object"!==b.nodeName.toLowerCase()){(k=b.getAttribute("id"))?k=k.replace(ba,ca):b.setAttribute("id",k=u),o=g(a),h=o.length;while(h--)o[h]="#"+k+" "+sa(o[h]);r=o.join(","),s=$.test(a)&&qa(b.parentNode)||b}if(r)try{return G.apply(d,s.querySelectorAll(r)),d}catch(x){}finally{k===u&&b.removeAttribute("id")}}}return i(a.replace(P,"$1"),b,d,e)}function ha(){var a=[];function b(c,e){return a.push(c+" ")>d.cacheLength&&delete b[a.shift()],b[c+" "]=e}return b}function ia(a){return a[u]=!0,a}function ja(a){var b=n.createElement("fieldset");try{return!!a(b)}catch(c){return!1}finally{b.parentNode&&b.parentNode.removeChild(b),b=null}}function ka(a,b){var c=a.split("|"),e=c.length;while(e--)d.attrHandle[c[e]]=b}function la(a,b){var c=b&&a,d=c&&1===a.nodeType&&1===b.nodeType&&a.sourceIndex-b.sourceIndex;if(d)return d;if(c)while(c=c.nextSibling)if(c===b)return-1;return a?1:-1}function ma(a){return function(b){var c=b.nodeName.toLowerCase();return"input"===c&&b.type===a}}function na(a){return function(b){var c=b.nodeName.toLowerCase();return("input"===c||"button"===c)&&b.type===a}}function oa(a){return function(b){return"label"in b&&b.disabled===a||"form"in b&&b.disabled===a||"form"in b&&b.disabled===!1&&(b.isDisabled===a||b.isDisabled!==!a&&("label"in b||!ea(b))!==a)}}function pa(a){return ia(function(b){return b=+b,ia(function(c,d){var e,f=a([],c.length,b),g=f.length;while(g--)c[e=f[g]]&&(c[e]=!(d[e]=c[e]))})})}function qa(a){return a&&"undefined"!=typeof a.getElementsByTagName&&a}c=ga.support={},f=ga.isXML=function(a){var b=a&&(a.ownerDocument||a).documentElement;return!!b&&"HTML"!==b.nodeName},m=ga.setDocument=function(a){var b,e,g=a?a.ownerDocument||a:v;return g!==n&&9===g.nodeType&&g.documentElement?(n=g,o=n.documentElement,p=!f(n),v!==n&&(e=n.defaultView)&&e.top!==e&&(e.addEventListener?e.addEventListener("unload",da,!1):e.attachEvent&&e.attachEvent("onunload",da)),c.attributes=ja(function(a){return a.className="i",!a.getAttribute("className")}),c.getElementsByTagName=ja(function(a){return a.appendChild(n.createComment("")),!a.getElementsByTagName("*").length}),c.getElementsByClassName=Y.test(n.getElementsByClassName),c.getById=ja(function(a){return o.appendChild(a).id=u,!n.getElementsByName||!n.getElementsByName(u).length}),c.getById?(d.find.ID=function(a,b){if("undefined"!=typeof b.getElementById&&p){var c=b.getElementById(a);return c?[c]:[]}},d.filter.ID=function(a){var b=a.replace(_,aa);return function(a){return a.getAttribute("id")===b}}):(delete d.find.ID,d.filter.ID=function(a){var b=a.replace(_,aa);return function(a){var c="undefined"!=typeof a.getAttributeNode&&a.getAttributeNode("id");return c&&c.value===b}}),d.find.TAG=c.getElementsByTagName?function(a,b){return"undefined"!=typeof b.getElementsByTagName?b.getElementsByTagName(a):c.qsa?b.querySelectorAll(a):void 0}:function(a,b){var c,d=[],e=0,f=b.getElementsByTagName(a);if("*"===a){while(c=f[e++])1===c.nodeType&&d.push(c);return d}return f},d.find.CLASS=c.getElementsByClassName&&function(a,b){if("undefined"!=typeof b.getElementsByClassName&&p)return b.getElementsByClassName(a)},r=[],q=[],(c.qsa=Y.test(n.querySelectorAll))&&(ja(function(a){o.appendChild(a).innerHTML="<a id='"+u+"'></a><select id='"+u+"-\r\\' msallowcapture=''><option selected=''></option></select>",a.querySelectorAll("[msallowcapture^='']").length&&q.push("[*^$]="+K+"*(?:''|\"\")"),a.querySelectorAll("[selected]").length||q.push("\\["+K+"*(?:value|"+J+")"),a.querySelectorAll("[id~="+u+"-]").length||q.push("~="),a.querySelectorAll(":checked").length||q.push(":checked"),a.querySelectorAll("a#"+u+"+*").length||q.push(".#.+[+~]")}),ja(function(a){a.innerHTML="<a href='' disabled='disabled'></a><select disabled='disabled'><option/></select>";var b=n.createElement("input");b.setAttribute("type","hidden"),a.appendChild(b).setAttribute("name","D"),a.querySelectorAll("[name=d]").length&&q.push("name"+K+"*[*^$|!~]?="),2!==a.querySelectorAll(":enabled").length&&q.push(":enabled",":disabled"),o.appendChild(a).disabled=!0,2!==a.querySelectorAll(":disabled").length&&q.push(":enabled",":disabled"),a.querySelectorAll("*,:x"),q.push(",.*:")})),(c.matchesSelector=Y.test(s=o.matches||o.webkitMatchesSelector||o.mozMatchesSelector||o.oMatchesSelector||o.msMatchesSelector))&&ja(function(a){c.disconnectedMatch=s.call(a,"*"),s.call(a,"[s!='']:x"),r.push("!=",N)}),q=q.length&&new RegExp(q.join("|")),r=r.length&&new RegExp(r.join("|")),b=Y.test(o.compareDocumentPosition),t=b||Y.test(o.contains)?function(a,b){var c=9===a.nodeType?a.documentElement:a,d=b&&b.parentNode;return a===d||!(!d||1!==d.nodeType||!(c.contains?c.contains(d):a.compareDocumentPosition&&16&a.compareDocumentPosition(d)))}:function(a,b){if(b)while(b=b.parentNode)if(b===a)return!0;return!1},B=b?function(a,b){if(a===b)return l=!0,0;var d=!a.compareDocumentPosition-!b.compareDocumentPosition;return d?d:(d=(a.ownerDocument||a)===(b.ownerDocument||b)?a.compareDocumentPosition(b):1,1&d||!c.sortDetached&&b.compareDocumentPosition(a)===d?a===n||a.ownerDocument===v&&t(v,a)?-1:b===n||b.ownerDocument===v&&t(v,b)?1:k?I(k,a)-I(k,b):0:4&d?-1:1)}:function(a,b){if(a===b)return l=!0,0;var c,d=0,e=a.parentNode,f=b.parentNode,g=[a],h=[b];if(!e||!f)return a===n?-1:b===n?1:e?-1:f?1:k?I(k,a)-I(k,b):0;if(e===f)return la(a,b);c=a;while(c=c.parentNode)g.unshift(c);c=b;while(c=c.parentNode)h.unshift(c);while(g[d]===h[d])d++;return d?la(g[d],h[d]):g[d]===v?-1:h[d]===v?1:0},n):n},ga.matches=function(a,b){return ga(a,null,null,b)},ga.matchesSelector=function(a,b){if((a.ownerDocument||a)!==n&&m(a),b=b.replace(S,"='$1']"),c.matchesSelector&&p&&!A[b+" "]&&(!r||!r.test(b))&&(!q||!q.test(b)))try{var d=s.call(a,b);if(d||c.disconnectedMatch||a.document&&11!==a.document.nodeType)return d}catch(e){}return ga(b,n,null,[a]).length>0},ga.contains=function(a,b){return(a.ownerDocument||a)!==n&&m(a),t(a,b)},ga.attr=function(a,b){(a.ownerDocument||a)!==n&&m(a);var e=d.attrHandle[b.toLowerCase()],f=e&&C.call(d.attrHandle,b.toLowerCase())?e(a,b,!p):void 0;return void 0!==f?f:c.attributes||!p?a.getAttribute(b):(f=a.getAttributeNode(b))&&f.specified?f.value:null},ga.escape=function(a){return(a+"").replace(ba,ca)},ga.error=function(a){throw new Error("Syntax error, unrecognized expression: "+a)},ga.uniqueSort=function(a){var b,d=[],e=0,f=0;if(l=!c.detectDuplicates,k=!c.sortStable&&a.slice(0),a.sort(B),l){while(b=a[f++])b===a[f]&&(e=d.push(f));while(e--)a.splice(d[e],1)}return k=null,a},e=ga.getText=function(a){var b,c="",d=0,f=a.nodeType;if(f){if(1===f||9===f||11===f){if("string"==typeof a.textContent)return a.textContent;for(a=a.firstChild;a;a=a.nextSibling)c+=e(a)}else if(3===f||4===f)return a.nodeValue}else while(b=a[d++])c+=e(b);return c},d=ga.selectors={cacheLength:50,createPseudo:ia,match:V,attrHandle:{},find:{},relative:{">":{dir:"parentNode",first:!0}," ":{dir:"parentNode"},"+":{dir:"previousSibling",first:!0},"~":{dir:"previousSibling"}},preFilter:{ATTR:function(a){return a[1]=a[1].replace(_,aa),a[3]=(a[3]||a[4]||a[5]||"").replace(_,aa),"~="===a[2]&&(a[3]=" "+a[3]+" "),a.slice(0,4)},CHILD:function(a){return a[1]=a[1].toLowerCase(),"nth"===a[1].slice(0,3)?(a[3]||ga.error(a[0]),a[4]=+(a[4]?a[5]+(a[6]||1):2*("even"===a[3]||"odd"===a[3])),a[5]=+(a[7]+a[8]||"odd"===a[3])):a[3]&&ga.error(a[0]),a},PSEUDO:function(a){var b,c=!a[6]&&a[2];return V.CHILD.test(a[0])?null:(a[3]?a[2]=a[4]||a[5]||"":c&&T.test(c)&&(b=g(c,!0))&&(b=c.indexOf(")",c.length-b)-c.length)&&(a[0]=a[0].slice(0,b),a[2]=c.slice(0,b)),a.slice(0,3))}},filter:{TAG:function(a){var b=a.replace(_,aa).toLowerCase();return"*"===a?function(){return!0}:function(a){return a.nodeName&&a.nodeName.toLowerCase()===b}},CLASS:function(a){var b=y[a+" "];return b||(b=new RegExp("(^|"+K+")"+a+"("+K+"|$)"))&&y(a,function(a){return b.test("string"==typeof a.className&&a.className||"undefined"!=typeof a.getAttribute&&a.getAttribute("class")||"")})},ATTR:function(a,b,c){return function(d){var e=ga.attr(d,a);return null==e?"!="===b:!b||(e+="","="===b?e===c:"!="===b?e!==c:"^="===b?c&&0===e.indexOf(c):"*="===b?c&&e.indexOf(c)>-1:"$="===b?c&&e.slice(-c.length)===c:"~="===b?(" "+e.replace(O," ")+" ").indexOf(c)>-1:"|="===b&&(e===c||e.slice(0,c.length+1)===c+"-"))}},CHILD:function(a,b,c,d,e){var f="nth"!==a.slice(0,3),g="last"!==a.slice(-4),h="of-type"===b;return 1===d&&0===e?function(a){return!!a.parentNode}:function(b,c,i){var j,k,l,m,n,o,p=f!==g?"nextSibling":"previousSibling",q=b.parentNode,r=h&&b.nodeName.toLowerCase(),s=!i&&!h,t=!1;if(q){if(f){while(p){m=b;while(m=m[p])if(h?m.nodeName.toLowerCase()===r:1===m.nodeType)return!1;o=p="only"===a&&!o&&"nextSibling"}return!0}if(o=[g?q.firstChild:q.lastChild],g&&s){m=q,l=m[u]||(m[u]={}),k=l[m.uniqueID]||(l[m.uniqueID]={}),j=k[a]||[],n=j[0]===w&&j[1],t=n&&j[2],m=n&&q.childNodes[n];while(m=++n&&m&&m[p]||(t=n=0)||o.pop())if(1===m.nodeType&&++t&&m===b){k[a]=[w,n,t];break}}else if(s&&(m=b,l=m[u]||(m[u]={}),k=l[m.uniqueID]||(l[m.uniqueID]={}),j=k[a]||[],n=j[0]===w&&j[1],t=n),t===!1)while(m=++n&&m&&m[p]||(t=n=0)||o.pop())if((h?m.nodeName.toLowerCase()===r:1===m.nodeType)&&++t&&(s&&(l=m[u]||(m[u]={}),k=l[m.uniqueID]||(l[m.uniqueID]={}),k[a]=[w,t]),m===b))break;return t-=e,t===d||t%d===0&&t/d>=0}}},PSEUDO:function(a,b){var c,e=d.pseudos[a]||d.setFilters[a.toLowerCase()]||ga.error("unsupported pseudo: "+a);return e[u]?e(b):e.length>1?(c=[a,a,"",b],d.setFilters.hasOwnProperty(a.toLowerCase())?ia(function(a,c){var d,f=e(a,b),g=f.length;while(g--)d=I(a,f[g]),a[d]=!(c[d]=f[g])}):function(a){return e(a,0,c)}):e}},pseudos:{not:ia(function(a){var b=[],c=[],d=h(a.replace(P,"$1"));return d[u]?ia(function(a,b,c,e){var f,g=d(a,null,e,[]),h=a.length;while(h--)(f=g[h])&&(a[h]=!(b[h]=f))}):function(a,e,f){return b[0]=a,d(b,null,f,c),b[0]=null,!c.pop()}}),has:ia(function(a){return function(b){return ga(a,b).length>0}}),contains:ia(function(a){return a=a.replace(_,aa),function(b){return(b.textContent||b.innerText||e(b)).indexOf(a)>-1}}),lang:ia(function(a){return U.test(a||"")||ga.error("unsupported lang: "+a),a=a.replace(_,aa).toLowerCase(),function(b){var c;do if(c=p?b.lang:b.getAttribute("xml:lang")||b.getAttribute("lang"))return c=c.toLowerCase(),c===a||0===c.indexOf(a+"-");while((b=b.parentNode)&&1===b.nodeType);return!1}}),target:function(b){var c=a.location&&a.location.hash;return c&&c.slice(1)===b.id},root:function(a){return a===o},focus:function(a){return a===n.activeElement&&(!n.hasFocus||n.hasFocus())&&!!(a.type||a.href||~a.tabIndex)},enabled:oa(!1),disabled:oa(!0),checked:function(a){var b=a.nodeName.toLowerCase();return"input"===b&&!!a.checked||"option"===b&&!!a.selected},selected:function(a){return a.parentNode&&a.parentNode.selectedIndex,a.selected===!0},empty:function(a){for(a=a.firstChild;a;a=a.nextSibling)if(a.nodeType<6)return!1;return!0},parent:function(a){return!d.pseudos.empty(a)},header:function(a){return X.test(a.nodeName)},input:function(a){return W.test(a.nodeName)},button:function(a){var b=a.nodeName.toLowerCase();return"input"===b&&"button"===a.type||"button"===b},text:function(a){var b;return"input"===a.nodeName.toLowerCase()&&"text"===a.type&&(null==(b=a.getAttribute("type"))||"text"===b.toLowerCase())},first:pa(function(){return[0]}),last:pa(function(a,b){return[b-1]}),eq:pa(function(a,b,c){return[c<0?c+b:c]}),even:pa(function(a,b){for(var c=0;c<b;c+=2)a.push(c);return a}),odd:pa(function(a,b){for(var c=1;c<b;c+=2)a.push(c);return a}),lt:pa(function(a,b,c){for(var d=c<0?c+b:c;--d>=0;)a.push(d);return a}),gt:pa(function(a,b,c){for(var d=c<0?c+b:c;++d<b;)a.push(d);return a})}},d.pseudos.nth=d.pseudos.eq;for(b in{radio:!0,checkbox:!0,file:!0,password:!0,image:!0})d.pseudos[b]=ma(b);for(b in{submit:!0,reset:!0})d.pseudos[b]=na(b);function ra(){}ra.prototype=d.filters=d.pseudos,d.setFilters=new ra,g=ga.tokenize=function(a,b){var c,e,f,g,h,i,j,k=z[a+" "];if(k)return b?0:k.slice(0);h=a,i=[],j=d.preFilter;while(h){c&&!(e=Q.exec(h))||(e&&(h=h.slice(e[0].length)||h),i.push(f=[])),c=!1,(e=R.exec(h))&&(c=e.shift(),f.push({value:c,type:e[0].replace(P," ")}),h=h.slice(c.length));for(g in d.filter)!(e=V[g].exec(h))||j[g]&&!(e=j[g](e))||(c=e.shift(),f.push({value:c,type:g,matches:e}),h=h.slice(c.length));if(!c)break}return b?h.length:h?ga.error(a):z(a,i).slice(0)};function sa(a){for(var b=0,c=a.length,d="";b<c;b++)d+=a[b].value;return d}function ta(a,b,c){var d=b.dir,e=b.next,f=e||d,g=c&&"parentNode"===f,h=x++;return b.first?function(b,c,e){while(b=b[d])if(1===b.nodeType||g)return a(b,c,e)}:function(b,c,i){var j,k,l,m=[w,h];if(i){while(b=b[d])if((1===b.nodeType||g)&&a(b,c,i))return!0}else while(b=b[d])if(1===b.nodeType||g)if(l=b[u]||(b[u]={}),k=l[b.uniqueID]||(l[b.uniqueID]={}),e&&e===b.nodeName.toLowerCase())b=b[d]||b;else{if((j=k[f])&&j[0]===w&&j[1]===h)return m[2]=j[2];if(k[f]=m,m[2]=a(b,c,i))return!0}}}function ua(a){return a.length>1?function(b,c,d){var e=a.length;while(e--)if(!a[e](b,c,d))return!1;return!0}:a[0]}function va(a,b,c){for(var d=0,e=b.length;d<e;d++)ga(a,b[d],c);return c}function wa(a,b,c,d,e){for(var f,g=[],h=0,i=a.length,j=null!=b;h<i;h++)(f=a[h])&&(c&&!c(f,d,e)||(g.push(f),j&&b.push(h)));return g}function xa(a,b,c,d,e,f){return d&&!d[u]&&(d=xa(d)),e&&!e[u]&&(e=xa(e,f)),ia(function(f,g,h,i){var j,k,l,m=[],n=[],o=g.length,p=f||va(b||"*",h.nodeType?[h]:h,[]),q=!a||!f&&b?p:wa(p,m,a,h,i),r=c?e||(f?a:o||d)?[]:g:q;if(c&&c(q,r,h,i),d){j=wa(r,n),d(j,[],h,i),k=j.length;while(k--)(l=j[k])&&(r[n[k]]=!(q[n[k]]=l))}if(f){if(e||a){if(e){j=[],k=r.length;while(k--)(l=r[k])&&j.push(q[k]=l);e(null,r=[],j,i)}k=r.length;while(k--)(l=r[k])&&(j=e?I(f,l):m[k])>-1&&(f[j]=!(g[j]=l))}}else r=wa(r===g?r.splice(o,r.length):r),e?e(null,g,r,i):G.apply(g,r)})}function ya(a){for(var b,c,e,f=a.length,g=d.relative[a[0].type],h=g||d.relative[" "],i=g?1:0,k=ta(function(a){return a===b},h,!0),l=ta(function(a){return I(b,a)>-1},h,!0),m=[function(a,c,d){var e=!g&&(d||c!==j)||((b=c).nodeType?k(a,c,d):l(a,c,d));return b=null,e}];i<f;i++)if(c=d.relative[a[i].type])m=[ta(ua(m),c)];else{if(c=d.filter[a[i].type].apply(null,a[i].matches),c[u]){for(e=++i;e<f;e++)if(d.relative[a[e].type])break;return xa(i>1&&ua(m),i>1&&sa(a.slice(0,i-1).concat({value:" "===a[i-2].type?"*":""})).replace(P,"$1"),c,i<e&&ya(a.slice(i,e)),e<f&&ya(a=a.slice(e)),e<f&&sa(a))}m.push(c)}return ua(m)}function za(a,b){var c=b.length>0,e=a.length>0,f=function(f,g,h,i,k){var l,o,q,r=0,s="0",t=f&&[],u=[],v=j,x=f||e&&d.find.TAG("*",k),y=w+=null==v?1:Math.random()||.1,z=x.length;for(k&&(j=g===n||g||k);s!==z&&null!=(l=x[s]);s++){if(e&&l){o=0,g||l.ownerDocument===n||(m(l),h=!p);while(q=a[o++])if(q(l,g||n,h)){i.push(l);break}k&&(w=y)}c&&((l=!q&&l)&&r--,f&&t.push(l))}if(r+=s,c&&s!==r){o=0;while(q=b[o++])q(t,u,g,h);if(f){if(r>0)while(s--)t[s]||u[s]||(u[s]=E.call(i));u=wa(u)}G.apply(i,u),k&&!f&&u.length>0&&r+b.length>1&&ga.uniqueSort(i)}return k&&(w=y,j=v),t};return c?ia(f):f}return h=ga.compile=function(a,b){var c,d=[],e=[],f=A[a+" "];if(!f){b||(b=g(a)),c=b.length;while(c--)f=ya(b[c]),f[u]?d.push(f):e.push(f);f=A(a,za(e,d)),f.selector=a}return f},i=ga.select=function(a,b,e,f){var i,j,k,l,m,n="function"==typeof a&&a,o=!f&&g(a=n.selector||a);if(e=e||[],1===o.length){if(j=o[0]=o[0].slice(0),j.length>2&&"ID"===(k=j[0]).type&&c.getById&&9===b.nodeType&&p&&d.relative[j[1].type]){if(b=(d.find.ID(k.matches[0].replace(_,aa),b)||[])[0],!b)return e;n&&(b=b.parentNode),a=a.slice(j.shift().value.length)}i=V.needsContext.test(a)?0:j.length;while(i--){if(k=j[i],d.relative[l=k.type])break;if((m=d.find[l])&&(f=m(k.matches[0].replace(_,aa),$.test(j[0].type)&&qa(b.parentNode)||b))){if(j.splice(i,1),a=f.length&&sa(j),!a)return G.apply(e,f),e;break}}}return(n||h(a,o))(f,b,!p,e,!b||$.test(a)&&qa(b.parentNode)||b),e},c.sortStable=u.split("").sort(B).join("")===u,c.detectDuplicates=!!l,m(),c.sortDetached=ja(function(a){return 1&a.compareDocumentPosition(n.createElement("fieldset"))}),ja(function(a){return a.innerHTML="<a href='#'></a>","#"===a.firstChild.getAttribute("href")})||ka("type|href|height|width",function(a,b,c){if(!c)return a.getAttribute(b,"type"===b.toLowerCase()?1:2)}),c.attributes&&ja(function(a){return a.innerHTML="<input/>",a.firstChild.setAttribute("value",""),""===a.firstChild.getAttribute("value")})||ka("value",function(a,b,c){if(!c&&"input"===a.nodeName.toLowerCase())return a.defaultValue}),ja(function(a){return null==a.getAttribute("disabled")})||ka(J,function(a,b,c){var d;if(!c)return a[b]===!0?b.toLowerCase():(d=a.getAttributeNode(b))&&d.specified?d.value:null}),ga}(a);r.find=x,r.expr=x.selectors,r.expr[":"]=r.expr.pseudos,r.uniqueSort=r.unique=x.uniqueSort,r.text=x.getText,r.isXMLDoc=x.isXML,r.contains=x.contains,r.escapeSelector=x.escape;var y=function(a,b,c){var d=[],e=void 0!==c;while((a=a[b])&&9!==a.nodeType)if(1===a.nodeType){if(e&&r(a).is(c))break;d.push(a)}return d},z=function(a,b){for(var c=[];a;a=a.nextSibling)1===a.nodeType&&a!==b&&c.push(a);return c},A=r.expr.match.needsContext,B=/^<([a-z][^\/\0>:\x20\t\r\n\f]*)[\x20\t\r\n\f]*\/?>(?:<\/\1>|)$/i,C=/^.[^:#\[\.,]*$/;function D(a,b,c){if(r.isFunction(b))return r.grep(a,function(a,d){return!!b.call(a,d,a)!==c});if(b.nodeType)return r.grep(a,function(a){return a===b!==c});if("string"==typeof b){if(C.test(b))return r.filter(b,a,c);b=r.filter(b,a)}return r.grep(a,function(a){return i.call(b,a)>-1!==c&&1===a.nodeType})}r.filter=function(a,b,c){var d=b[0];return c&&(a=":not("+a+")"),1===b.length&&1===d.nodeType?r.find.matchesSelector(d,a)?[d]:[]:r.find.matches(a,r.grep(b,function(a){return 1===a.nodeType}))},r.fn.extend({find:function(a){var b,c,d=this.length,e=this;if("string"!=typeof a)return this.pushStack(r(a).filter(function(){for(b=0;b<d;b++)if(r.contains(e[b],this))return!0}));for(c=this.pushStack([]),b=0;b<d;b++)r.find(a,e[b],c);return d>1?r.uniqueSort(c):c},filter:function(a){return this.pushStack(D(this,a||[],!1))},not:function(a){return this.pushStack(D(this,a||[],!0))},is:function(a){return!!D(this,"string"==typeof a&&A.test(a)?r(a):a||[],!1).length}});var E,F=/^(?:\s*(<[\w\W]+>)[^>]*|#([\w-]+))$/,G=r.fn.init=function(a,b,c){var e,f;if(!a)return this;if(c=c||E,"string"==typeof a){if(e="<"===a[0]&&">"===a[a.length-1]&&a.length>=3?[null,a,null]:F.exec(a),!e||!e[1]&&b)return!b||b.jquery?(b||c).find(a):this.constructor(b).find(a);if(e[1]){if(b=b instanceof r?b[0]:b,r.merge(this,r.parseHTML(e[1],b&&b.nodeType?b.ownerDocument||b:d,!0)),B.test(e[1])&&r.isPlainObject(b))for(e in b)r.isFunction(this[e])?this[e](b[e]):this.attr(e,b[e]);return this}return f=d.getElementById(e[2]),f&&(this[0]=f,this.length=1),this}return a.nodeType?(this[0]=a,this.length=1,this):r.isFunction(a)?void 0!==c.ready?c.ready(a):a(r):r.makeArray(a,this)};G.prototype=r.fn,E=r(d);var H=/^(?:parents|prev(?:Until|All))/,I={children:!0,contents:!0,next:!0,prev:!0};r.fn.extend({has:function(a){var b=r(a,this),c=b.length;return this.filter(function(){for(var a=0;a<c;a++)if(r.contains(this,b[a]))return!0})},closest:function(a,b){var c,d=0,e=this.length,f=[],g="string"!=typeof a&&r(a);if(!A.test(a))for(;d<e;d++)for(c=this[d];c&&c!==b;c=c.parentNode)if(c.nodeType<11&&(g?g.index(c)>-1:1===c.nodeType&&r.find.matchesSelector(c,a))){f.push(c);break}return this.pushStack(f.length>1?r.uniqueSort(f):f)},index:function(a){return a?"string"==typeof a?i.call(r(a),this[0]):i.call(this,a.jquery?a[0]:a):this[0]&&this[0].parentNode?this.first().prevAll().length:-1},add:function(a,b){return this.pushStack(r.uniqueSort(r.merge(this.get(),r(a,b))))},addBack:function(a){return this.add(null==a?this.prevObject:this.prevObject.filter(a))}});function J(a,b){while((a=a[b])&&1!==a.nodeType);return a}r.each({parent:function(a){var b=a.parentNode;return b&&11!==b.nodeType?b:null},parents:function(a){return y(a,"parentNode")},parentsUntil:function(a,b,c){return y(a,"parentNode",c)},next:function(a){return J(a,"nextSibling")},prev:function(a){return J(a,"previousSibling")},nextAll:function(a){return y(a,"nextSibling")},prevAll:function(a){return y(a,"previousSibling")},nextUntil:function(a,b,c){return y(a,"nextSibling",c)},prevUntil:function(a,b,c){return y(a,"previousSibling",c)},siblings:function(a){return z((a.parentNode||{}).firstChild,a)},children:function(a){return z(a.firstChild)},contents:function(a){return a.contentDocument||r.merge([],a.childNodes)}},function(a,b){r.fn[a]=function(c,d){var e=r.map(this,b,c);return"Until"!==a.slice(-5)&&(d=c),d&&"string"==typeof d&&(e=r.filter(d,e)),this.length>1&&(I[a]||r.uniqueSort(e),H.test(a)&&e.reverse()),this.pushStack(e)}});var K=/\S+/g;function L(a){var b={};return r.each(a.match(K)||[],function(a,c){b[c]=!0}),b}r.Callbacks=function(a){a="string"==typeof a?L(a):r.extend({},a);var b,c,d,e,f=[],g=[],h=-1,i=function(){for(e=a.once,d=b=!0;g.length;h=-1){c=g.shift();while(++h<f.length)f[h].apply(c[0],c[1])===!1&&a.stopOnFalse&&(h=f.length,c=!1)}a.memory||(c=!1),b=!1,e&&(f=c?[]:"")},j={add:function(){return f&&(c&&!b&&(h=f.length-1,g.push(c)),function d(b){r.each(b,function(b,c){r.isFunction(c)?a.unique&&j.has(c)||f.push(c):c&&c.length&&"string"!==r.type(c)&&d(c)})}(arguments),c&&!b&&i()),this},remove:function(){return r.each(arguments,function(a,b){var c;while((c=r.inArray(b,f,c))>-1)f.splice(c,1),c<=h&&h--}),this},has:function(a){return a?r.inArray(a,f)>-1:f.length>0},empty:function(){return f&&(f=[]),this},disable:function(){return e=g=[],f=c="",this},disabled:function(){return!f},lock:function(){return e=g=[],c||b||(f=c=""),this},locked:function(){return!!e},fireWith:function(a,c){return e||(c=c||[],c=[a,c.slice?c.slice():c],g.push(c),b||i()),this},fire:function(){return j.fireWith(this,arguments),this},fired:function(){return!!d}};return j};function M(a){return a}function N(a){throw a}function O(a,b,c){var d;try{a&&r.isFunction(d=a.promise)?d.call(a).done(b).fail(c):a&&r.isFunction(d=a.then)?d.call(a,b,c):b.call(void 0,a)}catch(a){c.call(void 0,a)}}r.extend({Deferred:function(b){var c=[["notify","progress",r.Callbacks("memory"),r.Callbacks("memory"),2],["resolve","done",r.Callbacks("once memory"),r.Callbacks("once memory"),0,"resolved"],["reject","fail",r.Callbacks("once memory"),r.Callbacks("once memory"),1,"rejected"]],d="pending",e={state:function(){return d},always:function(){return f.done(arguments).fail(arguments),this},"catch":function(a){return e.then(null,a)},pipe:function(){var a=arguments;return r.Deferred(function(b){r.each(c,function(c,d){var e=r.isFunction(a[d[4]])&&a[d[4]];f[d[1]](function(){var a=e&&e.apply(this,arguments);a&&r.isFunction(a.promise)?a.promise().progress(b.notify).done(b.resolve).fail(b.reject):b[d[0]+"With"](this,e?[a]:arguments)})}),a=null}).promise()},then:function(b,d,e){var f=0;function g(b,c,d,e){return function(){var h=this,i=arguments,j=function(){var a,j;if(!(b<f)){if(a=d.apply(h,i),a===c.promise())throw new TypeError("Thenable self-resolution");j=a&&("object"==typeof a||"function"==typeof a)&&a.then,r.isFunction(j)?e?j.call(a,g(f,c,M,e),g(f,c,N,e)):(f++,j.call(a,g(f,c,M,e),g(f,c,N,e),g(f,c,M,c.notifyWith))):(d!==M&&(h=void 0,i=[a]),(e||c.resolveWith)(h,i))}},k=e?j:function(){try{j()}catch(a){r.Deferred.exceptionHook&&r.Deferred.exceptionHook(a,k.stackTrace),b+1>=f&&(d!==N&&(h=void 0,i=[a]),c.rejectWith(h,i))}};b?k():(r.Deferred.getStackHook&&(k.stackTrace=r.Deferred.getStackHook()),a.setTimeout(k))}}return r.Deferred(function(a){c[0][3].add(g(0,a,r.isFunction(e)?e:M,a.notifyWith)),c[1][3].add(g(0,a,r.isFunction(b)?b:M)),c[2][3].add(g(0,a,r.isFunction(d)?d:N))}).promise()},promise:function(a){return null!=a?r.extend(a,e):e}},f={};return r.each(c,function(a,b){var g=b[2],h=b[5];e[b[1]]=g.add,h&&g.add(function(){d=h},c[3-a][2].disable,c[0][2].lock),g.add(b[3].fire),f[b[0]]=function(){return f[b[0]+"With"](this===f?void 0:this,arguments),this},f[b[0]+"With"]=g.fireWith}),e.promise(f),b&&b.call(f,f),f},when:function(a){var b=arguments.length,c=b,d=Array(c),e=f.call(arguments),g=r.Deferred(),h=function(a){return function(c){d[a]=this,e[a]=arguments.length>1?f.call(arguments):c,--b||g.resolveWith(d,e)}};if(b<=1&&(O(a,g.done(h(c)).resolve,g.reject),"pending"===g.state()||r.isFunction(e[c]&&e[c].then)))return g.then();while(c--)O(e[c],h(c),g.reject);return g.promise()}});var P=/^(Eval|Internal|Range|Reference|Syntax|Type|URI)Error$/;r.Deferred.exceptionHook=function(b,c){a.console&&a.console.warn&&b&&P.test(b.name)&&a.console.warn("jQuery.Deferred exception: "+b.message,b.stack,c)},r.readyException=function(b){a.setTimeout(function(){throw b})};var Q=r.Deferred();r.fn.ready=function(a){return Q.then(a)["catch"](function(a){r.readyException(a)}),this},r.extend({isReady:!1,readyWait:1,holdReady:function(a){a?r.readyWait++:r.ready(!0)},ready:function(a){(a===!0?--r.readyWait:r.isReady)||(r.isReady=!0,a!==!0&&--r.readyWait>0||Q.resolveWith(d,[r]))}}),r.ready.then=Q.then;function R(){d.removeEventListener("DOMContentLoaded",R),a.removeEventListener("load",R),r.ready()}"complete"===d.readyState||"loading"!==d.readyState&&!d.documentElement.doScroll?a.setTimeout(r.ready):(d.addEventListener("DOMContentLoaded",R),a.addEventListener("load",R));var S=function(a,b,c,d,e,f,g){var h=0,i=a.length,j=null==c;if("object"===r.type(c)){e=!0;for(h in c)S(a,b,h,c[h],!0,f,g)}else if(void 0!==d&&(e=!0, +r.isFunction(d)||(g=!0),j&&(g?(b.call(a,d),b=null):(j=b,b=function(a,b,c){return j.call(r(a),c)})),b))for(;h<i;h++)b(a[h],c,g?d:d.call(a[h],h,b(a[h],c)));return e?a:j?b.call(a):i?b(a[0],c):f},T=function(a){return 1===a.nodeType||9===a.nodeType||!+a.nodeType};function U(){this.expando=r.expando+U.uid++}U.uid=1,U.prototype={cache:function(a){var b=a[this.expando];return b||(b={},T(a)&&(a.nodeType?a[this.expando]=b:Object.defineProperty(a,this.expando,{value:b,configurable:!0}))),b},set:function(a,b,c){var d,e=this.cache(a);if("string"==typeof b)e[r.camelCase(b)]=c;else for(d in b)e[r.camelCase(d)]=b[d];return e},get:function(a,b){return void 0===b?this.cache(a):a[this.expando]&&a[this.expando][r.camelCase(b)]},access:function(a,b,c){return void 0===b||b&&"string"==typeof b&&void 0===c?this.get(a,b):(this.set(a,b,c),void 0!==c?c:b)},remove:function(a,b){var c,d=a[this.expando];if(void 0!==d){if(void 0!==b){r.isArray(b)?b=b.map(r.camelCase):(b=r.camelCase(b),b=b in d?[b]:b.match(K)||[]),c=b.length;while(c--)delete d[b[c]]}(void 0===b||r.isEmptyObject(d))&&(a.nodeType?a[this.expando]=void 0:delete a[this.expando])}},hasData:function(a){var b=a[this.expando];return void 0!==b&&!r.isEmptyObject(b)}};var V=new U,W=new U,X=/^(?:\{[\w\W]*\}|\[[\w\W]*\])$/,Y=/[A-Z]/g;function Z(a,b,c){var d;if(void 0===c&&1===a.nodeType)if(d="data-"+b.replace(Y,"-$&").toLowerCase(),c=a.getAttribute(d),"string"==typeof c){try{c="true"===c||"false"!==c&&("null"===c?null:+c+""===c?+c:X.test(c)?JSON.parse(c):c)}catch(e){}W.set(a,b,c)}else c=void 0;return c}r.extend({hasData:function(a){return W.hasData(a)||V.hasData(a)},data:function(a,b,c){return W.access(a,b,c)},removeData:function(a,b){W.remove(a,b)},_data:function(a,b,c){return V.access(a,b,c)},_removeData:function(a,b){V.remove(a,b)}}),r.fn.extend({data:function(a,b){var c,d,e,f=this[0],g=f&&f.attributes;if(void 0===a){if(this.length&&(e=W.get(f),1===f.nodeType&&!V.get(f,"hasDataAttrs"))){c=g.length;while(c--)g[c]&&(d=g[c].name,0===d.indexOf("data-")&&(d=r.camelCase(d.slice(5)),Z(f,d,e[d])));V.set(f,"hasDataAttrs",!0)}return e}return"object"==typeof a?this.each(function(){W.set(this,a)}):S(this,function(b){var c;if(f&&void 0===b){if(c=W.get(f,a),void 0!==c)return c;if(c=Z(f,a),void 0!==c)return c}else this.each(function(){W.set(this,a,b)})},null,b,arguments.length>1,null,!0)},removeData:function(a){return this.each(function(){W.remove(this,a)})}}),r.extend({queue:function(a,b,c){var d;if(a)return b=(b||"fx")+"queue",d=V.get(a,b),c&&(!d||r.isArray(c)?d=V.access(a,b,r.makeArray(c)):d.push(c)),d||[]},dequeue:function(a,b){b=b||"fx";var c=r.queue(a,b),d=c.length,e=c.shift(),f=r._queueHooks(a,b),g=function(){r.dequeue(a,b)};"inprogress"===e&&(e=c.shift(),d--),e&&("fx"===b&&c.unshift("inprogress"),delete f.stop,e.call(a,g,f)),!d&&f&&f.empty.fire()},_queueHooks:function(a,b){var c=b+"queueHooks";return V.get(a,c)||V.access(a,c,{empty:r.Callbacks("once memory").add(function(){V.remove(a,[b+"queue",c])})})}}),r.fn.extend({queue:function(a,b){var c=2;return"string"!=typeof a&&(b=a,a="fx",c--),arguments.length<c?r.queue(this[0],a):void 0===b?this:this.each(function(){var c=r.queue(this,a,b);r._queueHooks(this,a),"fx"===a&&"inprogress"!==c[0]&&r.dequeue(this,a)})},dequeue:function(a){return this.each(function(){r.dequeue(this,a)})},clearQueue:function(a){return this.queue(a||"fx",[])},promise:function(a,b){var c,d=1,e=r.Deferred(),f=this,g=this.length,h=function(){--d||e.resolveWith(f,[f])};"string"!=typeof a&&(b=a,a=void 0),a=a||"fx";while(g--)c=V.get(f[g],a+"queueHooks"),c&&c.empty&&(d++,c.empty.add(h));return h(),e.promise(b)}});var $=/[+-]?(?:\d*\.|)\d+(?:[eE][+-]?\d+|)/.source,_=new RegExp("^(?:([+-])=|)("+$+")([a-z%]*)$","i"),aa=["Top","Right","Bottom","Left"],ba=function(a,b){return a=b||a,"none"===a.style.display||""===a.style.display&&r.contains(a.ownerDocument,a)&&"none"===r.css(a,"display")},ca=function(a,b,c,d){var e,f,g={};for(f in b)g[f]=a.style[f],a.style[f]=b[f];e=c.apply(a,d||[]);for(f in b)a.style[f]=g[f];return e};function da(a,b,c,d){var e,f=1,g=20,h=d?function(){return d.cur()}:function(){return r.css(a,b,"")},i=h(),j=c&&c[3]||(r.cssNumber[b]?"":"px"),k=(r.cssNumber[b]||"px"!==j&&+i)&&_.exec(r.css(a,b));if(k&&k[3]!==j){j=j||k[3],c=c||[],k=+i||1;do f=f||".5",k/=f,r.style(a,b,k+j);while(f!==(f=h()/i)&&1!==f&&--g)}return c&&(k=+k||+i||0,e=c[1]?k+(c[1]+1)*c[2]:+c[2],d&&(d.unit=j,d.start=k,d.end=e)),e}var ea={};function fa(a){var b,c=a.ownerDocument,d=a.nodeName,e=ea[d];return e?e:(b=c.body.appendChild(c.createElement(d)),e=r.css(b,"display"),b.parentNode.removeChild(b),"none"===e&&(e="block"),ea[d]=e,e)}function ga(a,b){for(var c,d,e=[],f=0,g=a.length;f<g;f++)d=a[f],d.style&&(c=d.style.display,b?("none"===c&&(e[f]=V.get(d,"display")||null,e[f]||(d.style.display="")),""===d.style.display&&ba(d)&&(e[f]=fa(d))):"none"!==c&&(e[f]="none",V.set(d,"display",c)));for(f=0;f<g;f++)null!=e[f]&&(a[f].style.display=e[f]);return a}r.fn.extend({show:function(){return ga(this,!0)},hide:function(){return ga(this)},toggle:function(a){return"boolean"==typeof a?a?this.show():this.hide():this.each(function(){ba(this)?r(this).show():r(this).hide()})}});var ha=/^(?:checkbox|radio)$/i,ia=/<([a-z][^\/\0>\x20\t\r\n\f]+)/i,ja=/^$|\/(?:java|ecma)script/i,ka={option:[1,"<select multiple='multiple'>","</select>"],thead:[1,"<table>","</table>"],col:[2,"<table><colgroup>","</colgroup></table>"],tr:[2,"<table><tbody>","</tbody></table>"],td:[3,"<table><tbody><tr>","</tr></tbody></table>"],_default:[0,"",""]};ka.optgroup=ka.option,ka.tbody=ka.tfoot=ka.colgroup=ka.caption=ka.thead,ka.th=ka.td;function la(a,b){var c="undefined"!=typeof a.getElementsByTagName?a.getElementsByTagName(b||"*"):"undefined"!=typeof a.querySelectorAll?a.querySelectorAll(b||"*"):[];return void 0===b||b&&r.nodeName(a,b)?r.merge([a],c):c}function ma(a,b){for(var c=0,d=a.length;c<d;c++)V.set(a[c],"globalEval",!b||V.get(b[c],"globalEval"))}var na=/<|&#?\w+;/;function oa(a,b,c,d,e){for(var f,g,h,i,j,k,l=b.createDocumentFragment(),m=[],n=0,o=a.length;n<o;n++)if(f=a[n],f||0===f)if("object"===r.type(f))r.merge(m,f.nodeType?[f]:f);else if(na.test(f)){g=g||l.appendChild(b.createElement("div")),h=(ia.exec(f)||["",""])[1].toLowerCase(),i=ka[h]||ka._default,g.innerHTML=i[1]+r.htmlPrefilter(f)+i[2],k=i[0];while(k--)g=g.lastChild;r.merge(m,g.childNodes),g=l.firstChild,g.textContent=""}else m.push(b.createTextNode(f));l.textContent="",n=0;while(f=m[n++])if(d&&r.inArray(f,d)>-1)e&&e.push(f);else if(j=r.contains(f.ownerDocument,f),g=la(l.appendChild(f),"script"),j&&ma(g),c){k=0;while(f=g[k++])ja.test(f.type||"")&&c.push(f)}return l}!function(){var a=d.createDocumentFragment(),b=a.appendChild(d.createElement("div")),c=d.createElement("input");c.setAttribute("type","radio"),c.setAttribute("checked","checked"),c.setAttribute("name","t"),b.appendChild(c),o.checkClone=b.cloneNode(!0).cloneNode(!0).lastChild.checked,b.innerHTML="<textarea>x</textarea>",o.noCloneChecked=!!b.cloneNode(!0).lastChild.defaultValue}();var pa=d.documentElement,qa=/^key/,ra=/^(?:mouse|pointer|contextmenu|drag|drop)|click/,sa=/^([^.]*)(?:\.(.+)|)/;function ta(){return!0}function ua(){return!1}function va(){try{return d.activeElement}catch(a){}}function wa(a,b,c,d,e,f){var g,h;if("object"==typeof b){"string"!=typeof c&&(d=d||c,c=void 0);for(h in b)wa(a,h,c,d,b[h],f);return a}if(null==d&&null==e?(e=c,d=c=void 0):null==e&&("string"==typeof c?(e=d,d=void 0):(e=d,d=c,c=void 0)),e===!1)e=ua;else if(!e)return a;return 1===f&&(g=e,e=function(a){return r().off(a),g.apply(this,arguments)},e.guid=g.guid||(g.guid=r.guid++)),a.each(function(){r.event.add(this,b,e,d,c)})}r.event={global:{},add:function(a,b,c,d,e){var f,g,h,i,j,k,l,m,n,o,p,q=V.get(a);if(q){c.handler&&(f=c,c=f.handler,e=f.selector),e&&r.find.matchesSelector(pa,e),c.guid||(c.guid=r.guid++),(i=q.events)||(i=q.events={}),(g=q.handle)||(g=q.handle=function(b){return"undefined"!=typeof r&&r.event.triggered!==b.type?r.event.dispatch.apply(a,arguments):void 0}),b=(b||"").match(K)||[""],j=b.length;while(j--)h=sa.exec(b[j])||[],n=p=h[1],o=(h[2]||"").split(".").sort(),n&&(l=r.event.special[n]||{},n=(e?l.delegateType:l.bindType)||n,l=r.event.special[n]||{},k=r.extend({type:n,origType:p,data:d,handler:c,guid:c.guid,selector:e,needsContext:e&&r.expr.match.needsContext.test(e),namespace:o.join(".")},f),(m=i[n])||(m=i[n]=[],m.delegateCount=0,l.setup&&l.setup.call(a,d,o,g)!==!1||a.addEventListener&&a.addEventListener(n,g)),l.add&&(l.add.call(a,k),k.handler.guid||(k.handler.guid=c.guid)),e?m.splice(m.delegateCount++,0,k):m.push(k),r.event.global[n]=!0)}},remove:function(a,b,c,d,e){var f,g,h,i,j,k,l,m,n,o,p,q=V.hasData(a)&&V.get(a);if(q&&(i=q.events)){b=(b||"").match(K)||[""],j=b.length;while(j--)if(h=sa.exec(b[j])||[],n=p=h[1],o=(h[2]||"").split(".").sort(),n){l=r.event.special[n]||{},n=(d?l.delegateType:l.bindType)||n,m=i[n]||[],h=h[2]&&new RegExp("(^|\\.)"+o.join("\\.(?:.*\\.|)")+"(\\.|$)"),g=f=m.length;while(f--)k=m[f],!e&&p!==k.origType||c&&c.guid!==k.guid||h&&!h.test(k.namespace)||d&&d!==k.selector&&("**"!==d||!k.selector)||(m.splice(f,1),k.selector&&m.delegateCount--,l.remove&&l.remove.call(a,k));g&&!m.length&&(l.teardown&&l.teardown.call(a,o,q.handle)!==!1||r.removeEvent(a,n,q.handle),delete i[n])}else for(n in i)r.event.remove(a,n+b[j],c,d,!0);r.isEmptyObject(i)&&V.remove(a,"handle events")}},dispatch:function(a){var b=r.event.fix(a),c,d,e,f,g,h,i=new Array(arguments.length),j=(V.get(this,"events")||{})[b.type]||[],k=r.event.special[b.type]||{};for(i[0]=b,c=1;c<arguments.length;c++)i[c]=arguments[c];if(b.delegateTarget=this,!k.preDispatch||k.preDispatch.call(this,b)!==!1){h=r.event.handlers.call(this,b,j),c=0;while((f=h[c++])&&!b.isPropagationStopped()){b.currentTarget=f.elem,d=0;while((g=f.handlers[d++])&&!b.isImmediatePropagationStopped())b.rnamespace&&!b.rnamespace.test(g.namespace)||(b.handleObj=g,b.data=g.data,e=((r.event.special[g.origType]||{}).handle||g.handler).apply(f.elem,i),void 0!==e&&(b.result=e)===!1&&(b.preventDefault(),b.stopPropagation()))}return k.postDispatch&&k.postDispatch.call(this,b),b.result}},handlers:function(a,b){var c,d,e,f,g=[],h=b.delegateCount,i=a.target;if(h&&i.nodeType&&("click"!==a.type||isNaN(a.button)||a.button<1))for(;i!==this;i=i.parentNode||this)if(1===i.nodeType&&(i.disabled!==!0||"click"!==a.type)){for(d=[],c=0;c<h;c++)f=b[c],e=f.selector+" ",void 0===d[e]&&(d[e]=f.needsContext?r(e,this).index(i)>-1:r.find(e,this,null,[i]).length),d[e]&&d.push(f);d.length&&g.push({elem:i,handlers:d})}return h<b.length&&g.push({elem:this,handlers:b.slice(h)}),g},addProp:function(a,b){Object.defineProperty(r.Event.prototype,a,{enumerable:!0,configurable:!0,get:r.isFunction(b)?function(){if(this.originalEvent)return b(this.originalEvent)}:function(){if(this.originalEvent)return this.originalEvent[a]},set:function(b){Object.defineProperty(this,a,{enumerable:!0,configurable:!0,writable:!0,value:b})}})},fix:function(a){return a[r.expando]?a:new r.Event(a)},special:{load:{noBubble:!0},focus:{trigger:function(){if(this!==va()&&this.focus)return this.focus(),!1},delegateType:"focusin"},blur:{trigger:function(){if(this===va()&&this.blur)return this.blur(),!1},delegateType:"focusout"},click:{trigger:function(){if("checkbox"===this.type&&this.click&&r.nodeName(this,"input"))return this.click(),!1},_default:function(a){return r.nodeName(a.target,"a")}},beforeunload:{postDispatch:function(a){void 0!==a.result&&a.originalEvent&&(a.originalEvent.returnValue=a.result)}}}},r.removeEvent=function(a,b,c){a.removeEventListener&&a.removeEventListener(b,c)},r.Event=function(a,b){return this instanceof r.Event?(a&&a.type?(this.originalEvent=a,this.type=a.type,this.isDefaultPrevented=a.defaultPrevented||void 0===a.defaultPrevented&&a.returnValue===!1?ta:ua,this.target=a.target&&3===a.target.nodeType?a.target.parentNode:a.target,this.currentTarget=a.currentTarget,this.relatedTarget=a.relatedTarget):this.type=a,b&&r.extend(this,b),this.timeStamp=a&&a.timeStamp||r.now(),void(this[r.expando]=!0)):new r.Event(a,b)},r.Event.prototype={constructor:r.Event,isDefaultPrevented:ua,isPropagationStopped:ua,isImmediatePropagationStopped:ua,isSimulated:!1,preventDefault:function(){var a=this.originalEvent;this.isDefaultPrevented=ta,a&&!this.isSimulated&&a.preventDefault()},stopPropagation:function(){var a=this.originalEvent;this.isPropagationStopped=ta,a&&!this.isSimulated&&a.stopPropagation()},stopImmediatePropagation:function(){var a=this.originalEvent;this.isImmediatePropagationStopped=ta,a&&!this.isSimulated&&a.stopImmediatePropagation(),this.stopPropagation()}},r.each({altKey:!0,bubbles:!0,cancelable:!0,changedTouches:!0,ctrlKey:!0,detail:!0,eventPhase:!0,metaKey:!0,pageX:!0,pageY:!0,shiftKey:!0,view:!0,"char":!0,charCode:!0,key:!0,keyCode:!0,button:!0,buttons:!0,clientX:!0,clientY:!0,offsetX:!0,offsetY:!0,pointerId:!0,pointerType:!0,screenX:!0,screenY:!0,targetTouches:!0,toElement:!0,touches:!0,which:function(a){var b=a.button;return null==a.which&&qa.test(a.type)?null!=a.charCode?a.charCode:a.keyCode:!a.which&&void 0!==b&&ra.test(a.type)?1&b?1:2&b?3:4&b?2:0:a.which}},r.event.addProp),r.each({mouseenter:"mouseover",mouseleave:"mouseout",pointerenter:"pointerover",pointerleave:"pointerout"},function(a,b){r.event.special[a]={delegateType:b,bindType:b,handle:function(a){var c,d=this,e=a.relatedTarget,f=a.handleObj;return e&&(e===d||r.contains(d,e))||(a.type=f.origType,c=f.handler.apply(this,arguments),a.type=b),c}}}),r.fn.extend({on:function(a,b,c,d){return wa(this,a,b,c,d)},one:function(a,b,c,d){return wa(this,a,b,c,d,1)},off:function(a,b,c){var d,e;if(a&&a.preventDefault&&a.handleObj)return d=a.handleObj,r(a.delegateTarget).off(d.namespace?d.origType+"."+d.namespace:d.origType,d.selector,d.handler),this;if("object"==typeof a){for(e in a)this.off(e,b,a[e]);return this}return b!==!1&&"function"!=typeof b||(c=b,b=void 0),c===!1&&(c=ua),this.each(function(){r.event.remove(this,a,c,b)})}});var xa=/<(?!area|br|col|embed|hr|img|input|link|meta|param)(([a-z][^\/\0>\x20\t\r\n\f]*)[^>]*)\/>/gi,ya=/<script|<style|<link/i,za=/checked\s*(?:[^=]|=\s*.checked.)/i,Aa=/^true\/(.*)/,Ba=/^\s*<!(?:\[CDATA\[|--)|(?:\]\]|--)>\s*$/g;function Ca(a,b){return r.nodeName(a,"table")&&r.nodeName(11!==b.nodeType?b:b.firstChild,"tr")?a.getElementsByTagName("tbody")[0]||a:a}function Da(a){return a.type=(null!==a.getAttribute("type"))+"/"+a.type,a}function Ea(a){var b=Aa.exec(a.type);return b?a.type=b[1]:a.removeAttribute("type"),a}function Fa(a,b){var c,d,e,f,g,h,i,j;if(1===b.nodeType){if(V.hasData(a)&&(f=V.access(a),g=V.set(b,f),j=f.events)){delete g.handle,g.events={};for(e in j)for(c=0,d=j[e].length;c<d;c++)r.event.add(b,e,j[e][c])}W.hasData(a)&&(h=W.access(a),i=r.extend({},h),W.set(b,i))}}function Ga(a,b){var c=b.nodeName.toLowerCase();"input"===c&&ha.test(a.type)?b.checked=a.checked:"input"!==c&&"textarea"!==c||(b.defaultValue=a.defaultValue)}function Ha(a,b,c,d){b=g.apply([],b);var e,f,h,i,j,k,l=0,m=a.length,n=m-1,q=b[0],s=r.isFunction(q);if(s||m>1&&"string"==typeof q&&!o.checkClone&&za.test(q))return a.each(function(e){var f=a.eq(e);s&&(b[0]=q.call(this,e,f.html())),Ha(f,b,c,d)});if(m&&(e=oa(b,a[0].ownerDocument,!1,a,d),f=e.firstChild,1===e.childNodes.length&&(e=f),f||d)){for(h=r.map(la(e,"script"),Da),i=h.length;l<m;l++)j=e,l!==n&&(j=r.clone(j,!0,!0),i&&r.merge(h,la(j,"script"))),c.call(a[l],j,l);if(i)for(k=h[h.length-1].ownerDocument,r.map(h,Ea),l=0;l<i;l++)j=h[l],ja.test(j.type||"")&&!V.access(j,"globalEval")&&r.contains(k,j)&&(j.src?r._evalUrl&&r._evalUrl(j.src):p(j.textContent.replace(Ba,""),k))}return a}function Ia(a,b,c){for(var d,e=b?r.filter(b,a):a,f=0;null!=(d=e[f]);f++)c||1!==d.nodeType||r.cleanData(la(d)),d.parentNode&&(c&&r.contains(d.ownerDocument,d)&&ma(la(d,"script")),d.parentNode.removeChild(d));return a}r.extend({htmlPrefilter:function(a){return a.replace(xa,"<$1></$2>")},clone:function(a,b,c){var d,e,f,g,h=a.cloneNode(!0),i=r.contains(a.ownerDocument,a);if(!(o.noCloneChecked||1!==a.nodeType&&11!==a.nodeType||r.isXMLDoc(a)))for(g=la(h),f=la(a),d=0,e=f.length;d<e;d++)Ga(f[d],g[d]);if(b)if(c)for(f=f||la(a),g=g||la(h),d=0,e=f.length;d<e;d++)Fa(f[d],g[d]);else Fa(a,h);return g=la(h,"script"),g.length>0&&ma(g,!i&&la(a,"script")),h},cleanData:function(a){for(var b,c,d,e=r.event.special,f=0;void 0!==(c=a[f]);f++)if(T(c)){if(b=c[V.expando]){if(b.events)for(d in b.events)e[d]?r.event.remove(c,d):r.removeEvent(c,d,b.handle);c[V.expando]=void 0}c[W.expando]&&(c[W.expando]=void 0)}}}),r.fn.extend({detach:function(a){return Ia(this,a,!0)},remove:function(a){return Ia(this,a)},text:function(a){return S(this,function(a){return void 0===a?r.text(this):this.empty().each(function(){1!==this.nodeType&&11!==this.nodeType&&9!==this.nodeType||(this.textContent=a)})},null,a,arguments.length)},append:function(){return Ha(this,arguments,function(a){if(1===this.nodeType||11===this.nodeType||9===this.nodeType){var b=Ca(this,a);b.appendChild(a)}})},prepend:function(){return Ha(this,arguments,function(a){if(1===this.nodeType||11===this.nodeType||9===this.nodeType){var b=Ca(this,a);b.insertBefore(a,b.firstChild)}})},before:function(){return Ha(this,arguments,function(a){this.parentNode&&this.parentNode.insertBefore(a,this)})},after:function(){return Ha(this,arguments,function(a){this.parentNode&&this.parentNode.insertBefore(a,this.nextSibling)})},empty:function(){for(var a,b=0;null!=(a=this[b]);b++)1===a.nodeType&&(r.cleanData(la(a,!1)),a.textContent="");return this},clone:function(a,b){return a=null!=a&&a,b=null==b?a:b,this.map(function(){return r.clone(this,a,b)})},html:function(a){return S(this,function(a){var b=this[0]||{},c=0,d=this.length;if(void 0===a&&1===b.nodeType)return b.innerHTML;if("string"==typeof a&&!ya.test(a)&&!ka[(ia.exec(a)||["",""])[1].toLowerCase()]){a=r.htmlPrefilter(a);try{for(;c<d;c++)b=this[c]||{},1===b.nodeType&&(r.cleanData(la(b,!1)),b.innerHTML=a);b=0}catch(e){}}b&&this.empty().append(a)},null,a,arguments.length)},replaceWith:function(){var a=[];return Ha(this,arguments,function(b){var c=this.parentNode;r.inArray(this,a)<0&&(r.cleanData(la(this)),c&&c.replaceChild(b,this))},a)}}),r.each({appendTo:"append",prependTo:"prepend",insertBefore:"before",insertAfter:"after",replaceAll:"replaceWith"},function(a,b){r.fn[a]=function(a){for(var c,d=[],e=r(a),f=e.length-1,g=0;g<=f;g++)c=g===f?this:this.clone(!0),r(e[g])[b](c),h.apply(d,c.get());return this.pushStack(d)}});var Ja=/^margin/,Ka=new RegExp("^("+$+")(?!px)[a-z%]+$","i"),La=function(b){var c=b.ownerDocument.defaultView;return c&&c.opener||(c=a),c.getComputedStyle(b)};!function(){function b(){if(i){i.style.cssText="box-sizing:border-box;position:relative;display:block;margin:auto;border:1px;padding:1px;top:1%;width:50%",i.innerHTML="",pa.appendChild(h);var b=a.getComputedStyle(i);c="1%"!==b.top,g="2px"===b.marginLeft,e="4px"===b.width,i.style.marginRight="50%",f="4px"===b.marginRight,pa.removeChild(h),i=null}}var c,e,f,g,h=d.createElement("div"),i=d.createElement("div");i.style&&(i.style.backgroundClip="content-box",i.cloneNode(!0).style.backgroundClip="",o.clearCloneStyle="content-box"===i.style.backgroundClip,h.style.cssText="border:0;width:8px;height:0;top:0;left:-9999px;padding:0;margin-top:1px;position:absolute",h.appendChild(i),r.extend(o,{pixelPosition:function(){return b(),c},boxSizingReliable:function(){return b(),e},pixelMarginRight:function(){return b(),f},reliableMarginLeft:function(){return b(),g}}))}();function Ma(a,b,c){var d,e,f,g,h=a.style;return c=c||La(a),c&&(g=c.getPropertyValue(b)||c[b],""!==g||r.contains(a.ownerDocument,a)||(g=r.style(a,b)),!o.pixelMarginRight()&&Ka.test(g)&&Ja.test(b)&&(d=h.width,e=h.minWidth,f=h.maxWidth,h.minWidth=h.maxWidth=h.width=g,g=c.width,h.width=d,h.minWidth=e,h.maxWidth=f)),void 0!==g?g+"":g}function Na(a,b){return{get:function(){return a()?void delete this.get:(this.get=b).apply(this,arguments)}}}var Oa=/^(none|table(?!-c[ea]).+)/,Pa={position:"absolute",visibility:"hidden",display:"block"},Qa={letterSpacing:"0",fontWeight:"400"},Ra=["Webkit","Moz","ms"],Sa=d.createElement("div").style;function Ta(a){if(a in Sa)return a;var b=a[0].toUpperCase()+a.slice(1),c=Ra.length;while(c--)if(a=Ra[c]+b,a in Sa)return a}function Ua(a,b,c){var d=_.exec(b);return d?Math.max(0,d[2]-(c||0))+(d[3]||"px"):b}function Va(a,b,c,d,e){for(var f=c===(d?"border":"content")?4:"width"===b?1:0,g=0;f<4;f+=2)"margin"===c&&(g+=r.css(a,c+aa[f],!0,e)),d?("content"===c&&(g-=r.css(a,"padding"+aa[f],!0,e)),"margin"!==c&&(g-=r.css(a,"border"+aa[f]+"Width",!0,e))):(g+=r.css(a,"padding"+aa[f],!0,e),"padding"!==c&&(g+=r.css(a,"border"+aa[f]+"Width",!0,e)));return g}function Wa(a,b,c){var d,e=!0,f=La(a),g="border-box"===r.css(a,"boxSizing",!1,f);if(a.getClientRects().length&&(d=a.getBoundingClientRect()[b]),d<=0||null==d){if(d=Ma(a,b,f),(d<0||null==d)&&(d=a.style[b]),Ka.test(d))return d;e=g&&(o.boxSizingReliable()||d===a.style[b]),d=parseFloat(d)||0}return d+Va(a,b,c||(g?"border":"content"),e,f)+"px"}r.extend({cssHooks:{opacity:{get:function(a,b){if(b){var c=Ma(a,"opacity");return""===c?"1":c}}}},cssNumber:{animationIterationCount:!0,columnCount:!0,fillOpacity:!0,flexGrow:!0,flexShrink:!0,fontWeight:!0,lineHeight:!0,opacity:!0,order:!0,orphans:!0,widows:!0,zIndex:!0,zoom:!0},cssProps:{"float":"cssFloat"},style:function(a,b,c,d){if(a&&3!==a.nodeType&&8!==a.nodeType&&a.style){var e,f,g,h=r.camelCase(b),i=a.style;return b=r.cssProps[h]||(r.cssProps[h]=Ta(h)||h),g=r.cssHooks[b]||r.cssHooks[h],void 0===c?g&&"get"in g&&void 0!==(e=g.get(a,!1,d))?e:i[b]:(f=typeof c,"string"===f&&(e=_.exec(c))&&e[1]&&(c=da(a,b,e),f="number"),null!=c&&c===c&&("number"===f&&(c+=e&&e[3]||(r.cssNumber[h]?"":"px")),o.clearCloneStyle||""!==c||0!==b.indexOf("background")||(i[b]="inherit"),g&&"set"in g&&void 0===(c=g.set(a,c,d))||(i[b]=c)),void 0)}},css:function(a,b,c,d){var e,f,g,h=r.camelCase(b);return b=r.cssProps[h]||(r.cssProps[h]=Ta(h)||h),g=r.cssHooks[b]||r.cssHooks[h],g&&"get"in g&&(e=g.get(a,!0,c)),void 0===e&&(e=Ma(a,b,d)),"normal"===e&&b in Qa&&(e=Qa[b]),""===c||c?(f=parseFloat(e),c===!0||isFinite(f)?f||0:e):e}}),r.each(["height","width"],function(a,b){r.cssHooks[b]={get:function(a,c,d){if(c)return!Oa.test(r.css(a,"display"))||a.getClientRects().length&&a.getBoundingClientRect().width?Wa(a,b,d):ca(a,Pa,function(){return Wa(a,b,d)})},set:function(a,c,d){var e,f=d&&La(a),g=d&&Va(a,b,d,"border-box"===r.css(a,"boxSizing",!1,f),f);return g&&(e=_.exec(c))&&"px"!==(e[3]||"px")&&(a.style[b]=c,c=r.css(a,b)),Ua(a,c,g)}}}),r.cssHooks.marginLeft=Na(o.reliableMarginLeft,function(a,b){if(b)return(parseFloat(Ma(a,"marginLeft"))||a.getBoundingClientRect().left-ca(a,{marginLeft:0},function(){return a.getBoundingClientRect().left}))+"px"}),r.each({margin:"",padding:"",border:"Width"},function(a,b){r.cssHooks[a+b]={expand:function(c){for(var d=0,e={},f="string"==typeof c?c.split(" "):[c];d<4;d++)e[a+aa[d]+b]=f[d]||f[d-2]||f[0];return e}},Ja.test(a)||(r.cssHooks[a+b].set=Ua)}),r.fn.extend({css:function(a,b){return S(this,function(a,b,c){var d,e,f={},g=0;if(r.isArray(b)){for(d=La(a),e=b.length;g<e;g++)f[b[g]]=r.css(a,b[g],!1,d);return f}return void 0!==c?r.style(a,b,c):r.css(a,b)},a,b,arguments.length>1)}});function Xa(a,b,c,d,e){return new Xa.prototype.init(a,b,c,d,e)}r.Tween=Xa,Xa.prototype={constructor:Xa,init:function(a,b,c,d,e,f){this.elem=a,this.prop=c,this.easing=e||r.easing._default,this.options=b,this.start=this.now=this.cur(),this.end=d,this.unit=f||(r.cssNumber[c]?"":"px")},cur:function(){var a=Xa.propHooks[this.prop];return a&&a.get?a.get(this):Xa.propHooks._default.get(this)},run:function(a){var b,c=Xa.propHooks[this.prop];return this.options.duration?this.pos=b=r.easing[this.easing](a,this.options.duration*a,0,1,this.options.duration):this.pos=b=a,this.now=(this.end-this.start)*b+this.start,this.options.step&&this.options.step.call(this.elem,this.now,this),c&&c.set?c.set(this):Xa.propHooks._default.set(this),this}},Xa.prototype.init.prototype=Xa.prototype,Xa.propHooks={_default:{get:function(a){var b;return 1!==a.elem.nodeType||null!=a.elem[a.prop]&&null==a.elem.style[a.prop]?a.elem[a.prop]:(b=r.css(a.elem,a.prop,""),b&&"auto"!==b?b:0)},set:function(a){r.fx.step[a.prop]?r.fx.step[a.prop](a):1!==a.elem.nodeType||null==a.elem.style[r.cssProps[a.prop]]&&!r.cssHooks[a.prop]?a.elem[a.prop]=a.now:r.style(a.elem,a.prop,a.now+a.unit)}}},Xa.propHooks.scrollTop=Xa.propHooks.scrollLeft={set:function(a){a.elem.nodeType&&a.elem.parentNode&&(a.elem[a.prop]=a.now)}},r.easing={linear:function(a){return a},swing:function(a){return.5-Math.cos(a*Math.PI)/2},_default:"swing"},r.fx=Xa.prototype.init,r.fx.step={};var Ya,Za,$a=/^(?:toggle|show|hide)$/,_a=/queueHooks$/;function ab(){Za&&(a.requestAnimationFrame(ab),r.fx.tick())}function bb(){return a.setTimeout(function(){Ya=void 0}),Ya=r.now()}function cb(a,b){var c,d=0,e={height:a};for(b=b?1:0;d<4;d+=2-b)c=aa[d],e["margin"+c]=e["padding"+c]=a;return b&&(e.opacity=e.width=a),e}function db(a,b,c){for(var d,e=(gb.tweeners[b]||[]).concat(gb.tweeners["*"]),f=0,g=e.length;f<g;f++)if(d=e[f].call(c,b,a))return d}function eb(a,b,c){var d,e,f,g,h,i,j,k,l="width"in b||"height"in b,m=this,n={},o=a.style,p=a.nodeType&&ba(a),q=V.get(a,"fxshow");c.queue||(g=r._queueHooks(a,"fx"),null==g.unqueued&&(g.unqueued=0,h=g.empty.fire,g.empty.fire=function(){g.unqueued||h()}),g.unqueued++,m.always(function(){m.always(function(){g.unqueued--,r.queue(a,"fx").length||g.empty.fire()})}));for(d in b)if(e=b[d],$a.test(e)){if(delete b[d],f=f||"toggle"===e,e===(p?"hide":"show")){if("show"!==e||!q||void 0===q[d])continue;p=!0}n[d]=q&&q[d]||r.style(a,d)}if(i=!r.isEmptyObject(b),i||!r.isEmptyObject(n)){l&&1===a.nodeType&&(c.overflow=[o.overflow,o.overflowX,o.overflowY],j=q&&q.display,null==j&&(j=V.get(a,"display")),k=r.css(a,"display"),"none"===k&&(j?k=j:(ga([a],!0),j=a.style.display||j,k=r.css(a,"display"),ga([a]))),("inline"===k||"inline-block"===k&&null!=j)&&"none"===r.css(a,"float")&&(i||(m.done(function(){o.display=j}),null==j&&(k=o.display,j="none"===k?"":k)),o.display="inline-block")),c.overflow&&(o.overflow="hidden",m.always(function(){o.overflow=c.overflow[0],o.overflowX=c.overflow[1],o.overflowY=c.overflow[2]})),i=!1;for(d in n)i||(q?"hidden"in q&&(p=q.hidden):q=V.access(a,"fxshow",{display:j}),f&&(q.hidden=!p),p&&ga([a],!0),m.done(function(){p||ga([a]),V.remove(a,"fxshow");for(d in n)r.style(a,d,n[d])})),i=db(p?q[d]:0,d,m),d in q||(q[d]=i.start,p&&(i.end=i.start,i.start=0))}}function fb(a,b){var c,d,e,f,g;for(c in a)if(d=r.camelCase(c),e=b[d],f=a[c],r.isArray(f)&&(e=f[1],f=a[c]=f[0]),c!==d&&(a[d]=f,delete a[c]),g=r.cssHooks[d],g&&"expand"in g){f=g.expand(f),delete a[d];for(c in f)c in a||(a[c]=f[c],b[c]=e)}else b[d]=e}function gb(a,b,c){var d,e,f=0,g=gb.prefilters.length,h=r.Deferred().always(function(){delete i.elem}),i=function(){if(e)return!1;for(var b=Ya||bb(),c=Math.max(0,j.startTime+j.duration-b),d=c/j.duration||0,f=1-d,g=0,i=j.tweens.length;g<i;g++)j.tweens[g].run(f);return h.notifyWith(a,[j,f,c]),f<1&&i?c:(h.resolveWith(a,[j]),!1)},j=h.promise({elem:a,props:r.extend({},b),opts:r.extend(!0,{specialEasing:{},easing:r.easing._default},c),originalProperties:b,originalOptions:c,startTime:Ya||bb(),duration:c.duration,tweens:[],createTween:function(b,c){var d=r.Tween(a,j.opts,b,c,j.opts.specialEasing[b]||j.opts.easing);return j.tweens.push(d),d},stop:function(b){var c=0,d=b?j.tweens.length:0;if(e)return this;for(e=!0;c<d;c++)j.tweens[c].run(1);return b?(h.notifyWith(a,[j,1,0]),h.resolveWith(a,[j,b])):h.rejectWith(a,[j,b]),this}}),k=j.props;for(fb(k,j.opts.specialEasing);f<g;f++)if(d=gb.prefilters[f].call(j,a,k,j.opts))return r.isFunction(d.stop)&&(r._queueHooks(j.elem,j.opts.queue).stop=r.proxy(d.stop,d)),d;return r.map(k,db,j),r.isFunction(j.opts.start)&&j.opts.start.call(a,j),r.fx.timer(r.extend(i,{elem:a,anim:j,queue:j.opts.queue})),j.progress(j.opts.progress).done(j.opts.done,j.opts.complete).fail(j.opts.fail).always(j.opts.always)}r.Animation=r.extend(gb,{tweeners:{"*":[function(a,b){var c=this.createTween(a,b);return da(c.elem,a,_.exec(b),c),c}]},tweener:function(a,b){r.isFunction(a)?(b=a,a=["*"]):a=a.match(K);for(var c,d=0,e=a.length;d<e;d++)c=a[d],gb.tweeners[c]=gb.tweeners[c]||[],gb.tweeners[c].unshift(b)},prefilters:[eb],prefilter:function(a,b){b?gb.prefilters.unshift(a):gb.prefilters.push(a)}}),r.speed=function(a,b,c){var e=a&&"object"==typeof a?r.extend({},a):{complete:c||!c&&b||r.isFunction(a)&&a,duration:a,easing:c&&b||b&&!r.isFunction(b)&&b};return r.fx.off||d.hidden?e.duration=0:e.duration="number"==typeof e.duration?e.duration:e.duration in r.fx.speeds?r.fx.speeds[e.duration]:r.fx.speeds._default,null!=e.queue&&e.queue!==!0||(e.queue="fx"),e.old=e.complete,e.complete=function(){r.isFunction(e.old)&&e.old.call(this),e.queue&&r.dequeue(this,e.queue)},e},r.fn.extend({fadeTo:function(a,b,c,d){return this.filter(ba).css("opacity",0).show().end().animate({opacity:b},a,c,d)},animate:function(a,b,c,d){var e=r.isEmptyObject(a),f=r.speed(b,c,d),g=function(){var b=gb(this,r.extend({},a),f);(e||V.get(this,"finish"))&&b.stop(!0)};return g.finish=g,e||f.queue===!1?this.each(g):this.queue(f.queue,g)},stop:function(a,b,c){var d=function(a){var b=a.stop;delete a.stop,b(c)};return"string"!=typeof a&&(c=b,b=a,a=void 0),b&&a!==!1&&this.queue(a||"fx",[]),this.each(function(){var b=!0,e=null!=a&&a+"queueHooks",f=r.timers,g=V.get(this);if(e)g[e]&&g[e].stop&&d(g[e]);else for(e in g)g[e]&&g[e].stop&&_a.test(e)&&d(g[e]);for(e=f.length;e--;)f[e].elem!==this||null!=a&&f[e].queue!==a||(f[e].anim.stop(c),b=!1,f.splice(e,1));!b&&c||r.dequeue(this,a)})},finish:function(a){return a!==!1&&(a=a||"fx"),this.each(function(){var b,c=V.get(this),d=c[a+"queue"],e=c[a+"queueHooks"],f=r.timers,g=d?d.length:0;for(c.finish=!0,r.queue(this,a,[]),e&&e.stop&&e.stop.call(this,!0),b=f.length;b--;)f[b].elem===this&&f[b].queue===a&&(f[b].anim.stop(!0),f.splice(b,1));for(b=0;b<g;b++)d[b]&&d[b].finish&&d[b].finish.call(this);delete c.finish})}}),r.each(["toggle","show","hide"],function(a,b){var c=r.fn[b];r.fn[b]=function(a,d,e){return null==a||"boolean"==typeof a?c.apply(this,arguments):this.animate(cb(b,!0),a,d,e)}}),r.each({slideDown:cb("show"),slideUp:cb("hide"),slideToggle:cb("toggle"),fadeIn:{opacity:"show"},fadeOut:{opacity:"hide"},fadeToggle:{opacity:"toggle"}},function(a,b){r.fn[a]=function(a,c,d){return this.animate(b,a,c,d)}}),r.timers=[],r.fx.tick=function(){var a,b=0,c=r.timers;for(Ya=r.now();b<c.length;b++)a=c[b],a()||c[b]!==a||c.splice(b--,1);c.length||r.fx.stop(),Ya=void 0},r.fx.timer=function(a){r.timers.push(a),a()?r.fx.start():r.timers.pop()},r.fx.interval=13,r.fx.start=function(){Za||(Za=a.requestAnimationFrame?a.requestAnimationFrame(ab):a.setInterval(r.fx.tick,r.fx.interval))},r.fx.stop=function(){a.cancelAnimationFrame?a.cancelAnimationFrame(Za):a.clearInterval(Za),Za=null},r.fx.speeds={slow:600,fast:200,_default:400},r.fn.delay=function(b,c){return b=r.fx?r.fx.speeds[b]||b:b,c=c||"fx",this.queue(c,function(c,d){var e=a.setTimeout(c,b);d.stop=function(){a.clearTimeout(e)}})},function(){var a=d.createElement("input"),b=d.createElement("select"),c=b.appendChild(d.createElement("option"));a.type="checkbox",o.checkOn=""!==a.value,o.optSelected=c.selected,a=d.createElement("input"),a.value="t",a.type="radio",o.radioValue="t"===a.value}();var hb,ib=r.expr.attrHandle;r.fn.extend({attr:function(a,b){return S(this,r.attr,a,b,arguments.length>1)},removeAttr:function(a){return this.each(function(){r.removeAttr(this,a)})}}),r.extend({attr:function(a,b,c){var d,e,f=a.nodeType;if(3!==f&&8!==f&&2!==f)return"undefined"==typeof a.getAttribute?r.prop(a,b,c):(1===f&&r.isXMLDoc(a)||(e=r.attrHooks[b.toLowerCase()]||(r.expr.match.bool.test(b)?hb:void 0)),void 0!==c?null===c?void r.removeAttr(a,b):e&&"set"in e&&void 0!==(d=e.set(a,c,b))?d:(a.setAttribute(b,c+""),c):e&&"get"in e&&null!==(d=e.get(a,b))?d:(d=r.find.attr(a,b),null==d?void 0:d))},attrHooks:{type:{set:function(a,b){if(!o.radioValue&&"radio"===b&&r.nodeName(a,"input")){var c=a.value;return a.setAttribute("type",b),c&&(a.value=c),b}}}},removeAttr:function(a,b){var c,d=0,e=b&&b.match(K); +if(e&&1===a.nodeType)while(c=e[d++])a.removeAttribute(c)}}),hb={set:function(a,b,c){return b===!1?r.removeAttr(a,c):a.setAttribute(c,c),c}},r.each(r.expr.match.bool.source.match(/\w+/g),function(a,b){var c=ib[b]||r.find.attr;ib[b]=function(a,b,d){var e,f,g=b.toLowerCase();return d||(f=ib[g],ib[g]=e,e=null!=c(a,b,d)?g:null,ib[g]=f),e}});var jb=/^(?:input|select|textarea|button)$/i,kb=/^(?:a|area)$/i;r.fn.extend({prop:function(a,b){return S(this,r.prop,a,b,arguments.length>1)},removeProp:function(a){return this.each(function(){delete this[r.propFix[a]||a]})}}),r.extend({prop:function(a,b,c){var d,e,f=a.nodeType;if(3!==f&&8!==f&&2!==f)return 1===f&&r.isXMLDoc(a)||(b=r.propFix[b]||b,e=r.propHooks[b]),void 0!==c?e&&"set"in e&&void 0!==(d=e.set(a,c,b))?d:a[b]=c:e&&"get"in e&&null!==(d=e.get(a,b))?d:a[b]},propHooks:{tabIndex:{get:function(a){var b=r.find.attr(a,"tabindex");return b?parseInt(b,10):jb.test(a.nodeName)||kb.test(a.nodeName)&&a.href?0:-1}}},propFix:{"for":"htmlFor","class":"className"}}),o.optSelected||(r.propHooks.selected={get:function(a){var b=a.parentNode;return b&&b.parentNode&&b.parentNode.selectedIndex,null},set:function(a){var b=a.parentNode;b&&(b.selectedIndex,b.parentNode&&b.parentNode.selectedIndex)}}),r.each(["tabIndex","readOnly","maxLength","cellSpacing","cellPadding","rowSpan","colSpan","useMap","frameBorder","contentEditable"],function(){r.propFix[this.toLowerCase()]=this});var lb=/[\t\r\n\f]/g;function mb(a){return a.getAttribute&&a.getAttribute("class")||""}r.fn.extend({addClass:function(a){var b,c,d,e,f,g,h,i=0;if(r.isFunction(a))return this.each(function(b){r(this).addClass(a.call(this,b,mb(this)))});if("string"==typeof a&&a){b=a.match(K)||[];while(c=this[i++])if(e=mb(c),d=1===c.nodeType&&(" "+e+" ").replace(lb," ")){g=0;while(f=b[g++])d.indexOf(" "+f+" ")<0&&(d+=f+" ");h=r.trim(d),e!==h&&c.setAttribute("class",h)}}return this},removeClass:function(a){var b,c,d,e,f,g,h,i=0;if(r.isFunction(a))return this.each(function(b){r(this).removeClass(a.call(this,b,mb(this)))});if(!arguments.length)return this.attr("class","");if("string"==typeof a&&a){b=a.match(K)||[];while(c=this[i++])if(e=mb(c),d=1===c.nodeType&&(" "+e+" ").replace(lb," ")){g=0;while(f=b[g++])while(d.indexOf(" "+f+" ")>-1)d=d.replace(" "+f+" "," ");h=r.trim(d),e!==h&&c.setAttribute("class",h)}}return this},toggleClass:function(a,b){var c=typeof a;return"boolean"==typeof b&&"string"===c?b?this.addClass(a):this.removeClass(a):r.isFunction(a)?this.each(function(c){r(this).toggleClass(a.call(this,c,mb(this),b),b)}):this.each(function(){var b,d,e,f;if("string"===c){d=0,e=r(this),f=a.match(K)||[];while(b=f[d++])e.hasClass(b)?e.removeClass(b):e.addClass(b)}else void 0!==a&&"boolean"!==c||(b=mb(this),b&&V.set(this,"__className__",b),this.setAttribute&&this.setAttribute("class",b||a===!1?"":V.get(this,"__className__")||""))})},hasClass:function(a){var b,c,d=0;b=" "+a+" ";while(c=this[d++])if(1===c.nodeType&&(" "+mb(c)+" ").replace(lb," ").indexOf(b)>-1)return!0;return!1}});var nb=/\r/g,ob=/[\x20\t\r\n\f]+/g;r.fn.extend({val:function(a){var b,c,d,e=this[0];{if(arguments.length)return d=r.isFunction(a),this.each(function(c){var e;1===this.nodeType&&(e=d?a.call(this,c,r(this).val()):a,null==e?e="":"number"==typeof e?e+="":r.isArray(e)&&(e=r.map(e,function(a){return null==a?"":a+""})),b=r.valHooks[this.type]||r.valHooks[this.nodeName.toLowerCase()],b&&"set"in b&&void 0!==b.set(this,e,"value")||(this.value=e))});if(e)return b=r.valHooks[e.type]||r.valHooks[e.nodeName.toLowerCase()],b&&"get"in b&&void 0!==(c=b.get(e,"value"))?c:(c=e.value,"string"==typeof c?c.replace(nb,""):null==c?"":c)}}}),r.extend({valHooks:{option:{get:function(a){var b=r.find.attr(a,"value");return null!=b?b:r.trim(r.text(a)).replace(ob," ")}},select:{get:function(a){for(var b,c,d=a.options,e=a.selectedIndex,f="select-one"===a.type,g=f?null:[],h=f?e+1:d.length,i=e<0?h:f?e:0;i<h;i++)if(c=d[i],(c.selected||i===e)&&!c.disabled&&(!c.parentNode.disabled||!r.nodeName(c.parentNode,"optgroup"))){if(b=r(c).val(),f)return b;g.push(b)}return g},set:function(a,b){var c,d,e=a.options,f=r.makeArray(b),g=e.length;while(g--)d=e[g],(d.selected=r.inArray(r.valHooks.option.get(d),f)>-1)&&(c=!0);return c||(a.selectedIndex=-1),f}}}}),r.each(["radio","checkbox"],function(){r.valHooks[this]={set:function(a,b){if(r.isArray(b))return a.checked=r.inArray(r(a).val(),b)>-1}},o.checkOn||(r.valHooks[this].get=function(a){return null===a.getAttribute("value")?"on":a.value})});var pb=/^(?:focusinfocus|focusoutblur)$/;r.extend(r.event,{trigger:function(b,c,e,f){var g,h,i,j,k,m,n,o=[e||d],p=l.call(b,"type")?b.type:b,q=l.call(b,"namespace")?b.namespace.split("."):[];if(h=i=e=e||d,3!==e.nodeType&&8!==e.nodeType&&!pb.test(p+r.event.triggered)&&(p.indexOf(".")>-1&&(q=p.split("."),p=q.shift(),q.sort()),k=p.indexOf(":")<0&&"on"+p,b=b[r.expando]?b:new r.Event(p,"object"==typeof b&&b),b.isTrigger=f?2:3,b.namespace=q.join("."),b.rnamespace=b.namespace?new RegExp("(^|\\.)"+q.join("\\.(?:.*\\.|)")+"(\\.|$)"):null,b.result=void 0,b.target||(b.target=e),c=null==c?[b]:r.makeArray(c,[b]),n=r.event.special[p]||{},f||!n.trigger||n.trigger.apply(e,c)!==!1)){if(!f&&!n.noBubble&&!r.isWindow(e)){for(j=n.delegateType||p,pb.test(j+p)||(h=h.parentNode);h;h=h.parentNode)o.push(h),i=h;i===(e.ownerDocument||d)&&o.push(i.defaultView||i.parentWindow||a)}g=0;while((h=o[g++])&&!b.isPropagationStopped())b.type=g>1?j:n.bindType||p,m=(V.get(h,"events")||{})[b.type]&&V.get(h,"handle"),m&&m.apply(h,c),m=k&&h[k],m&&m.apply&&T(h)&&(b.result=m.apply(h,c),b.result===!1&&b.preventDefault());return b.type=p,f||b.isDefaultPrevented()||n._default&&n._default.apply(o.pop(),c)!==!1||!T(e)||k&&r.isFunction(e[p])&&!r.isWindow(e)&&(i=e[k],i&&(e[k]=null),r.event.triggered=p,e[p](),r.event.triggered=void 0,i&&(e[k]=i)),b.result}},simulate:function(a,b,c){var d=r.extend(new r.Event,c,{type:a,isSimulated:!0});r.event.trigger(d,null,b)}}),r.fn.extend({trigger:function(a,b){return this.each(function(){r.event.trigger(a,b,this)})},triggerHandler:function(a,b){var c=this[0];if(c)return r.event.trigger(a,b,c,!0)}}),r.each("blur focus focusin focusout resize scroll click dblclick mousedown mouseup mousemove mouseover mouseout mouseenter mouseleave change select submit keydown keypress keyup contextmenu".split(" "),function(a,b){r.fn[b]=function(a,c){return arguments.length>0?this.on(b,null,a,c):this.trigger(b)}}),r.fn.extend({hover:function(a,b){return this.mouseenter(a).mouseleave(b||a)}}),o.focusin="onfocusin"in a,o.focusin||r.each({focus:"focusin",blur:"focusout"},function(a,b){var c=function(a){r.event.simulate(b,a.target,r.event.fix(a))};r.event.special[b]={setup:function(){var d=this.ownerDocument||this,e=V.access(d,b);e||d.addEventListener(a,c,!0),V.access(d,b,(e||0)+1)},teardown:function(){var d=this.ownerDocument||this,e=V.access(d,b)-1;e?V.access(d,b,e):(d.removeEventListener(a,c,!0),V.remove(d,b))}}});var qb=a.location,rb=r.now(),sb=/\?/;r.parseXML=function(b){var c;if(!b||"string"!=typeof b)return null;try{c=(new a.DOMParser).parseFromString(b,"text/xml")}catch(d){c=void 0}return c&&!c.getElementsByTagName("parsererror").length||r.error("Invalid XML: "+b),c};var tb=/\[\]$/,ub=/\r?\n/g,vb=/^(?:submit|button|image|reset|file)$/i,wb=/^(?:input|select|textarea|keygen)/i;function xb(a,b,c,d){var e;if(r.isArray(b))r.each(b,function(b,e){c||tb.test(a)?d(a,e):xb(a+"["+("object"==typeof e&&null!=e?b:"")+"]",e,c,d)});else if(c||"object"!==r.type(b))d(a,b);else for(e in b)xb(a+"["+e+"]",b[e],c,d)}r.param=function(a,b){var c,d=[],e=function(a,b){var c=r.isFunction(b)?b():b;d[d.length]=encodeURIComponent(a)+"="+encodeURIComponent(null==c?"":c)};if(r.isArray(a)||a.jquery&&!r.isPlainObject(a))r.each(a,function(){e(this.name,this.value)});else for(c in a)xb(c,a[c],b,e);return d.join("&")},r.fn.extend({serialize:function(){return r.param(this.serializeArray())},serializeArray:function(){return this.map(function(){var a=r.prop(this,"elements");return a?r.makeArray(a):this}).filter(function(){var a=this.type;return this.name&&!r(this).is(":disabled")&&wb.test(this.nodeName)&&!vb.test(a)&&(this.checked||!ha.test(a))}).map(function(a,b){var c=r(this).val();return null==c?null:r.isArray(c)?r.map(c,function(a){return{name:b.name,value:a.replace(ub,"\r\n")}}):{name:b.name,value:c.replace(ub,"\r\n")}}).get()}});var yb=/%20/g,zb=/#.*$/,Ab=/([?&])_=[^&]*/,Bb=/^(.*?):[ \t]*([^\r\n]*)$/gm,Cb=/^(?:about|app|app-storage|.+-extension|file|res|widget):$/,Db=/^(?:GET|HEAD)$/,Eb=/^\/\//,Fb={},Gb={},Hb="*/".concat("*"),Ib=d.createElement("a");Ib.href=qb.href;function Jb(a){return function(b,c){"string"!=typeof b&&(c=b,b="*");var d,e=0,f=b.toLowerCase().match(K)||[];if(r.isFunction(c))while(d=f[e++])"+"===d[0]?(d=d.slice(1)||"*",(a[d]=a[d]||[]).unshift(c)):(a[d]=a[d]||[]).push(c)}}function Kb(a,b,c,d){var e={},f=a===Gb;function g(h){var i;return e[h]=!0,r.each(a[h]||[],function(a,h){var j=h(b,c,d);return"string"!=typeof j||f||e[j]?f?!(i=j):void 0:(b.dataTypes.unshift(j),g(j),!1)}),i}return g(b.dataTypes[0])||!e["*"]&&g("*")}function Lb(a,b){var c,d,e=r.ajaxSettings.flatOptions||{};for(c in b)void 0!==b[c]&&((e[c]?a:d||(d={}))[c]=b[c]);return d&&r.extend(!0,a,d),a}function Mb(a,b,c){var d,e,f,g,h=a.contents,i=a.dataTypes;while("*"===i[0])i.shift(),void 0===d&&(d=a.mimeType||b.getResponseHeader("Content-Type"));if(d)for(e in h)if(h[e]&&h[e].test(d)){i.unshift(e);break}if(i[0]in c)f=i[0];else{for(e in c){if(!i[0]||a.converters[e+" "+i[0]]){f=e;break}g||(g=e)}f=f||g}if(f)return f!==i[0]&&i.unshift(f),c[f]}function Nb(a,b,c,d){var e,f,g,h,i,j={},k=a.dataTypes.slice();if(k[1])for(g in a.converters)j[g.toLowerCase()]=a.converters[g];f=k.shift();while(f)if(a.responseFields[f]&&(c[a.responseFields[f]]=b),!i&&d&&a.dataFilter&&(b=a.dataFilter(b,a.dataType)),i=f,f=k.shift())if("*"===f)f=i;else if("*"!==i&&i!==f){if(g=j[i+" "+f]||j["* "+f],!g)for(e in j)if(h=e.split(" "),h[1]===f&&(g=j[i+" "+h[0]]||j["* "+h[0]])){g===!0?g=j[e]:j[e]!==!0&&(f=h[0],k.unshift(h[1]));break}if(g!==!0)if(g&&a["throws"])b=g(b);else try{b=g(b)}catch(l){return{state:"parsererror",error:g?l:"No conversion from "+i+" to "+f}}}return{state:"success",data:b}}r.extend({active:0,lastModified:{},etag:{},ajaxSettings:{url:qb.href,type:"GET",isLocal:Cb.test(qb.protocol),global:!0,processData:!0,async:!0,contentType:"application/x-www-form-urlencoded; charset=UTF-8",accepts:{"*":Hb,text:"text/plain",html:"text/html",xml:"application/xml, text/xml",json:"application/json, text/javascript"},contents:{xml:/\bxml\b/,html:/\bhtml/,json:/\bjson\b/},responseFields:{xml:"responseXML",text:"responseText",json:"responseJSON"},converters:{"* text":String,"text html":!0,"text json":JSON.parse,"text xml":r.parseXML},flatOptions:{url:!0,context:!0}},ajaxSetup:function(a,b){return b?Lb(Lb(a,r.ajaxSettings),b):Lb(r.ajaxSettings,a)},ajaxPrefilter:Jb(Fb),ajaxTransport:Jb(Gb),ajax:function(b,c){"object"==typeof b&&(c=b,b=void 0),c=c||{};var e,f,g,h,i,j,k,l,m,n,o=r.ajaxSetup({},c),p=o.context||o,q=o.context&&(p.nodeType||p.jquery)?r(p):r.event,s=r.Deferred(),t=r.Callbacks("once memory"),u=o.statusCode||{},v={},w={},x="canceled",y={readyState:0,getResponseHeader:function(a){var b;if(k){if(!h){h={};while(b=Bb.exec(g))h[b[1].toLowerCase()]=b[2]}b=h[a.toLowerCase()]}return null==b?null:b},getAllResponseHeaders:function(){return k?g:null},setRequestHeader:function(a,b){return null==k&&(a=w[a.toLowerCase()]=w[a.toLowerCase()]||a,v[a]=b),this},overrideMimeType:function(a){return null==k&&(o.mimeType=a),this},statusCode:function(a){var b;if(a)if(k)y.always(a[y.status]);else for(b in a)u[b]=[u[b],a[b]];return this},abort:function(a){var b=a||x;return e&&e.abort(b),A(0,b),this}};if(s.promise(y),o.url=((b||o.url||qb.href)+"").replace(Eb,qb.protocol+"//"),o.type=c.method||c.type||o.method||o.type,o.dataTypes=(o.dataType||"*").toLowerCase().match(K)||[""],null==o.crossDomain){j=d.createElement("a");try{j.href=o.url,j.href=j.href,o.crossDomain=Ib.protocol+"//"+Ib.host!=j.protocol+"//"+j.host}catch(z){o.crossDomain=!0}}if(o.data&&o.processData&&"string"!=typeof o.data&&(o.data=r.param(o.data,o.traditional)),Kb(Fb,o,c,y),k)return y;l=r.event&&o.global,l&&0===r.active++&&r.event.trigger("ajaxStart"),o.type=o.type.toUpperCase(),o.hasContent=!Db.test(o.type),f=o.url.replace(zb,""),o.hasContent?o.data&&o.processData&&0===(o.contentType||"").indexOf("application/x-www-form-urlencoded")&&(o.data=o.data.replace(yb,"+")):(n=o.url.slice(f.length),o.data&&(f+=(sb.test(f)?"&":"?")+o.data,delete o.data),o.cache===!1&&(f=f.replace(Ab,""),n=(sb.test(f)?"&":"?")+"_="+rb++ +n),o.url=f+n),o.ifModified&&(r.lastModified[f]&&y.setRequestHeader("If-Modified-Since",r.lastModified[f]),r.etag[f]&&y.setRequestHeader("If-None-Match",r.etag[f])),(o.data&&o.hasContent&&o.contentType!==!1||c.contentType)&&y.setRequestHeader("Content-Type",o.contentType),y.setRequestHeader("Accept",o.dataTypes[0]&&o.accepts[o.dataTypes[0]]?o.accepts[o.dataTypes[0]]+("*"!==o.dataTypes[0]?", "+Hb+"; q=0.01":""):o.accepts["*"]);for(m in o.headers)y.setRequestHeader(m,o.headers[m]);if(o.beforeSend&&(o.beforeSend.call(p,y,o)===!1||k))return y.abort();if(x="abort",t.add(o.complete),y.done(o.success),y.fail(o.error),e=Kb(Gb,o,c,y)){if(y.readyState=1,l&&q.trigger("ajaxSend",[y,o]),k)return y;o.async&&o.timeout>0&&(i=a.setTimeout(function(){y.abort("timeout")},o.timeout));try{k=!1,e.send(v,A)}catch(z){if(k)throw z;A(-1,z)}}else A(-1,"No Transport");function A(b,c,d,h){var j,m,n,v,w,x=c;k||(k=!0,i&&a.clearTimeout(i),e=void 0,g=h||"",y.readyState=b>0?4:0,j=b>=200&&b<300||304===b,d&&(v=Mb(o,y,d)),v=Nb(o,v,y,j),j?(o.ifModified&&(w=y.getResponseHeader("Last-Modified"),w&&(r.lastModified[f]=w),w=y.getResponseHeader("etag"),w&&(r.etag[f]=w)),204===b||"HEAD"===o.type?x="nocontent":304===b?x="notmodified":(x=v.state,m=v.data,n=v.error,j=!n)):(n=x,!b&&x||(x="error",b<0&&(b=0))),y.status=b,y.statusText=(c||x)+"",j?s.resolveWith(p,[m,x,y]):s.rejectWith(p,[y,x,n]),y.statusCode(u),u=void 0,l&&q.trigger(j?"ajaxSuccess":"ajaxError",[y,o,j?m:n]),t.fireWith(p,[y,x]),l&&(q.trigger("ajaxComplete",[y,o]),--r.active||r.event.trigger("ajaxStop")))}return y},getJSON:function(a,b,c){return r.get(a,b,c,"json")},getScript:function(a,b){return r.get(a,void 0,b,"script")}}),r.each(["get","post"],function(a,b){r[b]=function(a,c,d,e){return r.isFunction(c)&&(e=e||d,d=c,c=void 0),r.ajax(r.extend({url:a,type:b,dataType:e,data:c,success:d},r.isPlainObject(a)&&a))}}),r._evalUrl=function(a){return r.ajax({url:a,type:"GET",dataType:"script",cache:!0,async:!1,global:!1,"throws":!0})},r.fn.extend({wrapAll:function(a){var b;return this[0]&&(r.isFunction(a)&&(a=a.call(this[0])),b=r(a,this[0].ownerDocument).eq(0).clone(!0),this[0].parentNode&&b.insertBefore(this[0]),b.map(function(){var a=this;while(a.firstElementChild)a=a.firstElementChild;return a}).append(this)),this},wrapInner:function(a){return r.isFunction(a)?this.each(function(b){r(this).wrapInner(a.call(this,b))}):this.each(function(){var b=r(this),c=b.contents();c.length?c.wrapAll(a):b.append(a)})},wrap:function(a){var b=r.isFunction(a);return this.each(function(c){r(this).wrapAll(b?a.call(this,c):a)})},unwrap:function(a){return this.parent(a).not("body").each(function(){r(this).replaceWith(this.childNodes)}),this}}),r.expr.pseudos.hidden=function(a){return!r.expr.pseudos.visible(a)},r.expr.pseudos.visible=function(a){return!!(a.offsetWidth||a.offsetHeight||a.getClientRects().length)},r.ajaxSettings.xhr=function(){try{return new a.XMLHttpRequest}catch(b){}};var Ob={0:200,1223:204},Pb=r.ajaxSettings.xhr();o.cors=!!Pb&&"withCredentials"in Pb,o.ajax=Pb=!!Pb,r.ajaxTransport(function(b){var c,d;if(o.cors||Pb&&!b.crossDomain)return{send:function(e,f){var g,h=b.xhr();if(h.open(b.type,b.url,b.async,b.username,b.password),b.xhrFields)for(g in b.xhrFields)h[g]=b.xhrFields[g];b.mimeType&&h.overrideMimeType&&h.overrideMimeType(b.mimeType),b.crossDomain||e["X-Requested-With"]||(e["X-Requested-With"]="XMLHttpRequest");for(g in e)h.setRequestHeader(g,e[g]);c=function(a){return function(){c&&(c=d=h.onload=h.onerror=h.onabort=h.onreadystatechange=null,"abort"===a?h.abort():"error"===a?"number"!=typeof h.status?f(0,"error"):f(h.status,h.statusText):f(Ob[h.status]||h.status,h.statusText,"text"!==(h.responseType||"text")||"string"!=typeof h.responseText?{binary:h.response}:{text:h.responseText},h.getAllResponseHeaders()))}},h.onload=c(),d=h.onerror=c("error"),void 0!==h.onabort?h.onabort=d:h.onreadystatechange=function(){4===h.readyState&&a.setTimeout(function(){c&&d()})},c=c("abort");try{h.send(b.hasContent&&b.data||null)}catch(i){if(c)throw i}},abort:function(){c&&c()}}}),r.ajaxPrefilter(function(a){a.crossDomain&&(a.contents.script=!1)}),r.ajaxSetup({accepts:{script:"text/javascript, application/javascript, application/ecmascript, application/x-ecmascript"},contents:{script:/\b(?:java|ecma)script\b/},converters:{"text script":function(a){return r.globalEval(a),a}}}),r.ajaxPrefilter("script",function(a){void 0===a.cache&&(a.cache=!1),a.crossDomain&&(a.type="GET")}),r.ajaxTransport("script",function(a){if(a.crossDomain){var b,c;return{send:function(e,f){b=r("<script>").prop({charset:a.scriptCharset,src:a.url}).on("load error",c=function(a){b.remove(),c=null,a&&f("error"===a.type?404:200,a.type)}),d.head.appendChild(b[0])},abort:function(){c&&c()}}}});var Qb=[],Rb=/(=)\?(?=&|$)|\?\?/;r.ajaxSetup({jsonp:"callback",jsonpCallback:function(){var a=Qb.pop()||r.expando+"_"+rb++;return this[a]=!0,a}}),r.ajaxPrefilter("json jsonp",function(b,c,d){var e,f,g,h=b.jsonp!==!1&&(Rb.test(b.url)?"url":"string"==typeof b.data&&0===(b.contentType||"").indexOf("application/x-www-form-urlencoded")&&Rb.test(b.data)&&"data");if(h||"jsonp"===b.dataTypes[0])return e=b.jsonpCallback=r.isFunction(b.jsonpCallback)?b.jsonpCallback():b.jsonpCallback,h?b[h]=b[h].replace(Rb,"$1"+e):b.jsonp!==!1&&(b.url+=(sb.test(b.url)?"&":"?")+b.jsonp+"="+e),b.converters["script json"]=function(){return g||r.error(e+" was not called"),g[0]},b.dataTypes[0]="json",f=a[e],a[e]=function(){g=arguments},d.always(function(){void 0===f?r(a).removeProp(e):a[e]=f,b[e]&&(b.jsonpCallback=c.jsonpCallback,Qb.push(e)),g&&r.isFunction(f)&&f(g[0]),g=f=void 0}),"script"}),o.createHTMLDocument=function(){var a=d.implementation.createHTMLDocument("").body;return a.innerHTML="<form></form><form></form>",2===a.childNodes.length}(),r.parseHTML=function(a,b,c){if("string"!=typeof a)return[];"boolean"==typeof b&&(c=b,b=!1);var e,f,g;return b||(o.createHTMLDocument?(b=d.implementation.createHTMLDocument(""),e=b.createElement("base"),e.href=d.location.href,b.head.appendChild(e)):b=d),f=B.exec(a),g=!c&&[],f?[b.createElement(f[1])]:(f=oa([a],b,g),g&&g.length&&r(g).remove(),r.merge([],f.childNodes))},r.fn.load=function(a,b,c){var d,e,f,g=this,h=a.indexOf(" ");return h>-1&&(d=r.trim(a.slice(h)),a=a.slice(0,h)),r.isFunction(b)?(c=b,b=void 0):b&&"object"==typeof b&&(e="POST"),g.length>0&&r.ajax({url:a,type:e||"GET",dataType:"html",data:b}).done(function(a){f=arguments,g.html(d?r("<div>").append(r.parseHTML(a)).find(d):a)}).always(c&&function(a,b){g.each(function(){c.apply(this,f||[a.responseText,b,a])})}),this},r.each(["ajaxStart","ajaxStop","ajaxComplete","ajaxError","ajaxSuccess","ajaxSend"],function(a,b){r.fn[b]=function(a){return this.on(b,a)}}),r.expr.pseudos.animated=function(a){return r.grep(r.timers,function(b){return a===b.elem}).length};function Sb(a){return r.isWindow(a)?a:9===a.nodeType&&a.defaultView}r.offset={setOffset:function(a,b,c){var d,e,f,g,h,i,j,k=r.css(a,"position"),l=r(a),m={};"static"===k&&(a.style.position="relative"),h=l.offset(),f=r.css(a,"top"),i=r.css(a,"left"),j=("absolute"===k||"fixed"===k)&&(f+i).indexOf("auto")>-1,j?(d=l.position(),g=d.top,e=d.left):(g=parseFloat(f)||0,e=parseFloat(i)||0),r.isFunction(b)&&(b=b.call(a,c,r.extend({},h))),null!=b.top&&(m.top=b.top-h.top+g),null!=b.left&&(m.left=b.left-h.left+e),"using"in b?b.using.call(a,m):l.css(m)}},r.fn.extend({offset:function(a){if(arguments.length)return void 0===a?this:this.each(function(b){r.offset.setOffset(this,a,b)});var b,c,d,e,f=this[0];if(f)return f.getClientRects().length?(d=f.getBoundingClientRect(),d.width||d.height?(e=f.ownerDocument,c=Sb(e),b=e.documentElement,{top:d.top+c.pageYOffset-b.clientTop,left:d.left+c.pageXOffset-b.clientLeft}):d):{top:0,left:0}},position:function(){if(this[0]){var a,b,c=this[0],d={top:0,left:0};return"fixed"===r.css(c,"position")?b=c.getBoundingClientRect():(a=this.offsetParent(),b=this.offset(),r.nodeName(a[0],"html")||(d=a.offset()),d={top:d.top+r.css(a[0],"borderTopWidth",!0),left:d.left+r.css(a[0],"borderLeftWidth",!0)}),{top:b.top-d.top-r.css(c,"marginTop",!0),left:b.left-d.left-r.css(c,"marginLeft",!0)}}},offsetParent:function(){return this.map(function(){var a=this.offsetParent;while(a&&"static"===r.css(a,"position"))a=a.offsetParent;return a||pa})}}),r.each({scrollLeft:"pageXOffset",scrollTop:"pageYOffset"},function(a,b){var c="pageYOffset"===b;r.fn[a]=function(d){return S(this,function(a,d,e){var f=Sb(a);return void 0===e?f?f[b]:a[d]:void(f?f.scrollTo(c?f.pageXOffset:e,c?e:f.pageYOffset):a[d]=e)},a,d,arguments.length)}}),r.each(["top","left"],function(a,b){r.cssHooks[b]=Na(o.pixelPosition,function(a,c){if(c)return c=Ma(a,b),Ka.test(c)?r(a).position()[b]+"px":c})}),r.each({Height:"height",Width:"width"},function(a,b){r.each({padding:"inner"+a,content:b,"":"outer"+a},function(c,d){r.fn[d]=function(e,f){var g=arguments.length&&(c||"boolean"!=typeof e),h=c||(e===!0||f===!0?"margin":"border");return S(this,function(b,c,e){var f;return r.isWindow(b)?0===d.indexOf("outer")?b["inner"+a]:b.document.documentElement["client"+a]:9===b.nodeType?(f=b.documentElement,Math.max(b.body["scroll"+a],f["scroll"+a],b.body["offset"+a],f["offset"+a],f["client"+a])):void 0===e?r.css(b,c,h):r.style(b,c,e,h)},b,g?e:void 0,g)}})}),r.fn.extend({bind:function(a,b,c){return this.on(a,null,b,c)},unbind:function(a,b){return this.off(a,null,b)},delegate:function(a,b,c,d){return this.on(b,a,c,d)},undelegate:function(a,b,c){return 1===arguments.length?this.off(a,"**"):this.off(b,a||"**",c)}}),r.parseJSON=JSON.parse,"function"==typeof define&&define.amd&&define("jquery",[],function(){return r});var Tb=a.jQuery,Ub=a.$;return r.noConflict=function(b){return a.$===r&&(a.$=Ub),b&&a.jQuery===r&&(a.jQuery=Tb),r},b||(a.jQuery=a.$=r),r}); diff --git a/website/docs/_static/js/modernizr.min.js b/website/docs/_static/js/modernizr.min.js new file mode 100644 index 0000000..f65d479 --- /dev/null +++ b/website/docs/_static/js/modernizr.min.js @@ -0,0 +1,4 @@ +/* Modernizr 2.6.2 (Custom Build) | MIT & BSD + * Build: http://modernizr.com/download/#-fontface-backgroundsize-borderimage-borderradius-boxshadow-flexbox-hsla-multiplebgs-opacity-rgba-textshadow-cssanimations-csscolumns-generatedcontent-cssgradients-cssreflections-csstransforms-csstransforms3d-csstransitions-applicationcache-canvas-canvastext-draganddrop-hashchange-history-audio-video-indexeddb-input-inputtypes-localstorage-postmessage-sessionstorage-websockets-websqldatabase-webworkers-geolocation-inlinesvg-smil-svg-svgclippaths-touch-webgl-shiv-mq-cssclasses-addtest-prefixed-teststyles-testprop-testallprops-hasevent-prefixes-domprefixes-load + */ +;window.Modernizr=function(a,b,c){function D(a){j.cssText=a}function E(a,b){return D(n.join(a+";")+(b||""))}function F(a,b){return typeof a===b}function G(a,b){return!!~(""+a).indexOf(b)}function H(a,b){for(var d in a){var e=a[d];if(!G(e,"-")&&j[e]!==c)return b=="pfx"?e:!0}return!1}function I(a,b,d){for(var e in a){var f=b[a[e]];if(f!==c)return d===!1?a[e]:F(f,"function")?f.bind(d||b):f}return!1}function J(a,b,c){var d=a.charAt(0).toUpperCase()+a.slice(1),e=(a+" "+p.join(d+" ")+d).split(" ");return F(b,"string")||F(b,"undefined")?H(e,b):(e=(a+" "+q.join(d+" ")+d).split(" "),I(e,b,c))}function K(){e.input=function(c){for(var d=0,e=c.length;d<e;d++)u[c[d]]=c[d]in k;return u.list&&(u.list=!!b.createElement("datalist")&&!!a.HTMLDataListElement),u}("autocomplete autofocus list placeholder max min multiple pattern required step".split(" ")),e.inputtypes=function(a){for(var d=0,e,f,h,i=a.length;d<i;d++)k.setAttribute("type",f=a[d]),e=k.type!=="text",e&&(k.value=l,k.style.cssText="position:absolute;visibility:hidden;",/^range$/.test(f)&&k.style.WebkitAppearance!==c?(g.appendChild(k),h=b.defaultView,e=h.getComputedStyle&&h.getComputedStyle(k,null).WebkitAppearance!=="textfield"&&k.offsetHeight!==0,g.removeChild(k)):/^(search|tel)$/.test(f)||(/^(url|email)$/.test(f)?e=k.checkValidity&&k.checkValidity()===!1:e=k.value!=l)),t[a[d]]=!!e;return t}("search tel url email datetime date month week time datetime-local number range color".split(" "))}var d="2.6.2",e={},f=!0,g=b.documentElement,h="modernizr",i=b.createElement(h),j=i.style,k=b.createElement("input"),l=":)",m={}.toString,n=" -webkit- -moz- -o- -ms- ".split(" "),o="Webkit Moz O ms",p=o.split(" "),q=o.toLowerCase().split(" "),r={svg:"http://www.w3.org/2000/svg"},s={},t={},u={},v=[],w=v.slice,x,y=function(a,c,d,e){var f,i,j,k,l=b.createElement("div"),m=b.body,n=m||b.createElement("body");if(parseInt(d,10))while(d--)j=b.createElement("div"),j.id=e?e[d]:h+(d+1),l.appendChild(j);return f=["­",'<style id="s',h,'">',a,"</style>"].join(""),l.id=h,(m?l:n).innerHTML+=f,n.appendChild(l),m||(n.style.background="",n.style.overflow="hidden",k=g.style.overflow,g.style.overflow="hidden",g.appendChild(n)),i=c(l,a),m?l.parentNode.removeChild(l):(n.parentNode.removeChild(n),g.style.overflow=k),!!i},z=function(b){var c=a.matchMedia||a.msMatchMedia;if(c)return c(b).matches;var d;return y("@media "+b+" { #"+h+" { position: absolute; } }",function(b){d=(a.getComputedStyle?getComputedStyle(b,null):b.currentStyle)["position"]=="absolute"}),d},A=function(){function d(d,e){e=e||b.createElement(a[d]||"div"),d="on"+d;var f=d in e;return f||(e.setAttribute||(e=b.createElement("div")),e.setAttribute&&e.removeAttribute&&(e.setAttribute(d,""),f=F(e[d],"function"),F(e[d],"undefined")||(e[d]=c),e.removeAttribute(d))),e=null,f}var a={select:"input",change:"input",submit:"form",reset:"form",error:"img",load:"img",abort:"img"};return d}(),B={}.hasOwnProperty,C;!F(B,"undefined")&&!F(B.call,"undefined")?C=function(a,b){return B.call(a,b)}:C=function(a,b){return b in a&&F(a.constructor.prototype[b],"undefined")},Function.prototype.bind||(Function.prototype.bind=function(b){var c=this;if(typeof c!="function")throw new TypeError;var d=w.call(arguments,1),e=function(){if(this instanceof e){var a=function(){};a.prototype=c.prototype;var f=new a,g=c.apply(f,d.concat(w.call(arguments)));return Object(g)===g?g:f}return c.apply(b,d.concat(w.call(arguments)))};return e}),s.flexbox=function(){return J("flexWrap")},s.canvas=function(){var a=b.createElement("canvas");return!!a.getContext&&!!a.getContext("2d")},s.canvastext=function(){return!!e.canvas&&!!F(b.createElement("canvas").getContext("2d").fillText,"function")},s.webgl=function(){return!!a.WebGLRenderingContext},s.touch=function(){var c;return"ontouchstart"in a||a.DocumentTouch&&b instanceof DocumentTouch?c=!0:y(["@media (",n.join("touch-enabled),("),h,")","{#modernizr{top:9px;position:absolute}}"].join(""),function(a){c=a.offsetTop===9}),c},s.geolocation=function(){return"geolocation"in navigator},s.postmessage=function(){return!!a.postMessage},s.websqldatabase=function(){return!!a.openDatabase},s.indexedDB=function(){return!!J("indexedDB",a)},s.hashchange=function(){return A("hashchange",a)&&(b.documentMode===c||b.documentMode>7)},s.history=function(){return!!a.history&&!!history.pushState},s.draganddrop=function(){var a=b.createElement("div");return"draggable"in a||"ondragstart"in a&&"ondrop"in a},s.websockets=function(){return"WebSocket"in a||"MozWebSocket"in a},s.rgba=function(){return D("background-color:rgba(150,255,150,.5)"),G(j.backgroundColor,"rgba")},s.hsla=function(){return D("background-color:hsla(120,40%,100%,.5)"),G(j.backgroundColor,"rgba")||G(j.backgroundColor,"hsla")},s.multiplebgs=function(){return D("background:url(https://),url(https://),red url(https://)"),/(url\s*\(.*?){3}/.test(j.background)},s.backgroundsize=function(){return J("backgroundSize")},s.borderimage=function(){return J("borderImage")},s.borderradius=function(){return J("borderRadius")},s.boxshadow=function(){return J("boxShadow")},s.textshadow=function(){return b.createElement("div").style.textShadow===""},s.opacity=function(){return E("opacity:.55"),/^0.55$/.test(j.opacity)},s.cssanimations=function(){return J("animationName")},s.csscolumns=function(){return J("columnCount")},s.cssgradients=function(){var a="background-image:",b="gradient(linear,left top,right bottom,from(#9f9),to(white));",c="linear-gradient(left top,#9f9, white);";return D((a+"-webkit- ".split(" ").join(b+a)+n.join(c+a)).slice(0,-a.length)),G(j.backgroundImage,"gradient")},s.cssreflections=function(){return J("boxReflect")},s.csstransforms=function(){return!!J("transform")},s.csstransforms3d=function(){var a=!!J("perspective");return a&&"webkitPerspective"in g.style&&y("@media (transform-3d),(-webkit-transform-3d){#modernizr{left:9px;position:absolute;height:3px;}}",function(b,c){a=b.offsetLeft===9&&b.offsetHeight===3}),a},s.csstransitions=function(){return J("transition")},s.fontface=function(){var a;return y('@font-face {font-family:"font";src:url("https://")}',function(c,d){var e=b.getElementById("smodernizr"),f=e.sheet||e.styleSheet,g=f?f.cssRules&&f.cssRules[0]?f.cssRules[0].cssText:f.cssText||"":"";a=/src/i.test(g)&&g.indexOf(d.split(" ")[0])===0}),a},s.generatedcontent=function(){var a;return y(["#",h,"{font:0/0 a}#",h,':after{content:"',l,'";visibility:hidden;font:3px/1 a}'].join(""),function(b){a=b.offsetHeight>=3}),a},s.video=function(){var a=b.createElement("video"),c=!1;try{if(c=!!a.canPlayType)c=new Boolean(c),c.ogg=a.canPlayType('video/ogg; codecs="theora"').replace(/^no$/,""),c.h264=a.canPlayType('video/mp4; codecs="avc1.42E01E"').replace(/^no$/,""),c.webm=a.canPlayType('video/webm; codecs="vp8, vorbis"').replace(/^no$/,"")}catch(d){}return c},s.audio=function(){var a=b.createElement("audio"),c=!1;try{if(c=!!a.canPlayType)c=new Boolean(c),c.ogg=a.canPlayType('audio/ogg; codecs="vorbis"').replace(/^no$/,""),c.mp3=a.canPlayType("audio/mpeg;").replace(/^no$/,""),c.wav=a.canPlayType('audio/wav; codecs="1"').replace(/^no$/,""),c.m4a=(a.canPlayType("audio/x-m4a;")||a.canPlayType("audio/aac;")).replace(/^no$/,"")}catch(d){}return c},s.localstorage=function(){try{return localStorage.setItem(h,h),localStorage.removeItem(h),!0}catch(a){return!1}},s.sessionstorage=function(){try{return sessionStorage.setItem(h,h),sessionStorage.removeItem(h),!0}catch(a){return!1}},s.webworkers=function(){return!!a.Worker},s.applicationcache=function(){return!!a.applicationCache},s.svg=function(){return!!b.createElementNS&&!!b.createElementNS(r.svg,"svg").createSVGRect},s.inlinesvg=function(){var a=b.createElement("div");return a.innerHTML="<svg/>",(a.firstChild&&a.firstChild.namespaceURI)==r.svg},s.smil=function(){return!!b.createElementNS&&/SVGAnimate/.test(m.call(b.createElementNS(r.svg,"animate")))},s.svgclippaths=function(){return!!b.createElementNS&&/SVGClipPath/.test(m.call(b.createElementNS(r.svg,"clipPath")))};for(var L in s)C(s,L)&&(x=L.toLowerCase(),e[x]=s[L](),v.push((e[x]?"":"no-")+x));return e.input||K(),e.addTest=function(a,b){if(typeof a=="object")for(var d in a)C(a,d)&&e.addTest(d,a[d]);else{a=a.toLowerCase();if(e[a]!==c)return e;b=typeof b=="function"?b():b,typeof f!="undefined"&&f&&(g.className+=" "+(b?"":"no-")+a),e[a]=b}return e},D(""),i=k=null,function(a,b){function k(a,b){var c=a.createElement("p"),d=a.getElementsByTagName("head")[0]||a.documentElement;return c.innerHTML="x<style>"+b+"</style>",d.insertBefore(c.lastChild,d.firstChild)}function l(){var a=r.elements;return typeof a=="string"?a.split(" "):a}function m(a){var b=i[a[g]];return b||(b={},h++,a[g]=h,i[h]=b),b}function n(a,c,f){c||(c=b);if(j)return c.createElement(a);f||(f=m(c));var g;return f.cache[a]?g=f.cache[a].cloneNode():e.test(a)?g=(f.cache[a]=f.createElem(a)).cloneNode():g=f.createElem(a),g.canHaveChildren&&!d.test(a)?f.frag.appendChild(g):g}function o(a,c){a||(a=b);if(j)return a.createDocumentFragment();c=c||m(a);var d=c.frag.cloneNode(),e=0,f=l(),g=f.length;for(;e<g;e++)d.createElement(f[e]);return d}function p(a,b){b.cache||(b.cache={},b.createElem=a.createElement,b.createFrag=a.createDocumentFragment,b.frag=b.createFrag()),a.createElement=function(c){return r.shivMethods?n(c,a,b):b.createElem(c)},a.createDocumentFragment=Function("h,f","return function(){var n=f.cloneNode(),c=n.createElement;h.shivMethods&&("+l().join().replace(/\w+/g,function(a){return b.createElem(a),b.frag.createElement(a),'c("'+a+'")'})+");return n}")(r,b.frag)}function q(a){a||(a=b);var c=m(a);return r.shivCSS&&!f&&!c.hasCSS&&(c.hasCSS=!!k(a,"article,aside,figcaption,figure,footer,header,hgroup,nav,section{display:block}mark{background:#FF0;color:#000}")),j||p(a,c),a}var c=a.html5||{},d=/^<|^(?:button|map|select|textarea|object|iframe|option|optgroup)$/i,e=/^(?:a|b|code|div|fieldset|h1|h2|h3|h4|h5|h6|i|label|li|ol|p|q|span|strong|style|table|tbody|td|th|tr|ul)$/i,f,g="_html5shiv",h=0,i={},j;(function(){try{var a=b.createElement("a");a.innerHTML="<xyz></xyz>",f="hidden"in a,j=a.childNodes.length==1||function(){b.createElement("a");var a=b.createDocumentFragment();return typeof a.cloneNode=="undefined"||typeof a.createDocumentFragment=="undefined"||typeof a.createElement=="undefined"}()}catch(c){f=!0,j=!0}})();var r={elements:c.elements||"abbr article aside audio bdi canvas data datalist details figcaption figure footer header hgroup mark meter nav output progress section summary time video",shivCSS:c.shivCSS!==!1,supportsUnknownElements:j,shivMethods:c.shivMethods!==!1,type:"default",shivDocument:q,createElement:n,createDocumentFragment:o};a.html5=r,q(b)}(this,b),e._version=d,e._prefixes=n,e._domPrefixes=q,e._cssomPrefixes=p,e.mq=z,e.hasEvent=A,e.testProp=function(a){return H([a])},e.testAllProps=J,e.testStyles=y,e.prefixed=function(a,b,c){return b?J(a,b,c):J(a,"pfx")},g.className=g.className.replace(/(^|\s)no-js(\s|$)/,"$1$2")+(f?" js "+v.join(" "):""),e}(this,this.document),function(a,b,c){function d(a){return"[object Function]"==o.call(a)}function e(a){return"string"==typeof a}function f(){}function g(a){return!a||"loaded"==a||"complete"==a||"uninitialized"==a}function h(){var a=p.shift();q=1,a?a.t?m(function(){("c"==a.t?B.injectCss:B.injectJs)(a.s,0,a.a,a.x,a.e,1)},0):(a(),h()):q=0}function i(a,c,d,e,f,i,j){function k(b){if(!o&&g(l.readyState)&&(u.r=o=1,!q&&h(),l.onload=l.onreadystatechange=null,b)){"img"!=a&&m(function(){t.removeChild(l)},50);for(var d in y[c])y[c].hasOwnProperty(d)&&y[c][d].onload()}}var j=j||B.errorTimeout,l=b.createElement(a),o=0,r=0,u={t:d,s:c,e:f,a:i,x:j};1===y[c]&&(r=1,y[c]=[]),"object"==a?l.data=c:(l.src=c,l.type=a),l.width=l.height="0",l.onerror=l.onload=l.onreadystatechange=function(){k.call(this,r)},p.splice(e,0,u),"img"!=a&&(r||2===y[c]?(t.insertBefore(l,s?null:n),m(k,j)):y[c].push(l))}function j(a,b,c,d,f){return q=0,b=b||"j",e(a)?i("c"==b?v:u,a,b,this.i++,c,d,f):(p.splice(this.i++,0,a),1==p.length&&h()),this}function k(){var a=B;return a.loader={load:j,i:0},a}var l=b.documentElement,m=a.setTimeout,n=b.getElementsByTagName("script")[0],o={}.toString,p=[],q=0,r="MozAppearance"in l.style,s=r&&!!b.createRange().compareNode,t=s?l:n.parentNode,l=a.opera&&"[object Opera]"==o.call(a.opera),l=!!b.attachEvent&&!l,u=r?"object":l?"script":"img",v=l?"script":u,w=Array.isArray||function(a){return"[object Array]"==o.call(a)},x=[],y={},z={timeout:function(a,b){return b.length&&(a.timeout=b[0]),a}},A,B;B=function(a){function b(a){var a=a.split("!"),b=x.length,c=a.pop(),d=a.length,c={url:c,origUrl:c,prefixes:a},e,f,g;for(f=0;f<d;f++)g=a[f].split("="),(e=z[g.shift()])&&(c=e(c,g));for(f=0;f<b;f++)c=x[f](c);return c}function g(a,e,f,g,h){var i=b(a),j=i.autoCallback;i.url.split(".").pop().split("?").shift(),i.bypass||(e&&(e=d(e)?e:e[a]||e[g]||e[a.split("/").pop().split("?")[0]]),i.instead?i.instead(a,e,f,g,h):(y[i.url]?i.noexec=!0:y[i.url]=1,f.load(i.url,i.forceCSS||!i.forceJS&&"css"==i.url.split(".").pop().split("?").shift()?"c":c,i.noexec,i.attrs,i.timeout),(d(e)||d(j))&&f.load(function(){k(),e&&e(i.origUrl,h,g),j&&j(i.origUrl,h,g),y[i.url]=2})))}function h(a,b){function c(a,c){if(a){if(e(a))c||(j=function(){var a=[].slice.call(arguments);k.apply(this,a),l()}),g(a,j,b,0,h);else if(Object(a)===a)for(n in m=function(){var b=0,c;for(c in a)a.hasOwnProperty(c)&&b++;return b}(),a)a.hasOwnProperty(n)&&(!c&&!--m&&(d(j)?j=function(){var a=[].slice.call(arguments);k.apply(this,a),l()}:j[n]=function(a){return function(){var b=[].slice.call(arguments);a&&a.apply(this,b),l()}}(k[n])),g(a[n],j,b,n,h))}else!c&&l()}var h=!!a.test,i=a.load||a.both,j=a.callback||f,k=j,l=a.complete||f,m,n;c(h?a.yep:a.nope,!!i),i&&c(i)}var i,j,l=this.yepnope.loader;if(e(a))g(a,0,l,0);else if(w(a))for(i=0;i<a.length;i++)j=a[i],e(j)?g(j,0,l,0):w(j)?B(j):Object(j)===j&&h(j,l);else Object(a)===a&&h(a,l)},B.addPrefix=function(a,b){z[a]=b},B.addFilter=function(a){x.push(a)},B.errorTimeout=1e4,null==b.readyState&&b.addEventListener&&(b.readyState="loading",b.addEventListener("DOMContentLoaded",A=function(){b.removeEventListener("DOMContentLoaded",A,0),b.readyState="complete"},0)),a.yepnope=k(),a.yepnope.executeStack=h,a.yepnope.injectJs=function(a,c,d,e,i,j){var k=b.createElement("script"),l,o,e=e||B.errorTimeout;k.src=a;for(o in d)k.setAttribute(o,d[o]);c=j?h:c||f,k.onreadystatechange=k.onload=function(){!l&&g(k.readyState)&&(l=1,c(),k.onload=k.onreadystatechange=null)},m(function(){l||(l=1,c(1))},e),i?k.onload():n.parentNode.insertBefore(k,n)},a.yepnope.injectCss=function(a,c,d,e,g,i){var e=b.createElement("link"),j,c=i?h:c||f;e.href=a,e.rel="stylesheet",e.type="text/css";for(j in d)e.setAttribute(j,d[j]);g||(n.parentNode.insertBefore(e,n),m(c,0))}}(this,document),Modernizr.load=function(){yepnope.apply(window,[].slice.call(arguments,0))}; diff --git a/website/docs/_static/js/theme.js b/website/docs/_static/js/theme.js new file mode 100644 index 0000000..af661a9 --- /dev/null +++ b/website/docs/_static/js/theme.js @@ -0,0 +1,169 @@ +require=(function e(t,n,r){function s(o,u){if(!n[o]){if(!t[o]){var a=typeof require=="function"&&require;if(!u&&a)return a(o,!0);if(i)return i(o,!0);var f=new Error("Cannot find module '"+o+"'");throw f.code="MODULE_NOT_FOUND",f}var l=n[o]={exports:{}};t[o][0].call(l.exports,function(e){var n=t[o][1][e];return s(n?n:e)},l,l.exports,e,t,n,r)}return n[o].exports}var i=typeof require=="function"&&require;for(var o=0;o<r.length;o++)s(r[o]);return s})({"sphinx-rtd-theme":[function(require,module,exports){ +var jQuery = (typeof(window) != 'undefined') ? window.jQuery : require('jquery'); + +// Sphinx theme nav state +function ThemeNav () { + + var nav = { + navBar: null, + win: null, + winScroll: false, + winResize: false, + linkScroll: false, + winPosition: 0, + winHeight: null, + docHeight: null, + isRunning: false + }; + + nav.enable = function () { + var self = this; + + if (!self.isRunning) { + self.isRunning = true; + jQuery(function ($) { + self.init($); + + self.reset(); + self.win.on('hashchange', self.reset); + + // Set scroll monitor + self.win.on('scroll', function () { + if (!self.linkScroll) { + self.winScroll = true; + } + }); + setInterval(function () { if (self.winScroll) self.onScroll(); }, 25); + + // Set resize monitor + self.win.on('resize', function () { + self.winResize = true; + }); + setInterval(function () { if (self.winResize) self.onResize(); }, 25); + self.onResize(); + }); + }; + }; + + nav.init = function ($) { + var doc = $(document), + self = this; + + this.navBar = $('div.wy-side-scroll:first'); + this.win = $(window); + + // Set up javascript UX bits + $(document) + // Shift nav in mobile when clicking the menu. + .on('click', "[data-toggle='wy-nav-top']", function() { + $("[data-toggle='wy-nav-shift']").toggleClass("shift"); + $("[data-toggle='rst-versions']").toggleClass("shift"); + }) + + // Nav menu link click operations + .on('click', ".wy-menu-vertical .current ul li a", function() { + var target = $(this); + // Close menu when you click a link. + $("[data-toggle='wy-nav-shift']").removeClass("shift"); + $("[data-toggle='rst-versions']").toggleClass("shift"); + // Handle dynamic display of l3 and l4 nav lists + self.toggleCurrent(target); + self.hashChange(); + }) + .on('click', "[data-toggle='rst-current-version']", function() { + $("[data-toggle='rst-versions']").toggleClass("shift-up"); + }) + + // Make tables responsive + $("table.docutils:not(.field-list)") + .wrap("<div class='wy-table-responsive'></div>"); + + // Add expand links to all parents of nested ul + $('.wy-menu-vertical ul').not('.simple').siblings('a').each(function () { + var link = $(this); + expand = $('<span class="toctree-expand"></span>'); + expand.on('click', function (ev) { + self.toggleCurrent(link); + ev.stopPropagation(); + return false; + }); + link.prepend(expand); + }); + }; + + nav.reset = function () { + // Get anchor from URL and open up nested nav + var anchor = encodeURI(window.location.hash); + if (anchor) { + try { + var link = $('.wy-menu-vertical') + .find('[href="' + anchor + '"]'); + // If we didn't find a link, it may be because we clicked on + // something that is not in the sidebar (eg: when using + // sphinxcontrib.httpdomain it generates headerlinks but those + // aren't picked up and placed in the toctree). So let's find + // the closest header in the document and try with that one. + if (link.length === 0) { + var doc_link = $('.document a[href="' + anchor + '"]'); + var closest_section = doc_link.closest('div.section'); + // Try again with the closest section entry. + link = $('.wy-menu-vertical') + .find('[href="#' + closest_section.attr("id") + '"]'); + + } + $('.wy-menu-vertical li.toctree-l1 li.current') + .removeClass('current'); + link.closest('li.toctree-l2').addClass('current'); + link.closest('li.toctree-l3').addClass('current'); + link.closest('li.toctree-l4').addClass('current'); + } + catch (err) { + console.log("Error expanding nav for anchor", err); + } + } + }; + + nav.onScroll = function () { + this.winScroll = false; + var newWinPosition = this.win.scrollTop(), + winBottom = newWinPosition + this.winHeight, + navPosition = this.navBar.scrollTop(), + newNavPosition = navPosition + (newWinPosition - this.winPosition); + if (newWinPosition < 0 || winBottom > this.docHeight) { + return; + } + this.navBar.scrollTop(newNavPosition); + this.winPosition = newWinPosition; + }; + + nav.onResize = function () { + this.winResize = false; + this.winHeight = this.win.height(); + this.docHeight = $(document).height(); + }; + + nav.hashChange = function () { + this.linkScroll = true; + this.win.one('hashchange', function () { + this.linkScroll = false; + }); + }; + + nav.toggleCurrent = function (elem) { + var parent_li = elem.closest('li'); + parent_li.siblings('li.current').removeClass('current'); + parent_li.siblings().find('li.current').removeClass('current'); + parent_li.find('> ul li.current').removeClass('current'); + parent_li.toggleClass('current'); + } + + return nav; +}; + +module.exports.ThemeNav = ThemeNav(); + +if (typeof(window) != 'undefined') { + window.SphinxRtdTheme = { StickyNav: module.exports.ThemeNav }; +} + +},{"jquery":"jquery"}]},{},["sphinx-rtd-theme"]); diff --git a/website/docs/_static/minus.png b/website/docs/_static/minus.png new file mode 100644 index 0000000..d96755f Binary files /dev/null and b/website/docs/_static/minus.png differ diff --git a/website/docs/_static/plus.png b/website/docs/_static/plus.png new file mode 100644 index 0000000..7107cec Binary files /dev/null and b/website/docs/_static/plus.png differ diff --git a/website/docs/_static/pygments.css b/website/docs/_static/pygments.css new file mode 100644 index 0000000..20c4814 --- /dev/null +++ b/website/docs/_static/pygments.css @@ -0,0 +1,69 @@ +.highlight .hll { background-color: #ffffcc } +.highlight { background: #eeffcc; } +.highlight .c { color: #408090; font-style: italic } /* Comment */ +.highlight .err { border: 1px solid #FF0000 } /* Error */ +.highlight .k { color: #007020; font-weight: bold } /* Keyword */ +.highlight .o { color: #666666 } /* Operator */ +.highlight .ch { color: #408090; font-style: italic } /* Comment.Hashbang */ +.highlight .cm { color: #408090; font-style: italic } /* Comment.Multiline */ +.highlight .cp { color: #007020 } /* Comment.Preproc */ +.highlight .cpf { color: #408090; font-style: italic } /* Comment.PreprocFile */ +.highlight .c1 { color: #408090; font-style: italic } /* Comment.Single */ +.highlight .cs { color: #408090; background-color: #fff0f0 } /* Comment.Special */ +.highlight .gd { color: #A00000 } /* Generic.Deleted */ +.highlight .ge { font-style: italic } /* Generic.Emph */ +.highlight .gr { color: #FF0000 } /* Generic.Error */ +.highlight .gh { color: #000080; font-weight: bold } /* Generic.Heading */ +.highlight .gi { color: #00A000 } /* Generic.Inserted */ +.highlight .go { color: #333333 } /* Generic.Output */ +.highlight .gp { color: #c65d09; font-weight: bold } /* Generic.Prompt */ +.highlight .gs { font-weight: bold } /* Generic.Strong */ +.highlight .gu { color: #800080; font-weight: bold } /* Generic.Subheading */ +.highlight .gt { color: #0044DD } /* Generic.Traceback */ +.highlight .kc { color: #007020; font-weight: bold } /* Keyword.Constant */ +.highlight .kd { color: #007020; font-weight: bold } /* Keyword.Declaration */ +.highlight .kn { color: #007020; font-weight: bold } /* Keyword.Namespace */ +.highlight .kp { color: #007020 } /* Keyword.Pseudo */ +.highlight .kr { color: #007020; font-weight: bold } /* Keyword.Reserved */ +.highlight .kt { color: #902000 } /* Keyword.Type */ +.highlight .m { color: #208050 } /* Literal.Number */ +.highlight .s { color: #4070a0 } /* Literal.String */ +.highlight .na { color: #4070a0 } /* Name.Attribute */ +.highlight .nb { color: #007020 } /* Name.Builtin */ +.highlight .nc { color: #0e84b5; font-weight: bold } /* Name.Class */ +.highlight .no { color: #60add5 } /* Name.Constant */ +.highlight .nd { color: #555555; font-weight: bold } /* Name.Decorator */ +.highlight .ni { color: #d55537; font-weight: bold } /* Name.Entity */ +.highlight .ne { color: #007020 } /* Name.Exception */ +.highlight .nf { color: #06287e } /* Name.Function */ +.highlight .nl { color: #002070; font-weight: bold } /* Name.Label */ +.highlight .nn { color: #0e84b5; font-weight: bold } /* Name.Namespace */ +.highlight .nt { color: #062873; font-weight: bold } /* Name.Tag */ +.highlight .nv { color: #bb60d5 } /* Name.Variable */ +.highlight .ow { color: #007020; font-weight: bold } /* Operator.Word */ +.highlight .w { color: #bbbbbb } /* Text.Whitespace */ +.highlight .mb { color: #208050 } /* Literal.Number.Bin */ +.highlight .mf { color: #208050 } /* Literal.Number.Float */ +.highlight .mh { color: #208050 } /* Literal.Number.Hex */ +.highlight .mi { color: #208050 } /* Literal.Number.Integer */ +.highlight .mo { color: #208050 } /* Literal.Number.Oct */ +.highlight .sa { color: #4070a0 } /* Literal.String.Affix */ +.highlight .sb { color: #4070a0 } /* Literal.String.Backtick */ +.highlight .sc { color: #4070a0 } /* Literal.String.Char */ +.highlight .dl { color: #4070a0 } /* Literal.String.Delimiter */ +.highlight .sd { color: #4070a0; font-style: italic } /* Literal.String.Doc */ +.highlight .s2 { color: #4070a0 } /* Literal.String.Double */ +.highlight .se { color: #4070a0; font-weight: bold } /* Literal.String.Escape */ +.highlight .sh { color: #4070a0 } /* Literal.String.Heredoc */ +.highlight .si { color: #70a0d0; font-style: italic } /* Literal.String.Interpol */ +.highlight .sx { color: #c65d09 } /* Literal.String.Other */ +.highlight .sr { color: #235388 } /* Literal.String.Regex */ +.highlight .s1 { color: #4070a0 } /* Literal.String.Single */ +.highlight .ss { color: #517918 } /* Literal.String.Symbol */ +.highlight .bp { color: #007020 } /* Name.Builtin.Pseudo */ +.highlight .fm { color: #06287e } /* Name.Function.Magic */ +.highlight .vc { color: #bb60d5 } /* Name.Variable.Class */ +.highlight .vg { color: #bb60d5 } /* Name.Variable.Global */ +.highlight .vi { color: #bb60d5 } /* Name.Variable.Instance */ +.highlight .vm { color: #bb60d5 } /* Name.Variable.Magic */ +.highlight .il { color: #208050 } /* Literal.Number.Integer.Long */ \ No newline at end of file diff --git a/website/docs/_static/searchtools.js b/website/docs/_static/searchtools.js new file mode 100644 index 0000000..bbfb3ac --- /dev/null +++ b/website/docs/_static/searchtools.js @@ -0,0 +1,758 @@ +/* + * searchtools.js_t + * ~~~~~~~~~~~~~~~~ + * + * Sphinx JavaScript utilities for the full-text search. + * + * :copyright: Copyright 2007-2016 by the Sphinx team, see AUTHORS. + * :license: BSD, see LICENSE for details. + * + */ + + +/* Non-minified version JS is _stemmer.js if file is provided */ +/** + * Porter Stemmer + */ +var Stemmer = function() { + + var step2list = { + ational: 'ate', + tional: 'tion', + enci: 'ence', + anci: 'ance', + izer: 'ize', + bli: 'ble', + alli: 'al', + entli: 'ent', + eli: 'e', + ousli: 'ous', + ization: 'ize', + ation: 'ate', + ator: 'ate', + alism: 'al', + iveness: 'ive', + fulness: 'ful', + ousness: 'ous', + aliti: 'al', + iviti: 'ive', + biliti: 'ble', + logi: 'log' + }; + + var step3list = { + icate: 'ic', + ative: '', + alize: 'al', + iciti: 'ic', + ical: 'ic', + ful: '', + ness: '' + }; + + var c = "[^aeiou]"; // consonant + var v = "[aeiouy]"; // vowel + var C = c + "[^aeiouy]*"; // consonant sequence + var V = v + "[aeiou]*"; // vowel sequence + + var mgr0 = "^(" + C + ")?" + V + C; // [C]VC... is m>0 + var meq1 = "^(" + C + ")?" + V + C + "(" + V + ")?$"; // [C]VC[V] is m=1 + var mgr1 = "^(" + C + ")?" + V + C + V + C; // [C]VCVC... is m>1 + var s_v = "^(" + C + ")?" + v; // vowel in stem + + this.stemWord = function (w) { + var stem; + var suffix; + var firstch; + var origword = w; + + if (w.length < 3) + return w; + + var re; + var re2; + var re3; + var re4; + + firstch = w.substr(0,1); + if (firstch == "y") + w = firstch.toUpperCase() + w.substr(1); + + // Step 1a + re = /^(.+?)(ss|i)es$/; + re2 = /^(.+?)([^s])s$/; + + if (re.test(w)) + w = w.replace(re,"$1$2"); + else if (re2.test(w)) + w = w.replace(re2,"$1$2"); + + // Step 1b + re = /^(.+?)eed$/; + re2 = /^(.+?)(ed|ing)$/; + if (re.test(w)) { + var fp = re.exec(w); + re = new RegExp(mgr0); + if (re.test(fp[1])) { + re = /.$/; + w = w.replace(re,""); + } + } + else if (re2.test(w)) { + var fp = re2.exec(w); + stem = fp[1]; + re2 = new RegExp(s_v); + if (re2.test(stem)) { + w = stem; + re2 = /(at|bl|iz)$/; + re3 = new RegExp("([^aeiouylsz])\\1$"); + re4 = new RegExp("^" + C + v + "[^aeiouwxy]$"); + if (re2.test(w)) + w = w + "e"; + else if (re3.test(w)) { + re = /.$/; + w = w.replace(re,""); + } + else if (re4.test(w)) + w = w + "e"; + } + } + + // Step 1c + re = /^(.+?)y$/; + if (re.test(w)) { + var fp = re.exec(w); + stem = fp[1]; + re = new RegExp(s_v); + if (re.test(stem)) + w = stem + "i"; + } + + // Step 2 + re = /^(.+?)(ational|tional|enci|anci|izer|bli|alli|entli|eli|ousli|ization|ation|ator|alism|iveness|fulness|ousness|aliti|iviti|biliti|logi)$/; + if (re.test(w)) { + var fp = re.exec(w); + stem = fp[1]; + suffix = fp[2]; + re = new RegExp(mgr0); + if (re.test(stem)) + w = stem + step2list[suffix]; + } + + // Step 3 + re = /^(.+?)(icate|ative|alize|iciti|ical|ful|ness)$/; + if (re.test(w)) { + var fp = re.exec(w); + stem = fp[1]; + suffix = fp[2]; + re = new RegExp(mgr0); + if (re.test(stem)) + w = stem + step3list[suffix]; + } + + // Step 4 + re = /^(.+?)(al|ance|ence|er|ic|able|ible|ant|ement|ment|ent|ou|ism|ate|iti|ous|ive|ize)$/; + re2 = /^(.+?)(s|t)(ion)$/; + if (re.test(w)) { + var fp = re.exec(w); + stem = fp[1]; + re = new RegExp(mgr1); + if (re.test(stem)) + w = stem; + } + else if (re2.test(w)) { + var fp = re2.exec(w); + stem = fp[1] + fp[2]; + re2 = new RegExp(mgr1); + if (re2.test(stem)) + w = stem; + } + + // Step 5 + re = /^(.+?)e$/; + if (re.test(w)) { + var fp = re.exec(w); + stem = fp[1]; + re = new RegExp(mgr1); + re2 = new RegExp(meq1); + re3 = new RegExp("^" + C + v + "[^aeiouwxy]$"); + if (re.test(stem) || (re2.test(stem) && !(re3.test(stem)))) + w = stem; + } + re = /ll$/; + re2 = new RegExp(mgr1); + if (re.test(w) && re2.test(w)) { + re = /.$/; + w = w.replace(re,""); + } + + // and turn initial Y back to y + if (firstch == "y") + w = firstch.toLowerCase() + w.substr(1); + return w; + } +} + + + +/** + * Simple result scoring code. + */ +var Scorer = { + // Implement the following function to further tweak the score for each result + // The function takes a result array [filename, title, anchor, descr, score] + // and returns the new score. + /* + score: function(result) { + return result[4]; + }, + */ + + // query matches the full name of an object + objNameMatch: 11, + // or matches in the last dotted part of the object name + objPartialMatch: 6, + // Additive scores depending on the priority of the object + objPrio: {0: 15, // used to be importantResults + 1: 5, // used to be objectResults + 2: -5}, // used to be unimportantResults + // Used when the priority is not in the mapping. + objPrioDefault: 0, + + // query found in title + title: 15, + // query found in terms + term: 5 +}; + + + + + +var splitChars = (function() { + var result = {}; + var singles = [96, 180, 187, 191, 215, 247, 749, 885, 903, 907, 909, 930, 1014, 1648, + 1748, 1809, 2416, 2473, 2481, 2526, 2601, 2609, 2612, 2615, 2653, 2702, + 2706, 2729, 2737, 2740, 2857, 2865, 2868, 2910, 2928, 2948, 2961, 2971, + 2973, 3085, 3089, 3113, 3124, 3213, 3217, 3241, 3252, 3295, 3341, 3345, + 3369, 3506, 3516, 3633, 3715, 3721, 3736, 3744, 3748, 3750, 3756, 3761, + 3781, 3912, 4239, 4347, 4681, 4695, 4697, 4745, 4785, 4799, 4801, 4823, + 4881, 5760, 5901, 5997, 6313, 7405, 8024, 8026, 8028, 8030, 8117, 8125, + 8133, 8181, 8468, 8485, 8487, 8489, 8494, 8527, 11311, 11359, 11687, 11695, + 11703, 11711, 11719, 11727, 11735, 12448, 12539, 43010, 43014, 43019, 43587, + 43696, 43713, 64286, 64297, 64311, 64317, 64319, 64322, 64325, 65141]; + var i, j, start, end; + for (i = 0; i < singles.length; i++) { + result[singles[i]] = true; + } + var ranges = [[0, 47], [58, 64], [91, 94], [123, 169], [171, 177], [182, 184], [706, 709], + [722, 735], [741, 747], [751, 879], [888, 889], [894, 901], [1154, 1161], + [1318, 1328], [1367, 1368], [1370, 1376], [1416, 1487], [1515, 1519], [1523, 1568], + [1611, 1631], [1642, 1645], [1750, 1764], [1767, 1773], [1789, 1790], [1792, 1807], + [1840, 1868], [1958, 1968], [1970, 1983], [2027, 2035], [2038, 2041], [2043, 2047], + [2070, 2073], [2075, 2083], [2085, 2087], [2089, 2307], [2362, 2364], [2366, 2383], + [2385, 2391], [2402, 2405], [2419, 2424], [2432, 2436], [2445, 2446], [2449, 2450], + [2483, 2485], [2490, 2492], [2494, 2509], [2511, 2523], [2530, 2533], [2546, 2547], + [2554, 2564], [2571, 2574], [2577, 2578], [2618, 2648], [2655, 2661], [2672, 2673], + [2677, 2692], [2746, 2748], [2750, 2767], [2769, 2783], [2786, 2789], [2800, 2820], + [2829, 2830], [2833, 2834], [2874, 2876], [2878, 2907], [2914, 2917], [2930, 2946], + [2955, 2957], [2966, 2968], [2976, 2978], [2981, 2983], [2987, 2989], [3002, 3023], + [3025, 3045], [3059, 3076], [3130, 3132], [3134, 3159], [3162, 3167], [3170, 3173], + [3184, 3191], [3199, 3204], [3258, 3260], [3262, 3293], [3298, 3301], [3312, 3332], + [3386, 3388], [3390, 3423], [3426, 3429], [3446, 3449], [3456, 3460], [3479, 3481], + [3518, 3519], [3527, 3584], [3636, 3647], [3655, 3663], [3674, 3712], [3717, 3718], + [3723, 3724], [3726, 3731], [3752, 3753], [3764, 3772], [3774, 3775], [3783, 3791], + [3802, 3803], [3806, 3839], [3841, 3871], [3892, 3903], [3949, 3975], [3980, 4095], + [4139, 4158], [4170, 4175], [4182, 4185], [4190, 4192], [4194, 4196], [4199, 4205], + [4209, 4212], [4226, 4237], [4250, 4255], [4294, 4303], [4349, 4351], [4686, 4687], + [4702, 4703], [4750, 4751], [4790, 4791], [4806, 4807], [4886, 4887], [4955, 4968], + [4989, 4991], [5008, 5023], [5109, 5120], [5741, 5742], [5787, 5791], [5867, 5869], + [5873, 5887], [5906, 5919], [5938, 5951], [5970, 5983], [6001, 6015], [6068, 6102], + [6104, 6107], [6109, 6111], [6122, 6127], [6138, 6159], [6170, 6175], [6264, 6271], + [6315, 6319], [6390, 6399], [6429, 6469], [6510, 6511], [6517, 6527], [6572, 6592], + [6600, 6607], [6619, 6655], [6679, 6687], [6741, 6783], [6794, 6799], [6810, 6822], + [6824, 6916], [6964, 6980], [6988, 6991], [7002, 7042], [7073, 7085], [7098, 7167], + [7204, 7231], [7242, 7244], [7294, 7400], [7410, 7423], [7616, 7679], [7958, 7959], + [7966, 7967], [8006, 8007], [8014, 8015], [8062, 8063], [8127, 8129], [8141, 8143], + [8148, 8149], [8156, 8159], [8173, 8177], [8189, 8303], [8306, 8307], [8314, 8318], + [8330, 8335], [8341, 8449], [8451, 8454], [8456, 8457], [8470, 8472], [8478, 8483], + [8506, 8507], [8512, 8516], [8522, 8525], [8586, 9311], [9372, 9449], [9472, 10101], + [10132, 11263], [11493, 11498], [11503, 11516], [11518, 11519], [11558, 11567], + [11622, 11630], [11632, 11647], [11671, 11679], [11743, 11822], [11824, 12292], + [12296, 12320], [12330, 12336], [12342, 12343], [12349, 12352], [12439, 12444], + [12544, 12548], [12590, 12592], [12687, 12689], [12694, 12703], [12728, 12783], + [12800, 12831], [12842, 12880], [12896, 12927], [12938, 12976], [12992, 13311], + [19894, 19967], [40908, 40959], [42125, 42191], [42238, 42239], [42509, 42511], + [42540, 42559], [42592, 42593], [42607, 42622], [42648, 42655], [42736, 42774], + [42784, 42785], [42889, 42890], [42893, 43002], [43043, 43055], [43062, 43071], + [43124, 43137], [43188, 43215], [43226, 43249], [43256, 43258], [43260, 43263], + [43302, 43311], [43335, 43359], [43389, 43395], [43443, 43470], [43482, 43519], + [43561, 43583], [43596, 43599], [43610, 43615], [43639, 43641], [43643, 43647], + [43698, 43700], [43703, 43704], [43710, 43711], [43715, 43738], [43742, 43967], + [44003, 44015], [44026, 44031], [55204, 55215], [55239, 55242], [55292, 55295], + [57344, 63743], [64046, 64047], [64110, 64111], [64218, 64255], [64263, 64274], + [64280, 64284], [64434, 64466], [64830, 64847], [64912, 64913], [64968, 65007], + [65020, 65135], [65277, 65295], [65306, 65312], [65339, 65344], [65371, 65381], + [65471, 65473], [65480, 65481], [65488, 65489], [65496, 65497]]; + for (i = 0; i < ranges.length; i++) { + start = ranges[i][0]; + end = ranges[i][1]; + for (j = start; j <= end; j++) { + result[j] = true; + } + } + return result; +})(); + +function splitQuery(query) { + var result = []; + var start = -1; + for (var i = 0; i < query.length; i++) { + if (splitChars[query.charCodeAt(i)]) { + if (start !== -1) { + result.push(query.slice(start, i)); + start = -1; + } + } else if (start === -1) { + start = i; + } + } + if (start !== -1) { + result.push(query.slice(start)); + } + return result; +} + + + + +/** + * Search Module + */ +var Search = { + + _index : null, + _queued_query : null, + _pulse_status : -1, + + init : function() { + var params = $.getQueryParameters(); + if (params.q) { + var query = params.q[0]; + $('input[name="q"]')[0].value = query; + this.performSearch(query); + } + }, + + loadIndex : function(url) { + $.ajax({type: "GET", url: url, data: null, + dataType: "script", cache: true, + complete: function(jqxhr, textstatus) { + if (textstatus != "success") { + document.getElementById("searchindexloader").src = url; + } + }}); + }, + + setIndex : function(index) { + var q; + this._index = index; + if ((q = this._queued_query) !== null) { + this._queued_query = null; + Search.query(q); + } + }, + + hasIndex : function() { + return this._index !== null; + }, + + deferQuery : function(query) { + this._queued_query = query; + }, + + stopPulse : function() { + this._pulse_status = 0; + }, + + startPulse : function() { + if (this._pulse_status >= 0) + return; + function pulse() { + var i; + Search._pulse_status = (Search._pulse_status + 1) % 4; + var dotString = ''; + for (i = 0; i < Search._pulse_status; i++) + dotString += '.'; + Search.dots.text(dotString); + if (Search._pulse_status > -1) + window.setTimeout(pulse, 500); + } + pulse(); + }, + + /** + * perform a search for something (or wait until index is loaded) + */ + performSearch : function(query) { + // create the required interface elements + this.out = $('#search-results'); + this.title = $('<h2>' + _('Searching') + '</h2>').appendTo(this.out); + this.dots = $('<span></span>').appendTo(this.title); + this.status = $('<p style="display: none"></p>').appendTo(this.out); + this.output = $('<ul class="search"/>').appendTo(this.out); + + $('#search-progress').text(_('Preparing search...')); + this.startPulse(); + + // index already loaded, the browser was quick! + if (this.hasIndex()) + this.query(query); + else + this.deferQuery(query); + }, + + /** + * execute search (requires search index to be loaded) + */ + query : function(query) { + var i; + var stopwords = ["a","and","are","as","at","be","but","by","for","if","in","into","is","it","near","no","not","of","on","or","such","that","the","their","then","there","these","they","this","to","was","will","with"]; + + // stem the searchterms and add them to the correct list + var stemmer = new Stemmer(); + var searchterms = []; + var excluded = []; + var hlterms = []; + var tmp = splitQuery(query); + var objectterms = []; + for (i = 0; i < tmp.length; i++) { + if (tmp[i] !== "") { + objectterms.push(tmp[i].toLowerCase()); + } + + if ($u.indexOf(stopwords, tmp[i].toLowerCase()) != -1 || tmp[i].match(/^\d+$/) || + tmp[i] === "") { + // skip this "word" + continue; + } + // stem the word + var word = stemmer.stemWord(tmp[i].toLowerCase()); + // prevent stemmer from cutting word smaller than two chars + if(word.length < 3 && tmp[i].length >= 3) { + word = tmp[i]; + } + var toAppend; + // select the correct list + if (word[0] == '-') { + toAppend = excluded; + word = word.substr(1); + } + else { + toAppend = searchterms; + hlterms.push(tmp[i].toLowerCase()); + } + // only add if not already in the list + if (!$u.contains(toAppend, word)) + toAppend.push(word); + } + var highlightstring = '?highlight=' + $.urlencode(hlterms.join(" ")); + + // console.debug('SEARCH: searching for:'); + // console.info('required: ', searchterms); + // console.info('excluded: ', excluded); + + // prepare search + var terms = this._index.terms; + var titleterms = this._index.titleterms; + + // array of [filename, title, anchor, descr, score] + var results = []; + $('#search-progress').empty(); + + // lookup as object + for (i = 0; i < objectterms.length; i++) { + var others = [].concat(objectterms.slice(0, i), + objectterms.slice(i+1, objectterms.length)); + results = results.concat(this.performObjectSearch(objectterms[i], others)); + } + + // lookup as search terms in fulltext + results = results.concat(this.performTermsSearch(searchterms, excluded, terms, titleterms)); + + // let the scorer override scores with a custom scoring function + if (Scorer.score) { + for (i = 0; i < results.length; i++) + results[i][4] = Scorer.score(results[i]); + } + + // now sort the results by score (in opposite order of appearance, since the + // display function below uses pop() to retrieve items) and then + // alphabetically + results.sort(function(a, b) { + var left = a[4]; + var right = b[4]; + if (left > right) { + return 1; + } else if (left < right) { + return -1; + } else { + // same score: sort alphabetically + left = a[1].toLowerCase(); + right = b[1].toLowerCase(); + return (left > right) ? -1 : ((left < right) ? 1 : 0); + } + }); + + // for debugging + //Search.lastresults = results.slice(); // a copy + //console.info('search results:', Search.lastresults); + + // print the results + var resultCount = results.length; + function displayNextItem() { + // results left, load the summary and display it + if (results.length) { + var item = results.pop(); + var listItem = $('<li style="display:none"></li>'); + if (DOCUMENTATION_OPTIONS.FILE_SUFFIX === '') { + // dirhtml builder + var dirname = item[0] + '/'; + if (dirname.match(/\/index\/$/)) { + dirname = dirname.substring(0, dirname.length-6); + } else if (dirname == 'index/') { + dirname = ''; + } + listItem.append($('<a/>').attr('href', + DOCUMENTATION_OPTIONS.URL_ROOT + dirname + + highlightstring + item[2]).html(item[1])); + } else { + // normal html builders + listItem.append($('<a/>').attr('href', + item[0] + DOCUMENTATION_OPTIONS.FILE_SUFFIX + + highlightstring + item[2]).html(item[1])); + } + if (item[3]) { + listItem.append($('<span> (' + item[3] + ')</span>')); + Search.output.append(listItem); + listItem.slideDown(5, function() { + displayNextItem(); + }); + } else if (DOCUMENTATION_OPTIONS.HAS_SOURCE) { + var suffix = DOCUMENTATION_OPTIONS.SOURCELINK_SUFFIX; + $.ajax({url: DOCUMENTATION_OPTIONS.URL_ROOT + '_sources/' + item[5] + (item[5].slice(-suffix.length) === suffix ? '' : suffix), + dataType: "text", + complete: function(jqxhr, textstatus) { + var data = jqxhr.responseText; + if (data !== '' && data !== undefined) { + listItem.append(Search.makeSearchSummary(data, searchterms, hlterms)); + } + Search.output.append(listItem); + listItem.slideDown(5, function() { + displayNextItem(); + }); + }}); + } else { + // no source available, just display title + Search.output.append(listItem); + listItem.slideDown(5, function() { + displayNextItem(); + }); + } + } + // search finished, update title and status message + else { + Search.stopPulse(); + Search.title.text(_('Search Results')); + if (!resultCount) + Search.status.text(_('Your search did not match any documents. Please make sure that all words are spelled correctly and that you\'ve selected enough categories.')); + else + Search.status.text(_('Search finished, found %s page(s) matching the search query.').replace('%s', resultCount)); + Search.status.fadeIn(500); + } + } + displayNextItem(); + }, + + /** + * search for object names + */ + performObjectSearch : function(object, otherterms) { + var filenames = this._index.filenames; + var docnames = this._index.docnames; + var objects = this._index.objects; + var objnames = this._index.objnames; + var titles = this._index.titles; + + var i; + var results = []; + + for (var prefix in objects) { + for (var name in objects[prefix]) { + var fullname = (prefix ? prefix + '.' : '') + name; + if (fullname.toLowerCase().indexOf(object) > -1) { + var score = 0; + var parts = fullname.split('.'); + // check for different match types: exact matches of full name or + // "last name" (i.e. last dotted part) + if (fullname == object || parts[parts.length - 1] == object) { + score += Scorer.objNameMatch; + // matches in last name + } else if (parts[parts.length - 1].indexOf(object) > -1) { + score += Scorer.objPartialMatch; + } + var match = objects[prefix][name]; + var objname = objnames[match[1]][2]; + var title = titles[match[0]]; + // If more than one term searched for, we require other words to be + // found in the name/title/description + if (otherterms.length > 0) { + var haystack = (prefix + ' ' + name + ' ' + + objname + ' ' + title).toLowerCase(); + var allfound = true; + for (i = 0; i < otherterms.length; i++) { + if (haystack.indexOf(otherterms[i]) == -1) { + allfound = false; + break; + } + } + if (!allfound) { + continue; + } + } + var descr = objname + _(', in ') + title; + + var anchor = match[3]; + if (anchor === '') + anchor = fullname; + else if (anchor == '-') + anchor = objnames[match[1]][1] + '-' + fullname; + // add custom score for some objects according to scorer + if (Scorer.objPrio.hasOwnProperty(match[2])) { + score += Scorer.objPrio[match[2]]; + } else { + score += Scorer.objPrioDefault; + } + results.push([docnames[match[0]], fullname, '#'+anchor, descr, score, filenames[match[0]]]); + } + } + } + + return results; + }, + + /** + * search for full-text terms in the index + */ + performTermsSearch : function(searchterms, excluded, terms, titleterms) { + var docnames = this._index.docnames; + var filenames = this._index.filenames; + var titles = this._index.titles; + + var i, j, file; + var fileMap = {}; + var scoreMap = {}; + var results = []; + + // perform the search on the required terms + for (i = 0; i < searchterms.length; i++) { + var word = searchterms[i]; + var files = []; + var _o = [ + {files: terms[word], score: Scorer.term}, + {files: titleterms[word], score: Scorer.title} + ]; + + // no match but word was a required one + if ($u.every(_o, function(o){return o.files === undefined;})) { + break; + } + // found search word in contents + $u.each(_o, function(o) { + var _files = o.files; + if (_files === undefined) + return + + if (_files.length === undefined) + _files = [_files]; + files = files.concat(_files); + + // set score for the word in each file to Scorer.term + for (j = 0; j < _files.length; j++) { + file = _files[j]; + if (!(file in scoreMap)) + scoreMap[file] = {} + scoreMap[file][word] = o.score; + } + }); + + // create the mapping + for (j = 0; j < files.length; j++) { + file = files[j]; + if (file in fileMap) + fileMap[file].push(word); + else + fileMap[file] = [word]; + } + } + + // now check if the files don't contain excluded terms + for (file in fileMap) { + var valid = true; + + // check if all requirements are matched + if (fileMap[file].length != searchterms.length) + continue; + + // ensure that none of the excluded terms is in the search result + for (i = 0; i < excluded.length; i++) { + if (terms[excluded[i]] == file || + titleterms[excluded[i]] == file || + $u.contains(terms[excluded[i]] || [], file) || + $u.contains(titleterms[excluded[i]] || [], file)) { + valid = false; + break; + } + } + + // if we have still a valid result we can add it to the result list + if (valid) { + // select one (max) score for the file. + // for better ranking, we should calculate ranking by using words statistics like basic tf-idf... + var score = $u.max($u.map(fileMap[file], function(w){return scoreMap[file][w]})); + results.push([docnames[file], titles[file], '', null, score, filenames[file]]); + } + } + return results; + }, + + /** + * helper function to return a node containing the + * search summary for a given text. keywords is a list + * of stemmed words, hlwords is the list of normal, unstemmed + * words. the first one is used to find the occurrence, the + * latter for highlighting it. + */ + makeSearchSummary : function(text, keywords, hlwords) { + var textLower = text.toLowerCase(); + var start = 0; + $.each(keywords, function() { + var i = textLower.indexOf(this.toLowerCase()); + if (i > -1) + start = i; + }); + start = Math.max(start - 120, 0); + var excerpt = ((start > 0) ? '...' : '') + + $.trim(text.substr(start, 240)) + + ((start + 240 - text.length) ? '...' : ''); + var rv = $('<div class="context"></div>').text(excerpt); + $.each(hlwords, function() { + rv = rv.highlightText(this, 'highlighted'); + }); + return rv; + } +}; + +$(document).ready(function() { + Search.init(); +}); \ No newline at end of file diff --git a/website/docs/_static/underscore-1.3.1.js b/website/docs/_static/underscore-1.3.1.js new file mode 100644 index 0000000..208d4cd --- /dev/null +++ b/website/docs/_static/underscore-1.3.1.js @@ -0,0 +1,999 @@ +// Underscore.js 1.3.1 +// (c) 2009-2012 Jeremy Ashkenas, DocumentCloud Inc. +// Underscore is freely distributable under the MIT license. +// Portions of Underscore are inspired or borrowed from Prototype, +// Oliver Steele's Functional, and John Resig's Micro-Templating. +// For all details and documentation: +// http://documentcloud.github.com/underscore + +(function() { + + // Baseline setup + // -------------- + + // Establish the root object, `window` in the browser, or `global` on the server. + var root = this; + + // Save the previous value of the `_` variable. + var previousUnderscore = root._; + + // Establish the object that gets returned to break out of a loop iteration. + var breaker = {}; + + // Save bytes in the minified (but not gzipped) version: + var ArrayProto = Array.prototype, ObjProto = Object.prototype, FuncProto = Function.prototype; + + // Create quick reference variables for speed access to core prototypes. + var slice = ArrayProto.slice, + unshift = ArrayProto.unshift, + toString = ObjProto.toString, + hasOwnProperty = ObjProto.hasOwnProperty; + + // All **ECMAScript 5** native function implementations that we hope to use + // are declared here. + var + nativeForEach = ArrayProto.forEach, + nativeMap = ArrayProto.map, + nativeReduce = ArrayProto.reduce, + nativeReduceRight = ArrayProto.reduceRight, + nativeFilter = ArrayProto.filter, + nativeEvery = ArrayProto.every, + nativeSome = ArrayProto.some, + nativeIndexOf = ArrayProto.indexOf, + nativeLastIndexOf = ArrayProto.lastIndexOf, + nativeIsArray = Array.isArray, + nativeKeys = Object.keys, + nativeBind = FuncProto.bind; + + // Create a safe reference to the Underscore object for use below. + var _ = function(obj) { return new wrapper(obj); }; + + // Export the Underscore object for **Node.js**, with + // backwards-compatibility for the old `require()` API. If we're in + // the browser, add `_` as a global object via a string identifier, + // for Closure Compiler "advanced" mode. + if (typeof exports !== 'undefined') { + if (typeof module !== 'undefined' && module.exports) { + exports = module.exports = _; + } + exports._ = _; + } else { + root['_'] = _; + } + + // Current version. + _.VERSION = '1.3.1'; + + // Collection Functions + // -------------------- + + // The cornerstone, an `each` implementation, aka `forEach`. + // Handles objects with the built-in `forEach`, arrays, and raw objects. + // Delegates to **ECMAScript 5**'s native `forEach` if available. + var each = _.each = _.forEach = function(obj, iterator, context) { + if (obj == null) return; + if (nativeForEach && obj.forEach === nativeForEach) { + obj.forEach(iterator, context); + } else if (obj.length === +obj.length) { + for (var i = 0, l = obj.length; i < l; i++) { + if (i in obj && iterator.call(context, obj[i], i, obj) === breaker) return; + } + } else { + for (var key in obj) { + if (_.has(obj, key)) { + if (iterator.call(context, obj[key], key, obj) === breaker) return; + } + } + } + }; + + // Return the results of applying the iterator to each element. + // Delegates to **ECMAScript 5**'s native `map` if available. + _.map = _.collect = function(obj, iterator, context) { + var results = []; + if (obj == null) return results; + if (nativeMap && obj.map === nativeMap) return obj.map(iterator, context); + each(obj, function(value, index, list) { + results[results.length] = iterator.call(context, value, index, list); + }); + if (obj.length === +obj.length) results.length = obj.length; + return results; + }; + + // **Reduce** builds up a single result from a list of values, aka `inject`, + // or `foldl`. Delegates to **ECMAScript 5**'s native `reduce` if available. + _.reduce = _.foldl = _.inject = function(obj, iterator, memo, context) { + var initial = arguments.length > 2; + if (obj == null) obj = []; + if (nativeReduce && obj.reduce === nativeReduce) { + if (context) iterator = _.bind(iterator, context); + return initial ? obj.reduce(iterator, memo) : obj.reduce(iterator); + } + each(obj, function(value, index, list) { + if (!initial) { + memo = value; + initial = true; + } else { + memo = iterator.call(context, memo, value, index, list); + } + }); + if (!initial) throw new TypeError('Reduce of empty array with no initial value'); + return memo; + }; + + // The right-associative version of reduce, also known as `foldr`. + // Delegates to **ECMAScript 5**'s native `reduceRight` if available. + _.reduceRight = _.foldr = function(obj, iterator, memo, context) { + var initial = arguments.length > 2; + if (obj == null) obj = []; + if (nativeReduceRight && obj.reduceRight === nativeReduceRight) { + if (context) iterator = _.bind(iterator, context); + return initial ? obj.reduceRight(iterator, memo) : obj.reduceRight(iterator); + } + var reversed = _.toArray(obj).reverse(); + if (context && !initial) iterator = _.bind(iterator, context); + return initial ? _.reduce(reversed, iterator, memo, context) : _.reduce(reversed, iterator); + }; + + // Return the first value which passes a truth test. Aliased as `detect`. + _.find = _.detect = function(obj, iterator, context) { + var result; + any(obj, function(value, index, list) { + if (iterator.call(context, value, index, list)) { + result = value; + return true; + } + }); + return result; + }; + + // Return all the elements that pass a truth test. + // Delegates to **ECMAScript 5**'s native `filter` if available. + // Aliased as `select`. + _.filter = _.select = function(obj, iterator, context) { + var results = []; + if (obj == null) return results; + if (nativeFilter && obj.filter === nativeFilter) return obj.filter(iterator, context); + each(obj, function(value, index, list) { + if (iterator.call(context, value, index, list)) results[results.length] = value; + }); + return results; + }; + + // Return all the elements for which a truth test fails. + _.reject = function(obj, iterator, context) { + var results = []; + if (obj == null) return results; + each(obj, function(value, index, list) { + if (!iterator.call(context, value, index, list)) results[results.length] = value; + }); + return results; + }; + + // Determine whether all of the elements match a truth test. + // Delegates to **ECMAScript 5**'s native `every` if available. + // Aliased as `all`. + _.every = _.all = function(obj, iterator, context) { + var result = true; + if (obj == null) return result; + if (nativeEvery && obj.every === nativeEvery) return obj.every(iterator, context); + each(obj, function(value, index, list) { + if (!(result = result && iterator.call(context, value, index, list))) return breaker; + }); + return result; + }; + + // Determine if at least one element in the object matches a truth test. + // Delegates to **ECMAScript 5**'s native `some` if available. + // Aliased as `any`. + var any = _.some = _.any = function(obj, iterator, context) { + iterator || (iterator = _.identity); + var result = false; + if (obj == null) return result; + if (nativeSome && obj.some === nativeSome) return obj.some(iterator, context); + each(obj, function(value, index, list) { + if (result || (result = iterator.call(context, value, index, list))) return breaker; + }); + return !!result; + }; + + // Determine if a given value is included in the array or object using `===`. + // Aliased as `contains`. + _.include = _.contains = function(obj, target) { + var found = false; + if (obj == null) return found; + if (nativeIndexOf && obj.indexOf === nativeIndexOf) return obj.indexOf(target) != -1; + found = any(obj, function(value) { + return value === target; + }); + return found; + }; + + // Invoke a method (with arguments) on every item in a collection. + _.invoke = function(obj, method) { + var args = slice.call(arguments, 2); + return _.map(obj, function(value) { + return (_.isFunction(method) ? method || value : value[method]).apply(value, args); + }); + }; + + // Convenience version of a common use case of `map`: fetching a property. + _.pluck = function(obj, key) { + return _.map(obj, function(value){ return value[key]; }); + }; + + // Return the maximum element or (element-based computation). + _.max = function(obj, iterator, context) { + if (!iterator && _.isArray(obj)) return Math.max.apply(Math, obj); + if (!iterator && _.isEmpty(obj)) return -Infinity; + var result = {computed : -Infinity}; + each(obj, function(value, index, list) { + var computed = iterator ? iterator.call(context, value, index, list) : value; + computed >= result.computed && (result = {value : value, computed : computed}); + }); + return result.value; + }; + + // Return the minimum element (or element-based computation). + _.min = function(obj, iterator, context) { + if (!iterator && _.isArray(obj)) return Math.min.apply(Math, obj); + if (!iterator && _.isEmpty(obj)) return Infinity; + var result = {computed : Infinity}; + each(obj, function(value, index, list) { + var computed = iterator ? iterator.call(context, value, index, list) : value; + computed < result.computed && (result = {value : value, computed : computed}); + }); + return result.value; + }; + + // Shuffle an array. + _.shuffle = function(obj) { + var shuffled = [], rand; + each(obj, function(value, index, list) { + if (index == 0) { + shuffled[0] = value; + } else { + rand = Math.floor(Math.random() * (index + 1)); + shuffled[index] = shuffled[rand]; + shuffled[rand] = value; + } + }); + return shuffled; + }; + + // Sort the object's values by a criterion produced by an iterator. + _.sortBy = function(obj, iterator, context) { + return _.pluck(_.map(obj, function(value, index, list) { + return { + value : value, + criteria : iterator.call(context, value, index, list) + }; + }).sort(function(left, right) { + var a = left.criteria, b = right.criteria; + return a < b ? -1 : a > b ? 1 : 0; + }), 'value'); + }; + + // Groups the object's values by a criterion. Pass either a string attribute + // to group by, or a function that returns the criterion. + _.groupBy = function(obj, val) { + var result = {}; + var iterator = _.isFunction(val) ? val : function(obj) { return obj[val]; }; + each(obj, function(value, index) { + var key = iterator(value, index); + (result[key] || (result[key] = [])).push(value); + }); + return result; + }; + + // Use a comparator function to figure out at what index an object should + // be inserted so as to maintain order. Uses binary search. + _.sortedIndex = function(array, obj, iterator) { + iterator || (iterator = _.identity); + var low = 0, high = array.length; + while (low < high) { + var mid = (low + high) >> 1; + iterator(array[mid]) < iterator(obj) ? low = mid + 1 : high = mid; + } + return low; + }; + + // Safely convert anything iterable into a real, live array. + _.toArray = function(iterable) { + if (!iterable) return []; + if (iterable.toArray) return iterable.toArray(); + if (_.isArray(iterable)) return slice.call(iterable); + if (_.isArguments(iterable)) return slice.call(iterable); + return _.values(iterable); + }; + + // Return the number of elements in an object. + _.size = function(obj) { + return _.toArray(obj).length; + }; + + // Array Functions + // --------------- + + // Get the first element of an array. Passing **n** will return the first N + // values in the array. Aliased as `head`. The **guard** check allows it to work + // with `_.map`. + _.first = _.head = function(array, n, guard) { + return (n != null) && !guard ? slice.call(array, 0, n) : array[0]; + }; + + // Returns everything but the last entry of the array. Especcialy useful on + // the arguments object. Passing **n** will return all the values in + // the array, excluding the last N. The **guard** check allows it to work with + // `_.map`. + _.initial = function(array, n, guard) { + return slice.call(array, 0, array.length - ((n == null) || guard ? 1 : n)); + }; + + // Get the last element of an array. Passing **n** will return the last N + // values in the array. The **guard** check allows it to work with `_.map`. + _.last = function(array, n, guard) { + if ((n != null) && !guard) { + return slice.call(array, Math.max(array.length - n, 0)); + } else { + return array[array.length - 1]; + } + }; + + // Returns everything but the first entry of the array. Aliased as `tail`. + // Especially useful on the arguments object. Passing an **index** will return + // the rest of the values in the array from that index onward. The **guard** + // check allows it to work with `_.map`. + _.rest = _.tail = function(array, index, guard) { + return slice.call(array, (index == null) || guard ? 1 : index); + }; + + // Trim out all falsy values from an array. + _.compact = function(array) { + return _.filter(array, function(value){ return !!value; }); + }; + + // Return a completely flattened version of an array. + _.flatten = function(array, shallow) { + return _.reduce(array, function(memo, value) { + if (_.isArray(value)) return memo.concat(shallow ? value : _.flatten(value)); + memo[memo.length] = value; + return memo; + }, []); + }; + + // Return a version of the array that does not contain the specified value(s). + _.without = function(array) { + return _.difference(array, slice.call(arguments, 1)); + }; + + // Produce a duplicate-free version of the array. If the array has already + // been sorted, you have the option of using a faster algorithm. + // Aliased as `unique`. + _.uniq = _.unique = function(array, isSorted, iterator) { + var initial = iterator ? _.map(array, iterator) : array; + var result = []; + _.reduce(initial, function(memo, el, i) { + if (0 == i || (isSorted === true ? _.last(memo) != el : !_.include(memo, el))) { + memo[memo.length] = el; + result[result.length] = array[i]; + } + return memo; + }, []); + return result; + }; + + // Produce an array that contains the union: each distinct element from all of + // the passed-in arrays. + _.union = function() { + return _.uniq(_.flatten(arguments, true)); + }; + + // Produce an array that contains every item shared between all the + // passed-in arrays. (Aliased as "intersect" for back-compat.) + _.intersection = _.intersect = function(array) { + var rest = slice.call(arguments, 1); + return _.filter(_.uniq(array), function(item) { + return _.every(rest, function(other) { + return _.indexOf(other, item) >= 0; + }); + }); + }; + + // Take the difference between one array and a number of other arrays. + // Only the elements present in just the first array will remain. + _.difference = function(array) { + var rest = _.flatten(slice.call(arguments, 1)); + return _.filter(array, function(value){ return !_.include(rest, value); }); + }; + + // Zip together multiple lists into a single array -- elements that share + // an index go together. + _.zip = function() { + var args = slice.call(arguments); + var length = _.max(_.pluck(args, 'length')); + var results = new Array(length); + for (var i = 0; i < length; i++) results[i] = _.pluck(args, "" + i); + return results; + }; + + // If the browser doesn't supply us with indexOf (I'm looking at you, **MSIE**), + // we need this function. Return the position of the first occurrence of an + // item in an array, or -1 if the item is not included in the array. + // Delegates to **ECMAScript 5**'s native `indexOf` if available. + // If the array is large and already in sort order, pass `true` + // for **isSorted** to use binary search. + _.indexOf = function(array, item, isSorted) { + if (array == null) return -1; + var i, l; + if (isSorted) { + i = _.sortedIndex(array, item); + return array[i] === item ? i : -1; + } + if (nativeIndexOf && array.indexOf === nativeIndexOf) return array.indexOf(item); + for (i = 0, l = array.length; i < l; i++) if (i in array && array[i] === item) return i; + return -1; + }; + + // Delegates to **ECMAScript 5**'s native `lastIndexOf` if available. + _.lastIndexOf = function(array, item) { + if (array == null) return -1; + if (nativeLastIndexOf && array.lastIndexOf === nativeLastIndexOf) return array.lastIndexOf(item); + var i = array.length; + while (i--) if (i in array && array[i] === item) return i; + return -1; + }; + + // Generate an integer Array containing an arithmetic progression. A port of + // the native Python `range()` function. See + // [the Python documentation](http://docs.python.org/library/functions.html#range). + _.range = function(start, stop, step) { + if (arguments.length <= 1) { + stop = start || 0; + start = 0; + } + step = arguments[2] || 1; + + var len = Math.max(Math.ceil((stop - start) / step), 0); + var idx = 0; + var range = new Array(len); + + while(idx < len) { + range[idx++] = start; + start += step; + } + + return range; + }; + + // Function (ahem) Functions + // ------------------ + + // Reusable constructor function for prototype setting. + var ctor = function(){}; + + // Create a function bound to a given object (assigning `this`, and arguments, + // optionally). Binding with arguments is also known as `curry`. + // Delegates to **ECMAScript 5**'s native `Function.bind` if available. + // We check for `func.bind` first, to fail fast when `func` is undefined. + _.bind = function bind(func, context) { + var bound, args; + if (func.bind === nativeBind && nativeBind) return nativeBind.apply(func, slice.call(arguments, 1)); + if (!_.isFunction(func)) throw new TypeError; + args = slice.call(arguments, 2); + return bound = function() { + if (!(this instanceof bound)) return func.apply(context, args.concat(slice.call(arguments))); + ctor.prototype = func.prototype; + var self = new ctor; + var result = func.apply(self, args.concat(slice.call(arguments))); + if (Object(result) === result) return result; + return self; + }; + }; + + // Bind all of an object's methods to that object. Useful for ensuring that + // all callbacks defined on an object belong to it. + _.bindAll = function(obj) { + var funcs = slice.call(arguments, 1); + if (funcs.length == 0) funcs = _.functions(obj); + each(funcs, function(f) { obj[f] = _.bind(obj[f], obj); }); + return obj; + }; + + // Memoize an expensive function by storing its results. + _.memoize = function(func, hasher) { + var memo = {}; + hasher || (hasher = _.identity); + return function() { + var key = hasher.apply(this, arguments); + return _.has(memo, key) ? memo[key] : (memo[key] = func.apply(this, arguments)); + }; + }; + + // Delays a function for the given number of milliseconds, and then calls + // it with the arguments supplied. + _.delay = function(func, wait) { + var args = slice.call(arguments, 2); + return setTimeout(function(){ return func.apply(func, args); }, wait); + }; + + // Defers a function, scheduling it to run after the current call stack has + // cleared. + _.defer = function(func) { + return _.delay.apply(_, [func, 1].concat(slice.call(arguments, 1))); + }; + + // Returns a function, that, when invoked, will only be triggered at most once + // during a given window of time. + _.throttle = function(func, wait) { + var context, args, timeout, throttling, more; + var whenDone = _.debounce(function(){ more = throttling = false; }, wait); + return function() { + context = this; args = arguments; + var later = function() { + timeout = null; + if (more) func.apply(context, args); + whenDone(); + }; + if (!timeout) timeout = setTimeout(later, wait); + if (throttling) { + more = true; + } else { + func.apply(context, args); + } + whenDone(); + throttling = true; + }; + }; + + // Returns a function, that, as long as it continues to be invoked, will not + // be triggered. The function will be called after it stops being called for + // N milliseconds. + _.debounce = function(func, wait) { + var timeout; + return function() { + var context = this, args = arguments; + var later = function() { + timeout = null; + func.apply(context, args); + }; + clearTimeout(timeout); + timeout = setTimeout(later, wait); + }; + }; + + // Returns a function that will be executed at most one time, no matter how + // often you call it. Useful for lazy initialization. + _.once = function(func) { + var ran = false, memo; + return function() { + if (ran) return memo; + ran = true; + return memo = func.apply(this, arguments); + }; + }; + + // Returns the first function passed as an argument to the second, + // allowing you to adjust arguments, run code before and after, and + // conditionally execute the original function. + _.wrap = function(func, wrapper) { + return function() { + var args = [func].concat(slice.call(arguments, 0)); + return wrapper.apply(this, args); + }; + }; + + // Returns a function that is the composition of a list of functions, each + // consuming the return value of the function that follows. + _.compose = function() { + var funcs = arguments; + return function() { + var args = arguments; + for (var i = funcs.length - 1; i >= 0; i--) { + args = [funcs[i].apply(this, args)]; + } + return args[0]; + }; + }; + + // Returns a function that will only be executed after being called N times. + _.after = function(times, func) { + if (times <= 0) return func(); + return function() { + if (--times < 1) { return func.apply(this, arguments); } + }; + }; + + // Object Functions + // ---------------- + + // Retrieve the names of an object's properties. + // Delegates to **ECMAScript 5**'s native `Object.keys` + _.keys = nativeKeys || function(obj) { + if (obj !== Object(obj)) throw new TypeError('Invalid object'); + var keys = []; + for (var key in obj) if (_.has(obj, key)) keys[keys.length] = key; + return keys; + }; + + // Retrieve the values of an object's properties. + _.values = function(obj) { + return _.map(obj, _.identity); + }; + + // Return a sorted list of the function names available on the object. + // Aliased as `methods` + _.functions = _.methods = function(obj) { + var names = []; + for (var key in obj) { + if (_.isFunction(obj[key])) names.push(key); + } + return names.sort(); + }; + + // Extend a given object with all the properties in passed-in object(s). + _.extend = function(obj) { + each(slice.call(arguments, 1), function(source) { + for (var prop in source) { + obj[prop] = source[prop]; + } + }); + return obj; + }; + + // Fill in a given object with default properties. + _.defaults = function(obj) { + each(slice.call(arguments, 1), function(source) { + for (var prop in source) { + if (obj[prop] == null) obj[prop] = source[prop]; + } + }); + return obj; + }; + + // Create a (shallow-cloned) duplicate of an object. + _.clone = function(obj) { + if (!_.isObject(obj)) return obj; + return _.isArray(obj) ? obj.slice() : _.extend({}, obj); + }; + + // Invokes interceptor with the obj, and then returns obj. + // The primary purpose of this method is to "tap into" a method chain, in + // order to perform operations on intermediate results within the chain. + _.tap = function(obj, interceptor) { + interceptor(obj); + return obj; + }; + + // Internal recursive comparison function. + function eq(a, b, stack) { + // Identical objects are equal. `0 === -0`, but they aren't identical. + // See the Harmony `egal` proposal: http://wiki.ecmascript.org/doku.php?id=harmony:egal. + if (a === b) return a !== 0 || 1 / a == 1 / b; + // A strict comparison is necessary because `null == undefined`. + if (a == null || b == null) return a === b; + // Unwrap any wrapped objects. + if (a._chain) a = a._wrapped; + if (b._chain) b = b._wrapped; + // Invoke a custom `isEqual` method if one is provided. + if (a.isEqual && _.isFunction(a.isEqual)) return a.isEqual(b); + if (b.isEqual && _.isFunction(b.isEqual)) return b.isEqual(a); + // Compare `[[Class]]` names. + var className = toString.call(a); + if (className != toString.call(b)) return false; + switch (className) { + // Strings, numbers, dates, and booleans are compared by value. + case '[object String]': + // Primitives and their corresponding object wrappers are equivalent; thus, `"5"` is + // equivalent to `new String("5")`. + return a == String(b); + case '[object Number]': + // `NaN`s are equivalent, but non-reflexive. An `egal` comparison is performed for + // other numeric values. + return a != +a ? b != +b : (a == 0 ? 1 / a == 1 / b : a == +b); + case '[object Date]': + case '[object Boolean]': + // Coerce dates and booleans to numeric primitive values. Dates are compared by their + // millisecond representations. Note that invalid dates with millisecond representations + // of `NaN` are not equivalent. + return +a == +b; + // RegExps are compared by their source patterns and flags. + case '[object RegExp]': + return a.source == b.source && + a.global == b.global && + a.multiline == b.multiline && + a.ignoreCase == b.ignoreCase; + } + if (typeof a != 'object' || typeof b != 'object') return false; + // Assume equality for cyclic structures. The algorithm for detecting cyclic + // structures is adapted from ES 5.1 section 15.12.3, abstract operation `JO`. + var length = stack.length; + while (length--) { + // Linear search. Performance is inversely proportional to the number of + // unique nested structures. + if (stack[length] == a) return true; + } + // Add the first object to the stack of traversed objects. + stack.push(a); + var size = 0, result = true; + // Recursively compare objects and arrays. + if (className == '[object Array]') { + // Compare array lengths to determine if a deep comparison is necessary. + size = a.length; + result = size == b.length; + if (result) { + // Deep compare the contents, ignoring non-numeric properties. + while (size--) { + // Ensure commutative equality for sparse arrays. + if (!(result = size in a == size in b && eq(a[size], b[size], stack))) break; + } + } + } else { + // Objects with different constructors are not equivalent. + if ('constructor' in a != 'constructor' in b || a.constructor != b.constructor) return false; + // Deep compare objects. + for (var key in a) { + if (_.has(a, key)) { + // Count the expected number of properties. + size++; + // Deep compare each member. + if (!(result = _.has(b, key) && eq(a[key], b[key], stack))) break; + } + } + // Ensure that both objects contain the same number of properties. + if (result) { + for (key in b) { + if (_.has(b, key) && !(size--)) break; + } + result = !size; + } + } + // Remove the first object from the stack of traversed objects. + stack.pop(); + return result; + } + + // Perform a deep comparison to check if two objects are equal. + _.isEqual = function(a, b) { + return eq(a, b, []); + }; + + // Is a given array, string, or object empty? + // An "empty" object has no enumerable own-properties. + _.isEmpty = function(obj) { + if (_.isArray(obj) || _.isString(obj)) return obj.length === 0; + for (var key in obj) if (_.has(obj, key)) return false; + return true; + }; + + // Is a given value a DOM element? + _.isElement = function(obj) { + return !!(obj && obj.nodeType == 1); + }; + + // Is a given value an array? + // Delegates to ECMA5's native Array.isArray + _.isArray = nativeIsArray || function(obj) { + return toString.call(obj) == '[object Array]'; + }; + + // Is a given variable an object? + _.isObject = function(obj) { + return obj === Object(obj); + }; + + // Is a given variable an arguments object? + _.isArguments = function(obj) { + return toString.call(obj) == '[object Arguments]'; + }; + if (!_.isArguments(arguments)) { + _.isArguments = function(obj) { + return !!(obj && _.has(obj, 'callee')); + }; + } + + // Is a given value a function? + _.isFunction = function(obj) { + return toString.call(obj) == '[object Function]'; + }; + + // Is a given value a string? + _.isString = function(obj) { + return toString.call(obj) == '[object String]'; + }; + + // Is a given value a number? + _.isNumber = function(obj) { + return toString.call(obj) == '[object Number]'; + }; + + // Is the given value `NaN`? + _.isNaN = function(obj) { + // `NaN` is the only value for which `===` is not reflexive. + return obj !== obj; + }; + + // Is a given value a boolean? + _.isBoolean = function(obj) { + return obj === true || obj === false || toString.call(obj) == '[object Boolean]'; + }; + + // Is a given value a date? + _.isDate = function(obj) { + return toString.call(obj) == '[object Date]'; + }; + + // Is the given value a regular expression? + _.isRegExp = function(obj) { + return toString.call(obj) == '[object RegExp]'; + }; + + // Is a given value equal to null? + _.isNull = function(obj) { + return obj === null; + }; + + // Is a given variable undefined? + _.isUndefined = function(obj) { + return obj === void 0; + }; + + // Has own property? + _.has = function(obj, key) { + return hasOwnProperty.call(obj, key); + }; + + // Utility Functions + // ----------------- + + // Run Underscore.js in *noConflict* mode, returning the `_` variable to its + // previous owner. Returns a reference to the Underscore object. + _.noConflict = function() { + root._ = previousUnderscore; + return this; + }; + + // Keep the identity function around for default iterators. + _.identity = function(value) { + return value; + }; + + // Run a function **n** times. + _.times = function (n, iterator, context) { + for (var i = 0; i < n; i++) iterator.call(context, i); + }; + + // Escape a string for HTML interpolation. + _.escape = function(string) { + return (''+string).replace(/&/g, '&').replace(/</g, '<').replace(/>/g, '>').replace(/"/g, '"').replace(/'/g, ''').replace(/\//g,'/'); + }; + + // Add your own custom functions to the Underscore object, ensuring that + // they're correctly added to the OOP wrapper as well. + _.mixin = function(obj) { + each(_.functions(obj), function(name){ + addToWrapper(name, _[name] = obj[name]); + }); + }; + + // Generate a unique integer id (unique within the entire client session). + // Useful for temporary DOM ids. + var idCounter = 0; + _.uniqueId = function(prefix) { + var id = idCounter++; + return prefix ? prefix + id : id; + }; + + // By default, Underscore uses ERB-style template delimiters, change the + // following template settings to use alternative delimiters. + _.templateSettings = { + evaluate : /<%([\s\S]+?)%>/g, + interpolate : /<%=([\s\S]+?)%>/g, + escape : /<%-([\s\S]+?)%>/g + }; + + // When customizing `templateSettings`, if you don't want to define an + // interpolation, evaluation or escaping regex, we need one that is + // guaranteed not to match. + var noMatch = /.^/; + + // Within an interpolation, evaluation, or escaping, remove HTML escaping + // that had been previously added. + var unescape = function(code) { + return code.replace(/\\\\/g, '\\').replace(/\\'/g, "'"); + }; + + // JavaScript micro-templating, similar to John Resig's implementation. + // Underscore templating handles arbitrary delimiters, preserves whitespace, + // and correctly escapes quotes within interpolated code. + _.template = function(str, data) { + var c = _.templateSettings; + var tmpl = 'var __p=[],print=function(){__p.push.apply(__p,arguments);};' + + 'with(obj||{}){__p.push(\'' + + str.replace(/\\/g, '\\\\') + .replace(/'/g, "\\'") + .replace(c.escape || noMatch, function(match, code) { + return "',_.escape(" + unescape(code) + "),'"; + }) + .replace(c.interpolate || noMatch, function(match, code) { + return "'," + unescape(code) + ",'"; + }) + .replace(c.evaluate || noMatch, function(match, code) { + return "');" + unescape(code).replace(/[\r\n\t]/g, ' ') + ";__p.push('"; + }) + .replace(/\r/g, '\\r') + .replace(/\n/g, '\\n') + .replace(/\t/g, '\\t') + + "');}return __p.join('');"; + var func = new Function('obj', '_', tmpl); + if (data) return func(data, _); + return function(data) { + return func.call(this, data, _); + }; + }; + + // Add a "chain" function, which will delegate to the wrapper. + _.chain = function(obj) { + return _(obj).chain(); + }; + + // The OOP Wrapper + // --------------- + + // If Underscore is called as a function, it returns a wrapped object that + // can be used OO-style. This wrapper holds altered versions of all the + // underscore functions. Wrapped objects may be chained. + var wrapper = function(obj) { this._wrapped = obj; }; + + // Expose `wrapper.prototype` as `_.prototype` + _.prototype = wrapper.prototype; + + // Helper function to continue chaining intermediate results. + var result = function(obj, chain) { + return chain ? _(obj).chain() : obj; + }; + + // A method to easily add functions to the OOP wrapper. + var addToWrapper = function(name, func) { + wrapper.prototype[name] = function() { + var args = slice.call(arguments); + unshift.call(args, this._wrapped); + return result(func.apply(_, args), this._chain); + }; + }; + + // Add all of the Underscore functions to the wrapper object. + _.mixin(_); + + // Add all mutator Array functions to the wrapper. + each(['pop', 'push', 'reverse', 'shift', 'sort', 'splice', 'unshift'], function(name) { + var method = ArrayProto[name]; + wrapper.prototype[name] = function() { + var wrapped = this._wrapped; + method.apply(wrapped, arguments); + var length = wrapped.length; + if ((name == 'shift' || name == 'splice') && length === 0) delete wrapped[0]; + return result(wrapped, this._chain); + }; + }); + + // Add all accessor Array functions to the wrapper. + each(['concat', 'join', 'slice'], function(name) { + var method = ArrayProto[name]; + wrapper.prototype[name] = function() { + return result(method.apply(this._wrapped, arguments), this._chain); + }; + }); + + // Start chaining a wrapped Underscore object. + wrapper.prototype.chain = function() { + this._chain = true; + return this; + }; + + // Extracts the result from a wrapped and chained object. + wrapper.prototype.value = function() { + return this._wrapped; + }; + +}).call(this); diff --git a/website/docs/_static/underscore.js b/website/docs/_static/underscore.js new file mode 100644 index 0000000..5b55f32 --- /dev/null +++ b/website/docs/_static/underscore.js @@ -0,0 +1,31 @@ +// Underscore.js 1.3.1 +// (c) 2009-2012 Jeremy Ashkenas, DocumentCloud Inc. +// Underscore is freely distributable under the MIT license. +// Portions of Underscore are inspired or borrowed from Prototype, +// Oliver Steele's Functional, and John Resig's Micro-Templating. +// For all details and documentation: +// http://documentcloud.github.com/underscore +(function(){function q(a,c,d){if(a===c)return a!==0||1/a==1/c;if(a==null||c==null)return a===c;if(a._chain)a=a._wrapped;if(c._chain)c=c._wrapped;if(a.isEqual&&b.isFunction(a.isEqual))return a.isEqual(c);if(c.isEqual&&b.isFunction(c.isEqual))return c.isEqual(a);var e=l.call(a);if(e!=l.call(c))return false;switch(e){case "[object String]":return a==String(c);case "[object Number]":return a!=+a?c!=+c:a==0?1/a==1/c:a==+c;case "[object Date]":case "[object Boolean]":return+a==+c;case "[object RegExp]":return a.source== +c.source&&a.global==c.global&&a.multiline==c.multiline&&a.ignoreCase==c.ignoreCase}if(typeof a!="object"||typeof c!="object")return false;for(var f=d.length;f--;)if(d[f]==a)return true;d.push(a);var f=0,g=true;if(e=="[object Array]"){if(f=a.length,g=f==c.length)for(;f--;)if(!(g=f in a==f in c&&q(a[f],c[f],d)))break}else{if("constructor"in a!="constructor"in c||a.constructor!=c.constructor)return false;for(var h in a)if(b.has(a,h)&&(f++,!(g=b.has(c,h)&&q(a[h],c[h],d))))break;if(g){for(h in c)if(b.has(c, +h)&&!f--)break;g=!f}}d.pop();return g}var r=this,G=r._,n={},k=Array.prototype,o=Object.prototype,i=k.slice,H=k.unshift,l=o.toString,I=o.hasOwnProperty,w=k.forEach,x=k.map,y=k.reduce,z=k.reduceRight,A=k.filter,B=k.every,C=k.some,p=k.indexOf,D=k.lastIndexOf,o=Array.isArray,J=Object.keys,s=Function.prototype.bind,b=function(a){return new m(a)};if(typeof exports!=="undefined"){if(typeof module!=="undefined"&&module.exports)exports=module.exports=b;exports._=b}else r._=b;b.VERSION="1.3.1";var j=b.each= +b.forEach=function(a,c,d){if(a!=null)if(w&&a.forEach===w)a.forEach(c,d);else if(a.length===+a.length)for(var e=0,f=a.length;e<f;e++){if(e in a&&c.call(d,a[e],e,a)===n)break}else for(e in a)if(b.has(a,e)&&c.call(d,a[e],e,a)===n)break};b.map=b.collect=function(a,c,b){var e=[];if(a==null)return e;if(x&&a.map===x)return a.map(c,b);j(a,function(a,g,h){e[e.length]=c.call(b,a,g,h)});if(a.length===+a.length)e.length=a.length;return e};b.reduce=b.foldl=b.inject=function(a,c,d,e){var f=arguments.length>2;a== +null&&(a=[]);if(y&&a.reduce===y)return e&&(c=b.bind(c,e)),f?a.reduce(c,d):a.reduce(c);j(a,function(a,b,i){f?d=c.call(e,d,a,b,i):(d=a,f=true)});if(!f)throw new TypeError("Reduce of empty array with no initial value");return d};b.reduceRight=b.foldr=function(a,c,d,e){var f=arguments.length>2;a==null&&(a=[]);if(z&&a.reduceRight===z)return e&&(c=b.bind(c,e)),f?a.reduceRight(c,d):a.reduceRight(c);var g=b.toArray(a).reverse();e&&!f&&(c=b.bind(c,e));return f?b.reduce(g,c,d,e):b.reduce(g,c)};b.find=b.detect= +function(a,c,b){var e;E(a,function(a,g,h){if(c.call(b,a,g,h))return e=a,true});return e};b.filter=b.select=function(a,c,b){var e=[];if(a==null)return e;if(A&&a.filter===A)return a.filter(c,b);j(a,function(a,g,h){c.call(b,a,g,h)&&(e[e.length]=a)});return e};b.reject=function(a,c,b){var e=[];if(a==null)return e;j(a,function(a,g,h){c.call(b,a,g,h)||(e[e.length]=a)});return e};b.every=b.all=function(a,c,b){var e=true;if(a==null)return e;if(B&&a.every===B)return a.every(c,b);j(a,function(a,g,h){if(!(e= +e&&c.call(b,a,g,h)))return n});return e};var E=b.some=b.any=function(a,c,d){c||(c=b.identity);var e=false;if(a==null)return e;if(C&&a.some===C)return a.some(c,d);j(a,function(a,b,h){if(e||(e=c.call(d,a,b,h)))return n});return!!e};b.include=b.contains=function(a,c){var b=false;if(a==null)return b;return p&&a.indexOf===p?a.indexOf(c)!=-1:b=E(a,function(a){return a===c})};b.invoke=function(a,c){var d=i.call(arguments,2);return b.map(a,function(a){return(b.isFunction(c)?c||a:a[c]).apply(a,d)})};b.pluck= +function(a,c){return b.map(a,function(a){return a[c]})};b.max=function(a,c,d){if(!c&&b.isArray(a))return Math.max.apply(Math,a);if(!c&&b.isEmpty(a))return-Infinity;var e={computed:-Infinity};j(a,function(a,b,h){b=c?c.call(d,a,b,h):a;b>=e.computed&&(e={value:a,computed:b})});return e.value};b.min=function(a,c,d){if(!c&&b.isArray(a))return Math.min.apply(Math,a);if(!c&&b.isEmpty(a))return Infinity;var e={computed:Infinity};j(a,function(a,b,h){b=c?c.call(d,a,b,h):a;b<e.computed&&(e={value:a,computed:b})}); +return e.value};b.shuffle=function(a){var b=[],d;j(a,function(a,f){f==0?b[0]=a:(d=Math.floor(Math.random()*(f+1)),b[f]=b[d],b[d]=a)});return b};b.sortBy=function(a,c,d){return b.pluck(b.map(a,function(a,b,g){return{value:a,criteria:c.call(d,a,b,g)}}).sort(function(a,b){var c=a.criteria,d=b.criteria;return c<d?-1:c>d?1:0}),"value")};b.groupBy=function(a,c){var d={},e=b.isFunction(c)?c:function(a){return a[c]};j(a,function(a,b){var c=e(a,b);(d[c]||(d[c]=[])).push(a)});return d};b.sortedIndex=function(a, +c,d){d||(d=b.identity);for(var e=0,f=a.length;e<f;){var g=e+f>>1;d(a[g])<d(c)?e=g+1:f=g}return e};b.toArray=function(a){return!a?[]:a.toArray?a.toArray():b.isArray(a)?i.call(a):b.isArguments(a)?i.call(a):b.values(a)};b.size=function(a){return b.toArray(a).length};b.first=b.head=function(a,b,d){return b!=null&&!d?i.call(a,0,b):a[0]};b.initial=function(a,b,d){return i.call(a,0,a.length-(b==null||d?1:b))};b.last=function(a,b,d){return b!=null&&!d?i.call(a,Math.max(a.length-b,0)):a[a.length-1]};b.rest= +b.tail=function(a,b,d){return i.call(a,b==null||d?1:b)};b.compact=function(a){return b.filter(a,function(a){return!!a})};b.flatten=function(a,c){return b.reduce(a,function(a,e){if(b.isArray(e))return a.concat(c?e:b.flatten(e));a[a.length]=e;return a},[])};b.without=function(a){return b.difference(a,i.call(arguments,1))};b.uniq=b.unique=function(a,c,d){var d=d?b.map(a,d):a,e=[];b.reduce(d,function(d,g,h){if(0==h||(c===true?b.last(d)!=g:!b.include(d,g)))d[d.length]=g,e[e.length]=a[h];return d},[]); +return e};b.union=function(){return b.uniq(b.flatten(arguments,true))};b.intersection=b.intersect=function(a){var c=i.call(arguments,1);return b.filter(b.uniq(a),function(a){return b.every(c,function(c){return b.indexOf(c,a)>=0})})};b.difference=function(a){var c=b.flatten(i.call(arguments,1));return b.filter(a,function(a){return!b.include(c,a)})};b.zip=function(){for(var a=i.call(arguments),c=b.max(b.pluck(a,"length")),d=Array(c),e=0;e<c;e++)d[e]=b.pluck(a,""+e);return d};b.indexOf=function(a,c, +d){if(a==null)return-1;var e;if(d)return d=b.sortedIndex(a,c),a[d]===c?d:-1;if(p&&a.indexOf===p)return a.indexOf(c);for(d=0,e=a.length;d<e;d++)if(d in a&&a[d]===c)return d;return-1};b.lastIndexOf=function(a,b){if(a==null)return-1;if(D&&a.lastIndexOf===D)return a.lastIndexOf(b);for(var d=a.length;d--;)if(d in a&&a[d]===b)return d;return-1};b.range=function(a,b,d){arguments.length<=1&&(b=a||0,a=0);for(var d=arguments[2]||1,e=Math.max(Math.ceil((b-a)/d),0),f=0,g=Array(e);f<e;)g[f++]=a,a+=d;return g}; +var F=function(){};b.bind=function(a,c){var d,e;if(a.bind===s&&s)return s.apply(a,i.call(arguments,1));if(!b.isFunction(a))throw new TypeError;e=i.call(arguments,2);return d=function(){if(!(this instanceof d))return a.apply(c,e.concat(i.call(arguments)));F.prototype=a.prototype;var b=new F,g=a.apply(b,e.concat(i.call(arguments)));return Object(g)===g?g:b}};b.bindAll=function(a){var c=i.call(arguments,1);c.length==0&&(c=b.functions(a));j(c,function(c){a[c]=b.bind(a[c],a)});return a};b.memoize=function(a, +c){var d={};c||(c=b.identity);return function(){var e=c.apply(this,arguments);return b.has(d,e)?d[e]:d[e]=a.apply(this,arguments)}};b.delay=function(a,b){var d=i.call(arguments,2);return setTimeout(function(){return a.apply(a,d)},b)};b.defer=function(a){return b.delay.apply(b,[a,1].concat(i.call(arguments,1)))};b.throttle=function(a,c){var d,e,f,g,h,i=b.debounce(function(){h=g=false},c);return function(){d=this;e=arguments;var b;f||(f=setTimeout(function(){f=null;h&&a.apply(d,e);i()},c));g?h=true: +a.apply(d,e);i();g=true}};b.debounce=function(a,b){var d;return function(){var e=this,f=arguments;clearTimeout(d);d=setTimeout(function(){d=null;a.apply(e,f)},b)}};b.once=function(a){var b=false,d;return function(){if(b)return d;b=true;return d=a.apply(this,arguments)}};b.wrap=function(a,b){return function(){var d=[a].concat(i.call(arguments,0));return b.apply(this,d)}};b.compose=function(){var a=arguments;return function(){for(var b=arguments,d=a.length-1;d>=0;d--)b=[a[d].apply(this,b)];return b[0]}}; +b.after=function(a,b){return a<=0?b():function(){if(--a<1)return b.apply(this,arguments)}};b.keys=J||function(a){if(a!==Object(a))throw new TypeError("Invalid object");var c=[],d;for(d in a)b.has(a,d)&&(c[c.length]=d);return c};b.values=function(a){return b.map(a,b.identity)};b.functions=b.methods=function(a){var c=[],d;for(d in a)b.isFunction(a[d])&&c.push(d);return c.sort()};b.extend=function(a){j(i.call(arguments,1),function(b){for(var d in b)a[d]=b[d]});return a};b.defaults=function(a){j(i.call(arguments, +1),function(b){for(var d in b)a[d]==null&&(a[d]=b[d])});return a};b.clone=function(a){return!b.isObject(a)?a:b.isArray(a)?a.slice():b.extend({},a)};b.tap=function(a,b){b(a);return a};b.isEqual=function(a,b){return q(a,b,[])};b.isEmpty=function(a){if(b.isArray(a)||b.isString(a))return a.length===0;for(var c in a)if(b.has(a,c))return false;return true};b.isElement=function(a){return!!(a&&a.nodeType==1)};b.isArray=o||function(a){return l.call(a)=="[object Array]"};b.isObject=function(a){return a===Object(a)}; +b.isArguments=function(a){return l.call(a)=="[object Arguments]"};if(!b.isArguments(arguments))b.isArguments=function(a){return!(!a||!b.has(a,"callee"))};b.isFunction=function(a){return l.call(a)=="[object Function]"};b.isString=function(a){return l.call(a)=="[object String]"};b.isNumber=function(a){return l.call(a)=="[object Number]"};b.isNaN=function(a){return a!==a};b.isBoolean=function(a){return a===true||a===false||l.call(a)=="[object Boolean]"};b.isDate=function(a){return l.call(a)=="[object Date]"}; +b.isRegExp=function(a){return l.call(a)=="[object RegExp]"};b.isNull=function(a){return a===null};b.isUndefined=function(a){return a===void 0};b.has=function(a,b){return I.call(a,b)};b.noConflict=function(){r._=G;return this};b.identity=function(a){return a};b.times=function(a,b,d){for(var e=0;e<a;e++)b.call(d,e)};b.escape=function(a){return(""+a).replace(/&/g,"&").replace(/</g,"<").replace(/>/g,">").replace(/"/g,""").replace(/'/g,"'").replace(/\//g,"/")};b.mixin=function(a){j(b.functions(a), +function(c){K(c,b[c]=a[c])})};var L=0;b.uniqueId=function(a){var b=L++;return a?a+b:b};b.templateSettings={evaluate:/<%([\s\S]+?)%>/g,interpolate:/<%=([\s\S]+?)%>/g,escape:/<%-([\s\S]+?)%>/g};var t=/.^/,u=function(a){return a.replace(/\\\\/g,"\\").replace(/\\'/g,"'")};b.template=function(a,c){var d=b.templateSettings,d="var __p=[],print=function(){__p.push.apply(__p,arguments);};with(obj||{}){__p.push('"+a.replace(/\\/g,"\\\\").replace(/'/g,"\\'").replace(d.escape||t,function(a,b){return"',_.escape("+ +u(b)+"),'"}).replace(d.interpolate||t,function(a,b){return"',"+u(b)+",'"}).replace(d.evaluate||t,function(a,b){return"');"+u(b).replace(/[\r\n\t]/g," ")+";__p.push('"}).replace(/\r/g,"\\r").replace(/\n/g,"\\n").replace(/\t/g,"\\t")+"');}return __p.join('');",e=new Function("obj","_",d);return c?e(c,b):function(a){return e.call(this,a,b)}};b.chain=function(a){return b(a).chain()};var m=function(a){this._wrapped=a};b.prototype=m.prototype;var v=function(a,c){return c?b(a).chain():a},K=function(a,c){m.prototype[a]= +function(){var a=i.call(arguments);H.call(a,this._wrapped);return v(c.apply(b,a),this._chain)}};b.mixin(b);j("pop,push,reverse,shift,sort,splice,unshift".split(","),function(a){var b=k[a];m.prototype[a]=function(){var d=this._wrapped;b.apply(d,arguments);var e=d.length;(a=="shift"||a=="splice")&&e===0&&delete d[0];return v(d,this._chain)}});j(["concat","join","slice"],function(a){var b=k[a];m.prototype[a]=function(){return v(b.apply(this._wrapped,arguments),this._chain)}});m.prototype.chain=function(){this._chain= +true;return this};m.prototype.value=function(){return this._wrapped}}).call(this); diff --git a/website/docs/_static/up-pressed.png b/website/docs/_static/up-pressed.png new file mode 100644 index 0000000..acee3b6 Binary files /dev/null and b/website/docs/_static/up-pressed.png differ diff --git a/website/docs/_static/up.png b/website/docs/_static/up.png new file mode 100644 index 0000000..2a940a7 Binary files /dev/null and b/website/docs/_static/up.png differ diff --git a/website/docs/_static/websupport.js b/website/docs/_static/websupport.js new file mode 100644 index 0000000..98e7f40 --- /dev/null +++ b/website/docs/_static/websupport.js @@ -0,0 +1,808 @@ +/* + * websupport.js + * ~~~~~~~~~~~~~ + * + * sphinx.websupport utilities for all documentation. + * + * :copyright: Copyright 2007-2016 by the Sphinx team, see AUTHORS. + * :license: BSD, see LICENSE for details. + * + */ + +(function($) { + $.fn.autogrow = function() { + return this.each(function() { + var textarea = this; + + $.fn.autogrow.resize(textarea); + + $(textarea) + .focus(function() { + textarea.interval = setInterval(function() { + $.fn.autogrow.resize(textarea); + }, 500); + }) + .blur(function() { + clearInterval(textarea.interval); + }); + }); + }; + + $.fn.autogrow.resize = function(textarea) { + var lineHeight = parseInt($(textarea).css('line-height'), 10); + var lines = textarea.value.split('\n'); + var columns = textarea.cols; + var lineCount = 0; + $.each(lines, function() { + lineCount += Math.ceil(this.length / columns) || 1; + }); + var height = lineHeight * (lineCount + 1); + $(textarea).css('height', height); + }; +})(jQuery); + +(function($) { + var comp, by; + + function init() { + initEvents(); + initComparator(); + } + + function initEvents() { + $(document).on("click", 'a.comment-close', function(event) { + event.preventDefault(); + hide($(this).attr('id').substring(2)); + }); + $(document).on("click", 'a.vote', function(event) { + event.preventDefault(); + handleVote($(this)); + }); + $(document).on("click", 'a.reply', function(event) { + event.preventDefault(); + openReply($(this).attr('id').substring(2)); + }); + $(document).on("click", 'a.close-reply', function(event) { + event.preventDefault(); + closeReply($(this).attr('id').substring(2)); + }); + $(document).on("click", 'a.sort-option', function(event) { + event.preventDefault(); + handleReSort($(this)); + }); + $(document).on("click", 'a.show-proposal', function(event) { + event.preventDefault(); + showProposal($(this).attr('id').substring(2)); + }); + $(document).on("click", 'a.hide-proposal', function(event) { + event.preventDefault(); + hideProposal($(this).attr('id').substring(2)); + }); + $(document).on("click", 'a.show-propose-change', function(event) { + event.preventDefault(); + showProposeChange($(this).attr('id').substring(2)); + }); + $(document).on("click", 'a.hide-propose-change', function(event) { + event.preventDefault(); + hideProposeChange($(this).attr('id').substring(2)); + }); + $(document).on("click", 'a.accept-comment', function(event) { + event.preventDefault(); + acceptComment($(this).attr('id').substring(2)); + }); + $(document).on("click", 'a.delete-comment', function(event) { + event.preventDefault(); + deleteComment($(this).attr('id').substring(2)); + }); + $(document).on("click", 'a.comment-markup', function(event) { + event.preventDefault(); + toggleCommentMarkupBox($(this).attr('id').substring(2)); + }); + } + + /** + * Set comp, which is a comparator function used for sorting and + * inserting comments into the list. + */ + function setComparator() { + // If the first three letters are "asc", sort in ascending order + // and remove the prefix. + if (by.substring(0,3) == 'asc') { + var i = by.substring(3); + comp = function(a, b) { return a[i] - b[i]; }; + } else { + // Otherwise sort in descending order. + comp = function(a, b) { return b[by] - a[by]; }; + } + + // Reset link styles and format the selected sort option. + $('a.sel').attr('href', '#').removeClass('sel'); + $('a.by' + by).removeAttr('href').addClass('sel'); + } + + /** + * Create a comp function. If the user has preferences stored in + * the sortBy cookie, use those, otherwise use the default. + */ + function initComparator() { + by = 'rating'; // Default to sort by rating. + // If the sortBy cookie is set, use that instead. + if (document.cookie.length > 0) { + var start = document.cookie.indexOf('sortBy='); + if (start != -1) { + start = start + 7; + var end = document.cookie.indexOf(";", start); + if (end == -1) { + end = document.cookie.length; + by = unescape(document.cookie.substring(start, end)); + } + } + } + setComparator(); + } + + /** + * Show a comment div. + */ + function show(id) { + $('#ao' + id).hide(); + $('#ah' + id).show(); + var context = $.extend({id: id}, opts); + var popup = $(renderTemplate(popupTemplate, context)).hide(); + popup.find('textarea[name="proposal"]').hide(); + popup.find('a.by' + by).addClass('sel'); + var form = popup.find('#cf' + id); + form.submit(function(event) { + event.preventDefault(); + addComment(form); + }); + $('#s' + id).after(popup); + popup.slideDown('fast', function() { + getComments(id); + }); + } + + /** + * Hide a comment div. + */ + function hide(id) { + $('#ah' + id).hide(); + $('#ao' + id).show(); + var div = $('#sc' + id); + div.slideUp('fast', function() { + div.remove(); + }); + } + + /** + * Perform an ajax request to get comments for a node + * and insert the comments into the comments tree. + */ + function getComments(id) { + $.ajax({ + type: 'GET', + url: opts.getCommentsURL, + data: {node: id}, + success: function(data, textStatus, request) { + var ul = $('#cl' + id); + var speed = 100; + $('#cf' + id) + .find('textarea[name="proposal"]') + .data('source', data.source); + + if (data.comments.length === 0) { + ul.html('<li>No comments yet.</li>'); + ul.data('empty', true); + } else { + // If there are comments, sort them and put them in the list. + var comments = sortComments(data.comments); + speed = data.comments.length * 100; + appendComments(comments, ul); + ul.data('empty', false); + } + $('#cn' + id).slideUp(speed + 200); + ul.slideDown(speed); + }, + error: function(request, textStatus, error) { + showError('Oops, there was a problem retrieving the comments.'); + }, + dataType: 'json' + }); + } + + /** + * Add a comment via ajax and insert the comment into the comment tree. + */ + function addComment(form) { + var node_id = form.find('input[name="node"]').val(); + var parent_id = form.find('input[name="parent"]').val(); + var text = form.find('textarea[name="comment"]').val(); + var proposal = form.find('textarea[name="proposal"]').val(); + + if (text == '') { + showError('Please enter a comment.'); + return; + } + + // Disable the form that is being submitted. + form.find('textarea,input').attr('disabled', 'disabled'); + + // Send the comment to the server. + $.ajax({ + type: "POST", + url: opts.addCommentURL, + dataType: 'json', + data: { + node: node_id, + parent: parent_id, + text: text, + proposal: proposal + }, + success: function(data, textStatus, error) { + // Reset the form. + if (node_id) { + hideProposeChange(node_id); + } + form.find('textarea') + .val('') + .add(form.find('input')) + .removeAttr('disabled'); + var ul = $('#cl' + (node_id || parent_id)); + if (ul.data('empty')) { + $(ul).empty(); + ul.data('empty', false); + } + insertComment(data.comment); + var ao = $('#ao' + node_id); + ao.find('img').attr({'src': opts.commentBrightImage}); + if (node_id) { + // if this was a "root" comment, remove the commenting box + // (the user can get it back by reopening the comment popup) + $('#ca' + node_id).slideUp(); + } + }, + error: function(request, textStatus, error) { + form.find('textarea,input').removeAttr('disabled'); + showError('Oops, there was a problem adding the comment.'); + } + }); + } + + /** + * Recursively append comments to the main comment list and children + * lists, creating the comment tree. + */ + function appendComments(comments, ul) { + $.each(comments, function() { + var div = createCommentDiv(this); + ul.append($(document.createElement('li')).html(div)); + appendComments(this.children, div.find('ul.comment-children')); + // To avoid stagnating data, don't store the comments children in data. + this.children = null; + div.data('comment', this); + }); + } + + /** + * After adding a new comment, it must be inserted in the correct + * location in the comment tree. + */ + function insertComment(comment) { + var div = createCommentDiv(comment); + + // To avoid stagnating data, don't store the comments children in data. + comment.children = null; + div.data('comment', comment); + + var ul = $('#cl' + (comment.node || comment.parent)); + var siblings = getChildren(ul); + + var li = $(document.createElement('li')); + li.hide(); + + // Determine where in the parents children list to insert this comment. + for(i=0; i < siblings.length; i++) { + if (comp(comment, siblings[i]) <= 0) { + $('#cd' + siblings[i].id) + .parent() + .before(li.html(div)); + li.slideDown('fast'); + return; + } + } + + // If we get here, this comment rates lower than all the others, + // or it is the only comment in the list. + ul.append(li.html(div)); + li.slideDown('fast'); + } + + function acceptComment(id) { + $.ajax({ + type: 'POST', + url: opts.acceptCommentURL, + data: {id: id}, + success: function(data, textStatus, request) { + $('#cm' + id).fadeOut('fast'); + $('#cd' + id).removeClass('moderate'); + }, + error: function(request, textStatus, error) { + showError('Oops, there was a problem accepting the comment.'); + } + }); + } + + function deleteComment(id) { + $.ajax({ + type: 'POST', + url: opts.deleteCommentURL, + data: {id: id}, + success: function(data, textStatus, request) { + var div = $('#cd' + id); + if (data == 'delete') { + // Moderator mode: remove the comment and all children immediately + div.slideUp('fast', function() { + div.remove(); + }); + return; + } + // User mode: only mark the comment as deleted + div + .find('span.user-id:first') + .text('[deleted]').end() + .find('div.comment-text:first') + .text('[deleted]').end() + .find('#cm' + id + ', #dc' + id + ', #ac' + id + ', #rc' + id + + ', #sp' + id + ', #hp' + id + ', #cr' + id + ', #rl' + id) + .remove(); + var comment = div.data('comment'); + comment.username = '[deleted]'; + comment.text = '[deleted]'; + div.data('comment', comment); + }, + error: function(request, textStatus, error) { + showError('Oops, there was a problem deleting the comment.'); + } + }); + } + + function showProposal(id) { + $('#sp' + id).hide(); + $('#hp' + id).show(); + $('#pr' + id).slideDown('fast'); + } + + function hideProposal(id) { + $('#hp' + id).hide(); + $('#sp' + id).show(); + $('#pr' + id).slideUp('fast'); + } + + function showProposeChange(id) { + $('#pc' + id).hide(); + $('#hc' + id).show(); + var textarea = $('#pt' + id); + textarea.val(textarea.data('source')); + $.fn.autogrow.resize(textarea[0]); + textarea.slideDown('fast'); + } + + function hideProposeChange(id) { + $('#hc' + id).hide(); + $('#pc' + id).show(); + var textarea = $('#pt' + id); + textarea.val('').removeAttr('disabled'); + textarea.slideUp('fast'); + } + + function toggleCommentMarkupBox(id) { + $('#mb' + id).toggle(); + } + + /** Handle when the user clicks on a sort by link. */ + function handleReSort(link) { + var classes = link.attr('class').split(/\s+/); + for (var i=0; i<classes.length; i++) { + if (classes[i] != 'sort-option') { + by = classes[i].substring(2); + } + } + setComparator(); + // Save/update the sortBy cookie. + var expiration = new Date(); + expiration.setDate(expiration.getDate() + 365); + document.cookie= 'sortBy=' + escape(by) + + ';expires=' + expiration.toUTCString(); + $('ul.comment-ul').each(function(index, ul) { + var comments = getChildren($(ul), true); + comments = sortComments(comments); + appendComments(comments, $(ul).empty()); + }); + } + + /** + * Function to process a vote when a user clicks an arrow. + */ + function handleVote(link) { + if (!opts.voting) { + showError("You'll need to login to vote."); + return; + } + + var id = link.attr('id'); + if (!id) { + // Didn't click on one of the voting arrows. + return; + } + // If it is an unvote, the new vote value is 0, + // Otherwise it's 1 for an upvote, or -1 for a downvote. + var value = 0; + if (id.charAt(1) != 'u') { + value = id.charAt(0) == 'u' ? 1 : -1; + } + // The data to be sent to the server. + var d = { + comment_id: id.substring(2), + value: value + }; + + // Swap the vote and unvote links. + link.hide(); + $('#' + id.charAt(0) + (id.charAt(1) == 'u' ? 'v' : 'u') + d.comment_id) + .show(); + + // The div the comment is displayed in. + var div = $('div#cd' + d.comment_id); + var data = div.data('comment'); + + // If this is not an unvote, and the other vote arrow has + // already been pressed, unpress it. + if ((d.value !== 0) && (data.vote === d.value * -1)) { + $('#' + (d.value == 1 ? 'd' : 'u') + 'u' + d.comment_id).hide(); + $('#' + (d.value == 1 ? 'd' : 'u') + 'v' + d.comment_id).show(); + } + + // Update the comments rating in the local data. + data.rating += (data.vote === 0) ? d.value : (d.value - data.vote); + data.vote = d.value; + div.data('comment', data); + + // Change the rating text. + div.find('.rating:first') + .text(data.rating + ' point' + (data.rating == 1 ? '' : 's')); + + // Send the vote information to the server. + $.ajax({ + type: "POST", + url: opts.processVoteURL, + data: d, + error: function(request, textStatus, error) { + showError('Oops, there was a problem casting that vote.'); + } + }); + } + + /** + * Open a reply form used to reply to an existing comment. + */ + function openReply(id) { + // Swap out the reply link for the hide link + $('#rl' + id).hide(); + $('#cr' + id).show(); + + // Add the reply li to the children ul. + var div = $(renderTemplate(replyTemplate, {id: id})).hide(); + $('#cl' + id) + .prepend(div) + // Setup the submit handler for the reply form. + .find('#rf' + id) + .submit(function(event) { + event.preventDefault(); + addComment($('#rf' + id)); + closeReply(id); + }) + .find('input[type=button]') + .click(function() { + closeReply(id); + }); + div.slideDown('fast', function() { + $('#rf' + id).find('textarea').focus(); + }); + } + + /** + * Close the reply form opened with openReply. + */ + function closeReply(id) { + // Remove the reply div from the DOM. + $('#rd' + id).slideUp('fast', function() { + $(this).remove(); + }); + + // Swap out the hide link for the reply link + $('#cr' + id).hide(); + $('#rl' + id).show(); + } + + /** + * Recursively sort a tree of comments using the comp comparator. + */ + function sortComments(comments) { + comments.sort(comp); + $.each(comments, function() { + this.children = sortComments(this.children); + }); + return comments; + } + + /** + * Get the children comments from a ul. If recursive is true, + * recursively include childrens' children. + */ + function getChildren(ul, recursive) { + var children = []; + ul.children().children("[id^='cd']") + .each(function() { + var comment = $(this).data('comment'); + if (recursive) + comment.children = getChildren($(this).find('#cl' + comment.id), true); + children.push(comment); + }); + return children; + } + + /** Create a div to display a comment in. */ + function createCommentDiv(comment) { + if (!comment.displayed && !opts.moderator) { + return $('<div class="moderate">Thank you! Your comment will show up ' + + 'once it is has been approved by a moderator.</div>'); + } + // Prettify the comment rating. + comment.pretty_rating = comment.rating + ' point' + + (comment.rating == 1 ? '' : 's'); + // Make a class (for displaying not yet moderated comments differently) + comment.css_class = comment.displayed ? '' : ' moderate'; + // Create a div for this comment. + var context = $.extend({}, opts, comment); + var div = $(renderTemplate(commentTemplate, context)); + + // If the user has voted on this comment, highlight the correct arrow. + if (comment.vote) { + var direction = (comment.vote == 1) ? 'u' : 'd'; + div.find('#' + direction + 'v' + comment.id).hide(); + div.find('#' + direction + 'u' + comment.id).show(); + } + + if (opts.moderator || comment.text != '[deleted]') { + div.find('a.reply').show(); + if (comment.proposal_diff) + div.find('#sp' + comment.id).show(); + if (opts.moderator && !comment.displayed) + div.find('#cm' + comment.id).show(); + if (opts.moderator || (opts.username == comment.username)) + div.find('#dc' + comment.id).show(); + } + return div; + } + + /** + * A simple template renderer. Placeholders such as <%id%> are replaced + * by context['id'] with items being escaped. Placeholders such as <#id#> + * are not escaped. + */ + function renderTemplate(template, context) { + var esc = $(document.createElement('div')); + + function handle(ph, escape) { + var cur = context; + $.each(ph.split('.'), function() { + cur = cur[this]; + }); + return escape ? esc.text(cur || "").html() : cur; + } + + return template.replace(/<([%#])([\w\.]*)\1>/g, function() { + return handle(arguments[2], arguments[1] == '%' ? true : false); + }); + } + + /** Flash an error message briefly. */ + function showError(message) { + $(document.createElement('div')).attr({'class': 'popup-error'}) + .append($(document.createElement('div')) + .attr({'class': 'error-message'}).text(message)) + .appendTo('body') + .fadeIn("slow") + .delay(2000) + .fadeOut("slow"); + } + + /** Add a link the user uses to open the comments popup. */ + $.fn.comment = function() { + return this.each(function() { + var id = $(this).attr('id').substring(1); + var count = COMMENT_METADATA[id]; + var title = count + ' comment' + (count == 1 ? '' : 's'); + var image = count > 0 ? opts.commentBrightImage : opts.commentImage; + var addcls = count == 0 ? ' nocomment' : ''; + $(this) + .append( + $(document.createElement('a')).attr({ + href: '#', + 'class': 'sphinx-comment-open' + addcls, + id: 'ao' + id + }) + .append($(document.createElement('img')).attr({ + src: image, + alt: 'comment', + title: title + })) + .click(function(event) { + event.preventDefault(); + show($(this).attr('id').substring(2)); + }) + ) + .append( + $(document.createElement('a')).attr({ + href: '#', + 'class': 'sphinx-comment-close hidden', + id: 'ah' + id + }) + .append($(document.createElement('img')).attr({ + src: opts.closeCommentImage, + alt: 'close', + title: 'close' + })) + .click(function(event) { + event.preventDefault(); + hide($(this).attr('id').substring(2)); + }) + ); + }); + }; + + var opts = { + processVoteURL: '/_process_vote', + addCommentURL: '/_add_comment', + getCommentsURL: '/_get_comments', + acceptCommentURL: '/_accept_comment', + deleteCommentURL: '/_delete_comment', + commentImage: '/static/_static/comment.png', + closeCommentImage: '/static/_static/comment-close.png', + loadingImage: '/static/_static/ajax-loader.gif', + commentBrightImage: '/static/_static/comment-bright.png', + upArrow: '/static/_static/up.png', + downArrow: '/static/_static/down.png', + upArrowPressed: '/static/_static/up-pressed.png', + downArrowPressed: '/static/_static/down-pressed.png', + voting: false, + moderator: false + }; + + if (typeof COMMENT_OPTIONS != "undefined") { + opts = jQuery.extend(opts, COMMENT_OPTIONS); + } + + var popupTemplate = '\ + <div class="sphinx-comments" id="sc<%id%>">\ + <p class="sort-options">\ + Sort by:\ + <a href="#" class="sort-option byrating">best rated</a>\ + <a href="#" class="sort-option byascage">newest</a>\ + <a href="#" class="sort-option byage">oldest</a>\ + </p>\ + <div class="comment-header">Comments</div>\ + <div class="comment-loading" id="cn<%id%>">\ + loading comments... <img src="<%loadingImage%>" alt="" /></div>\ + <ul id="cl<%id%>" class="comment-ul"></ul>\ + <div id="ca<%id%>">\ + <p class="add-a-comment">Add a comment\ + (<a href="#" class="comment-markup" id="ab<%id%>">markup</a>):</p>\ + <div class="comment-markup-box" id="mb<%id%>">\ + reStructured text markup: <i>*emph*</i>, <b>**strong**</b>, \ + <code>``code``</code>, \ + code blocks: <code>::</code> and an indented block after blank line</div>\ + <form method="post" id="cf<%id%>" class="comment-form" action="">\ + <textarea name="comment" cols="80"></textarea>\ + <p class="propose-button">\ + <a href="#" id="pc<%id%>" class="show-propose-change">\ + Propose a change ▹\ + </a>\ + <a href="#" id="hc<%id%>" class="hide-propose-change">\ + Propose a change ▿\ + </a>\ + </p>\ + <textarea name="proposal" id="pt<%id%>" cols="80"\ + spellcheck="false"></textarea>\ + <input type="submit" value="Add comment" />\ + <input type="hidden" name="node" value="<%id%>" />\ + <input type="hidden" name="parent" value="" />\ + </form>\ + </div>\ + </div>'; + + var commentTemplate = '\ + <div id="cd<%id%>" class="sphinx-comment<%css_class%>">\ + <div class="vote">\ + <div class="arrow">\ + <a href="#" id="uv<%id%>" class="vote" title="vote up">\ + <img src="<%upArrow%>" />\ + </a>\ + <a href="#" id="uu<%id%>" class="un vote" title="vote up">\ + <img src="<%upArrowPressed%>" />\ + </a>\ + </div>\ + <div class="arrow">\ + <a href="#" id="dv<%id%>" class="vote" title="vote down">\ + <img src="<%downArrow%>" id="da<%id%>" />\ + </a>\ + <a href="#" id="du<%id%>" class="un vote" title="vote down">\ + <img src="<%downArrowPressed%>" />\ + </a>\ + </div>\ + </div>\ + <div class="comment-content">\ + <p class="tagline comment">\ + <span class="user-id"><%username%></span>\ + <span class="rating"><%pretty_rating%></span>\ + <span class="delta"><%time.delta%></span>\ + </p>\ + <div class="comment-text comment"><#text#></div>\ + <p class="comment-opts comment">\ + <a href="#" class="reply hidden" id="rl<%id%>">reply ▹</a>\ + <a href="#" class="close-reply" id="cr<%id%>">reply ▿</a>\ + <a href="#" id="sp<%id%>" class="show-proposal">proposal ▹</a>\ + <a href="#" id="hp<%id%>" class="hide-proposal">proposal ▿</a>\ + <a href="#" id="dc<%id%>" class="delete-comment hidden">delete</a>\ + <span id="cm<%id%>" class="moderation hidden">\ + <a href="#" id="ac<%id%>" class="accept-comment">accept</a>\ + </span>\ + </p>\ + <pre class="proposal" id="pr<%id%>">\ +<#proposal_diff#>\ + </pre>\ + <ul class="comment-children" id="cl<%id%>"></ul>\ + </div>\ + <div class="clearleft"></div>\ + </div>\ + </div>'; + + var replyTemplate = '\ + <li>\ + <div class="reply-div" id="rd<%id%>">\ + <form id="rf<%id%>">\ + <textarea name="comment" cols="80"></textarea>\ + <input type="submit" value="Add reply" />\ + <input type="button" value="Cancel" />\ + <input type="hidden" name="parent" value="<%id%>" />\ + <input type="hidden" name="node" value="" />\ + </form>\ + </div>\ + </li>'; + + $(document).ready(function() { + init(); + }); +})(jQuery); + +$(document).ready(function() { + // add comment anchors for all paragraphs that are commentable + $('.sphinx-has-comment').comment(); + + // highlight search words in search results + $("div.context").each(function() { + var params = $.getQueryParameters(); + var terms = (params.q) ? params.q[0].split(/\s+/) : []; + var result = $(this); + $.each(terms, function() { + result.highlightText(this.toLowerCase(), 'highlighted'); + }); + }); + + // directly open comment window if requested + var anchor = document.location.hash; + if (anchor.substring(0, 9) == '#comment-') { + $('#ao' + anchor.substring(9)).click(); + document.location.hash = '#s' + anchor.substring(9); + } +}); diff --git a/website/docs/advanced.html b/website/docs/advanced.html new file mode 100644 index 0000000..3cdb12a --- /dev/null +++ b/website/docs/advanced.html @@ -0,0 +1,629 @@ + + +<!DOCTYPE html> +<!--[if IE 8]><html class="no-js lt-ie9" lang="en" > <![endif]--> +<!--[if gt IE 8]><!--> <html class="no-js" lang="en" > <!--<![endif]--> +<head> + <meta charset="utf-8"> + + <meta name="viewport" content="width=device-width, initial-scale=1.0"> + + <title>Advanced Usage — JABAWS 2.2 documentation</title> + + + + + + + + + + + + + + + + + + <link rel="stylesheet" href="_static/css/theme.css" type="text/css" /> + + + + + + <link rel="index" title="Index" + href="genindex.html"/> + <link rel="search" title="Search" href="search.html"/> + <link rel="top" title="JABAWS 2.2 documentation" href="index.html"/> + <link rel="next" title="For Developers" href="develop.html"/> + <link rel="prev" title="Virtual Appliance (VA)" href="va.html"/> + + + <script src="_static/js/modernizr.min.js"></script> + +</head> + +<body class="wy-body-for-nav" role="document"> + + + <div class="wy-grid-for-nav"> + + + <nav data-toggle="wy-nav-shift" class="wy-nav-side"> + <div class="wy-side-scroll"> + <div class="wy-side-nav-search"> + + + + <a href="index.html" class="icon icon-home"> JABAWS + + + + </a> + + + + + <div class="version"> + 2.2 + </div> + + + + +<div role="search"> + <form id="rtd-search-form" class="wy-form" action="search.html" method="get"> + <input type="text" name="q" placeholder="Search docs" /> + <input type="hidden" name="check_keywords" value="yes" /> + <input type="hidden" name="area" value="default" /> + </form> +</div> + + + </div> + + <div class="wy-menu wy-menu-vertical" data-spy="affix" role="navigation" aria-label="main navigation"> + + + + + + + <p class="caption"><span class="caption-text">Contents:</span></p> +<ul class="current"> +<li class="toctree-l1"><a class="reference internal" href="getting_started.html">Getting Started</a></li> +<li class="toctree-l1"><a class="reference internal" href="included_tools.html">Included Tools</a></li> +<li class="toctree-l1"><a class="reference internal" href="client.html">Command Line Client (CLI)</a></li> +<li class="toctree-l1"><a class="reference internal" href="war.html">Web Application Archive (WAR)</a></li> +<li class="toctree-l1"><a class="reference internal" href="va.html">Virtual Appliance (VA)</a></li> +<li class="toctree-l1 current"><a class="current reference internal" href="#">Advanced Usage</a><ul> +<li class="toctree-l2"><a class="reference internal" href="#valid-wsdl">Valid WSDL</a></li> +<li class="toctree-l2"><a class="reference internal" href="#jabaws-configuration">JABAWS Configuration</a><ul> +<li class="toctree-l3"><a class="reference internal" href="#local-engine-configuration">Local Engine Configuration</a></li> +<li class="toctree-l3"><a class="reference internal" href="#cluster-engine-configuration">Cluster Engine Configuration</a></li> +<li class="toctree-l3"><a class="reference internal" href="#executable-configuration">Executable Configuration</a></li> +<li class="toctree-l3"><a class="reference internal" href="#defining-environment-variables-for-executables">Defining Environment Variables for Executables</a></li> +<li class="toctree-l3"><a class="reference internal" href="#configure-jabaws-to-work-with-mafft">Configure JABAWS to Work with Mafft</a></li> +<li class="toctree-l3"><a class="reference internal" href="#limiting-the-size-of-the-job-accepted-by-jabaws">Limiting the size of the job accepted by JABAWS</a></li> +<li class="toctree-l3"><a class="reference internal" href="#pre-compiled-binaries">Pre-compiled binaries</a></li> +<li class="toctree-l3"><a class="reference internal" href="#recompiling-binaries-for-your-system">Recompiling binaries for your system</a></li> +<li class="toctree-l3"><a class="reference internal" href="#obtaining-or-reusing-binaries">Obtaining or reusing binaries</a></li> +</ul> +</li> +<li class="toctree-l2"><a class="reference internal" href="#load-balancing">Load balancing</a></li> +<li class="toctree-l2"><a class="reference internal" href="#testing-the-jabaws-server">Testing the JABAWS Server</a></li> +<li class="toctree-l2"><a class="reference internal" href="#jabaws-internal-logging">JABAWS internal logging</a><ul> +<li class="toctree-l3"><a class="reference internal" href="#jabaws-requests-logging">JABAWS requests logging</a></li> +</ul> +</li> +<li class="toctree-l2"><a class="reference internal" href="#jabaws-and-google-analytics">JABAWS and Google Analytics</a></li> +<li class="toctree-l2"><a class="reference internal" href="#jabaws-war-file-content">JABAWS War File Content</a></li> +</ul> +</li> +<li class="toctree-l1"><a class="reference internal" href="develop.html">For Developers</a></li> +<li class="toctree-l1"><a class="reference internal" href="stats.html">Usage Statistics</a></li> +<li class="toctree-l1"><a class="reference internal" href="citations.html">Citations</a></li> +<li class="toctree-l1"><a class="reference internal" href="changelog.html">Changelog</a></li> +</ul> + + + + </div> + </div> + </nav> + + <section data-toggle="wy-nav-shift" class="wy-nav-content-wrap"> + + + <nav class="wy-nav-top" role="navigation" aria-label="top navigation"> + + <i data-toggle="wy-nav-top" class="fa fa-bars"></i> + <a href="index.html">JABAWS</a> + + </nav> + + + + <div class="wy-nav-content"> + <div class="rst-content"> + + + + + + + + + + + + + + + + +<div role="navigation" aria-label="breadcrumbs navigation"> + + <ul class="wy-breadcrumbs"> + + <li><a href="index.html">Docs</a> »</li> + + <li>Advanced Usage</li> + + + <li class="wy-breadcrumbs-aside"> + + + <a href="_sources/advanced.rst.txt" rel="nofollow"> View page source</a> + + + </li> + + </ul> + + + <hr/> +</div> + <div role="main" class="document" itemscope="itemscope" itemtype="http://schema.org/Article"> + <div itemprop="articleBody"> + + <div class="section" id="advanced-usage"> +<h1>Advanced Usage<a class="headerlink" href="#advanced-usage" title="Permalink to this headline">¶</a></h1> +<p>JABAWS web services are WS-I basic profile compliant, which means they can be accessed using any programming language or system that can utilize standard SOAP web services. The Web Service Definition Language (WSDL) for each service is published on the JABAWS home page, and you can use this to automatically generate service bindings for your program. If you use Java you may wish to use our client package to access JABAWS. This package is based on the autogenerated source code produced by wsimport, which is the Java tool for creating web service bindings. In addition, this offers some additional methods that simplify working with JABAWS. For more information please refer to the data model javadoc.</p> +<hr class="docutils" /> +<div class="section" id="valid-wsdl"> +<span id="jabaws-wsdl"></span><h2>Valid WSDL<a class="headerlink" href="#valid-wsdl" title="Permalink to this headline">¶</a></h2> +<p><strong>Multiple sequence alignment services</strong></p> +<ul class="simple"> +<li>ClustalOWS - <a class="reference external" href="http://www.compbio.dundee.ac.uk/jabaws/ClustalOWS?wsdl">http://www.compbio.dundee.ac.uk/jabaws/ClustalOWS?wsdl</a></li> +<li>ClustalWS - <a class="reference external" href="http://www.compbio.dundee.ac.uk/jabaws/ClustalWS?wsdl">http://www.compbio.dundee.ac.uk/jabaws/ClustalWS?wsdl</a></li> +<li>MuscleWS - <a class="reference external" href="http://www.compbio.dundee.ac.uk/jabaws/MuscleWS?wsdl">http://www.compbio.dundee.ac.uk/jabaws/MuscleWS?wsdl</a></li> +<li>MafftWS - <a class="reference external" href="http://www.compbio.dundee.ac.uk/jabaws/MafftWS?wsdl">http://www.compbio.dundee.ac.uk/jabaws/MafftWS?wsdl</a></li> +<li>TcoffeeWS - <a class="reference external" href="http://www.compbio.dundee.ac.uk/jabaws/TcoffeeWS?wsdl">http://www.compbio.dundee.ac.uk/jabaws/TcoffeeWS?wsdl</a></li> +<li>ProbconsWS - <a class="reference external" href="http://www.compbio.dundee.ac.uk/jabaws/ProbconsWS?wsdl">http://www.compbio.dundee.ac.uk/jabaws/ProbconsWS?wsdl</a></li> +<li>MSAprobsWS - <a class="reference external" href="http://www.compbio.dundee.ac.uk/jabaws/MSAprobsWS?wsdl">http://www.compbio.dundee.ac.uk/jabaws/MSAprobsWS?wsdl</a></li> +<li>GLprobsWS - <a class="reference external" href="http://www.compbio.dundee.ac.uk/jabaws/GLprobsWS?wsdl">http://www.compbio.dundee.ac.uk/jabaws/GLprobsWS?wsdl</a></li> +</ul> +<p><strong>Protein disorder prediction services</strong></p> +<ul class="simple"> +<li>IUPredWS - <a class="reference external" href="http://www.compbio.dundee.ac.uk/jabaws/IUPredWS?wsdl">http://www.compbio.dundee.ac.uk/jabaws/IUPredWS?wsdl</a></li> +<li>GlobPlotWS - <a class="reference external" href="http://www.compbio.dundee.ac.uk/jabaws/GlobPlotWS?wsdl">http://www.compbio.dundee.ac.uk/jabaws/GlobPlotWS?wsdl</a></li> +<li>DisemblWS - <a class="reference external" href="http://www.compbio.dundee.ac.uk/jabaws/DisemblWS?wsdl">http://www.compbio.dundee.ac.uk/jabaws/DisemblWS?wsdl</a></li> +<li>JronnWS - <a class="reference external" href="http://www.compbio.dundee.ac.uk/jabaws/JronnWS?wsdl">http://www.compbio.dundee.ac.uk/jabaws/JronnWS?wsdl</a></li> +</ul> +<p><strong>Amino acid conservation service</strong></p> +<ul class="simple"> +<li>AAConWS - <a class="reference external" href="http://www.compbio.dundee.ac.uk/jabaws/AAConWS?wsdl">http://www.compbio.dundee.ac.uk/jabaws/AAConWS?wsdl</a></li> +</ul> +<p><strong>RNA Secondary Structure Prediction</strong></p> +<ul class="simple"> +<li>RNAalifoldWS - <a class="reference external" href="http://www.compbio.dundee.ac.uk/jabaws/RNAalifoldWS?wsdl">http://www.compbio.dundee.ac.uk/jabaws/RNAalifoldWS?wsdl</a></li> +</ul> +<p>Please replace <a class="reference external" href="http://www.compbio.dundee.ac.uk/">http://www.compbio.dundee.ac.uk/</a> with your JABAWS instance host name, and jabaws with your JABAWS context name to access your local version of JABAWS web services. For example <a class="reference external" href="http://localhost:8080/jabaws">http://localhost:8080/jabaws</a> would be a valid URL for the default Apache-Tomcat installation and jabaws.war file deployment.</p> +<hr class="docutils" /> +</div> +<div class="section" id="jabaws-configuration"> +<span id="jabaws-config"></span><h2>JABAWS Configuration<a class="headerlink" href="#jabaws-configuration" title="Permalink to this headline">¶</a></h2> +<p>There are three parts of the system you can configure. The local and the cluster engines, and the paths to the individual executables for each engine. These settings are stored in configuration files within the web application directory (for an overview, then take a look at the <a class="reference external" href="advanced.html#jabaws_war_file_content">war file content table</a>).</p> +<p>Initially, JABAWS is configured with only the local engine enabled, with job output written to directory called “jobsout” within the web application itself. This means that JABAWS will work out of the box, but may not be suitable for serving a whole lab or a university.</p> +<hr class="docutils" /> +<div class="section" id="local-engine-configuration"> +<span id="jabaws-config-le"></span><h3>Local Engine Configuration<a class="headerlink" href="#local-engine-configuration" title="Permalink to this headline">¶</a></h3> +<p>The Local execution engine configuration is defined in the properties file <code class="docutils literal"><span class="pre">conf/Engine.local.properties</span></code>. The supported configuration settings are:</p> +<p><code class="docutils literal"><span class="pre">engine.local.enable=true</span></code> - enable or disable local engine, valid values true | false</p> +<p><code class="docutils literal"><span class="pre">local.tmp.directory=D:\\clusterengine\\testoutput</span></code> - a directory to use for temporary files storage, optional, defaults to java temporary directory</p> +<p><code class="docutils literal"><span class="pre">engine.local.thread.number=4</span></code> - Number of threads for tasks execution (valid values between 1 and 2x cpu. Where x is a number of cores available in the system). Optional defaults to the number of cores for core number <=4 and number of cores-1 for greater core numbers.</p> +<p>If the local engine going to be heavily loaded (which is often the case if you do not have a cluster) it is a good idea to increase the amount of memory available for the web application server. If you are using Apache-Tomcat, then you can define its memory settings in the JAVA_OPTS environment variable. To specify which JVM to use for Apache-Tomcat, put the full path to the JRE installation in the JAVA_HOME environment variable. (We would recommend using Sun Java Virtual Machine (JVM) in preference to Open JDK). Below is an example of code which can be added to <code class="docutils literal"><span class="pre"><tomcat_dir>/bin/setenv.sh</span></code> script to define which JVM to use and a memory settings for Tomcat server. Tomcat server startup script (<code class="docutils literal"><span class="pre">catalina.sh</span></code>) will execute <code class="docutils literal"><span class="pre">setenv.sh</span></code> on each server start automatically.</p> +<div class="code bash highlight-default"><div class="highlight"><pre><span></span><span class="n">export</span> <span class="n">JAVA_HOME</span><span class="o">=/</span><span class="n">homes</span><span class="o">/</span><span class="n">ws</span><span class="o">-</span><span class="n">dev2</span><span class="o">/</span><span class="n">jdk1</span><span class="o">.</span><span class="mf">6.0</span><span class="n">_17</span><span class="o">/</span> +<span class="n">export</span> <span class="n">JAVA_OPTS</span><span class="o">=</span><span class="s2">"-server -Xincgc -Xms512m -Xmx1024m"</span> +</pre></div> +</div> +<hr class="docutils" /> +</div> +<div class="section" id="cluster-engine-configuration"> +<span id="jabaws-config-ce"></span><h3>Cluster Engine Configuration<a class="headerlink" href="#cluster-engine-configuration" title="Permalink to this headline">¶</a></h3> +<p>Supported configuration settings:</p> +<p><code class="docutils literal"><span class="pre">engine.cluster.enable=true</span></code> - enable or disable local engine true | false, defaults to false</p> +<p><code class="docutils literal"><span class="pre">cluster.tmp.directory=/homes/clustengine/testoutput</span></code> - a directory to use for temporary files storage. The value must be an absolute path to the temporary directory. This is required. The value must be different from what is defined for local engine. This directory must be accessible from all cluster nodes.</p> +<p>For the cluster engine to work, the SGE_ROOT and LD_LIBRARY_PATH environment variables have to be defined. They tell the cluster engine where to find DRMAA libraries. These variables should be defined when the web application server starts up, e.g.</p> +<div class="code bash highlight-default"><div class="highlight"><pre><span></span><span class="n">SGE_ROOT</span><span class="o">=/</span><span class="n">gridware</span><span class="o">/</span><span class="n">sge</span> +<span class="n">LD_LIBRARY_PATH</span><span class="o">=/</span><span class="n">gridware</span><span class="o">/</span><span class="n">sge</span><span class="o">/</span><span class="n">lib</span><span class="o">/</span><span class="n">lx24</span><span class="o">-</span><span class="n">amd64</span> +</pre></div> +</div> +<p>Finally, do not forget to configure executables for the cluster execution, they may be the same as for the local execution but may be different. Please refer to the executable configuration section for further details.</p> +<hr class="docutils" /> +</div> +<div class="section" id="executable-configuration"> +<span id="jabaws-config-ec"></span><h3>Executable Configuration<a class="headerlink" href="#executable-configuration" title="Permalink to this headline">¶</a></h3> +<p>All the executable programs are configured in conf/Executable.properties file. Each executable is configured with a number of options. They are:</p> +<div class="code bash highlight-default"><div class="highlight"><pre><span></span><span class="n">local</span><span class="o">.</span><span class="n">X</span><span class="o">.</span><span class="n">bin</span><span class="o">.</span><span class="n">windows</span><span class="o">=<</span><span class="n">path</span> <span class="n">to</span> <span class="n">executable</span> <span class="n">under</span> <span class="n">windows</span> <span class="n">system</span><span class="p">,</span> <span class="n">optional</span><span class="o">></span> +<span class="n">local</span><span class="o">.</span><span class="n">X</span><span class="o">.</span><span class="n">bin</span><span class="o">=<</span><span class="n">path</span> <span class="n">to</span> <span class="n">the</span> <span class="n">executable</span> <span class="n">under</span> <span class="n">non</span><span class="o">-</span><span class="n">windows</span> <span class="n">system</span><span class="p">,</span> <span class="n">optional</span><span class="o">></span> +<span class="n">cluster</span><span class="o">.</span><span class="n">X</span><span class="o">.</span><span class="n">bin</span><span class="o">=<</span><span class="n">path</span> <span class="n">to</span> <span class="n">the</span> <span class="n">executable</span> <span class="n">on</span> <span class="n">the</span> <span class="n">cluster</span><span class="p">,</span> <span class="nb">all</span> <span class="n">cluster</span> <span class="n">nodes</span> <span class="n">must</span> <span class="n">see</span> <span class="n">it</span><span class="p">,</span> <span class="n">optional</span><span class="o">></span> +<span class="n">X</span><span class="o">.</span><span class="n">bin</span><span class="o">.</span><span class="n">env</span><span class="o">=<</span><span class="n">semicolon</span> <span class="n">separated</span> <span class="nb">list</span> <span class="n">of</span> <span class="n">environment</span> <span class="n">variables</span> <span class="k">for</span> <span class="n">executable</span><span class="p">,</span> <span class="n">use</span> <span class="nb">hash</span> <span class="n">symbol</span> <span class="k">as</span> <span class="n">name</span> <span class="n">value</span> <span class="n">separator</span><span class="p">,</span> <span class="n">optional</span><span class="o">></span> +<span class="n">X</span><span class="o">.--</span><span class="n">aamatrix</span><span class="o">.</span><span class="n">path</span><span class="o">=<</span><span class="n">path</span> <span class="n">to</span> <span class="n">the</span> <span class="n">directory</span> <span class="n">containing</span> <span class="n">substitution</span> <span class="n">matrices</span><span class="p">,</span> <span class="n">optional</span><span class="o">></span> +<span class="n">X</span><span class="o">.</span><span class="n">presets</span><span class="o">.</span><span class="n">file</span><span class="o">=<</span><span class="n">path</span> <span class="n">to</span> <span class="n">the</span> <span class="n">preset</span> <span class="n">configuration</span> <span class="n">file</span><span class="p">,</span> <span class="n">optional</span><span class="o">></span> +<span class="n">X</span><span class="o">.</span><span class="n">parameters</span><span class="o">.</span><span class="n">file</span><span class="o">=<</span><span class="n">path</span> <span class="n">to</span> <span class="n">the</span> <span class="n">parameters</span> <span class="n">configuration</span> <span class="n">file</span><span class="p">,</span> <span class="n">optional</span><span class="o">></span> +<span class="n">X</span><span class="o">.</span><span class="n">limits</span><span class="o">.</span><span class="n">file</span><span class="o">=<</span><span class="n">path</span> <span class="n">to</span> <span class="n">the</span> <span class="n">limits</span> <span class="n">configuration</span> <span class="n">file</span><span class="p">,</span> <span class="n">optional</span><span class="o">></span> +<span class="n">X</span><span class="o">.</span><span class="n">cluster</span><span class="o">.</span><span class="n">settings</span><span class="o">=<</span><span class="nb">list</span> <span class="n">of</span> <span class="n">the</span> <span class="n">cluster</span> <span class="n">specific</span> <span class="n">options</span><span class="p">,</span> <span class="n">optional</span><span class="o">></span> +</pre></div> +</div> +<p>Where X any of the bioinformatics tools available (e.g. clustalw, muscle, mafft, probcons, t-coffee, etc.).</p> +<p>Default JABAWS configuration includes path to local executables to be run by the local engine only, all cluster related settings are commented out, but they are there for you as examples. Cluster engine is disabled by default. To configure executable for cluster execution uncomment the X.cluster settings and change them appropriately.</p> +<p>By default limits are set well in excess of what you may want to offer to the users outside your lab, to make sure that the tasks are never rejected. The default limit is 100000 sequences of 100000 letters on average for all of the JABA web services. You can adjust the limits according to your needs by editing <code class="docutils literal"><span class="pre">conf/settings/<X>Limit.xml</span></code> files. +After you have completed the editing your configuration may look like this:</p> +<div class="code bash highlight-default"><div class="highlight"><pre><span></span><span class="n">local</span><span class="o">.</span><span class="n">mafft</span><span class="o">.</span><span class="n">bin</span><span class="o">=</span><span class="n">binaries</span><span class="o">/</span><span class="n">mafft</span> +<span class="n">cluster</span><span class="o">.</span><span class="n">mafft</span><span class="o">.</span><span class="n">bin</span><span class="o">=/</span><span class="n">homes</span><span class="o">/</span><span class="n">cengine</span><span class="o">/</span><span class="n">mafft</span> +<span class="n">mafft</span><span class="o">.</span><span class="n">bin</span><span class="o">.</span><span class="n">env</span><span class="o">=</span><span class="n">MAFFT_BINARIES</span><span class="c1">#/homes/cengine/mafft;FASTA_4_MAFFT#/bin/fasta34;</span> +<span class="n">mafft</span><span class="o">.--</span><span class="n">aamatrix</span><span class="o">.</span><span class="n">path</span><span class="o">=</span><span class="n">binaries</span><span class="o">/</span><span class="n">matrices</span> +<span class="n">mafft</span><span class="o">.</span><span class="n">presets</span><span class="o">.</span><span class="n">file</span><span class="o">=</span><span class="n">conf</span><span class="o">/</span><span class="n">settings</span><span class="o">/</span><span class="n">MafftPresets</span><span class="o">.</span><span class="n">xml</span> +<span class="n">mafft</span><span class="o">.</span><span class="n">parameters</span><span class="o">.</span><span class="n">file</span><span class="o">=</span><span class="n">conf</span><span class="o">/</span><span class="n">settings</span><span class="o">/</span><span class="n">MafftParameters</span><span class="o">.</span><span class="n">xml</span> +<span class="n">mafft</span><span class="o">.</span><span class="n">limits</span><span class="o">.</span><span class="n">file</span><span class="o">=</span><span class="n">conf</span><span class="o">/</span><span class="n">settings</span><span class="o">/</span><span class="n">MafftLimits</span><span class="o">.</span><span class="n">xml</span> +<span class="n">mafft</span><span class="o">.</span><span class="n">cluster</span><span class="o">.</span><span class="n">settings</span><span class="o">=-</span><span class="n">q</span> <span class="n">bigmem</span><span class="o">.</span><span class="n">q</span> <span class="o">-</span><span class="n">l</span> <span class="n">h_cpu</span><span class="o">=</span><span class="mi">24</span><span class="p">:</span><span class="mi">00</span><span class="p">:</span><span class="mi">00</span> <span class="o">-</span><span class="n">l</span> <span class="n">h_vmem</span><span class="o">=</span><span class="mi">6000</span><span class="n">M</span> <span class="o">-</span><span class="n">l</span> <span class="n">ram</span><span class="o">=</span><span class="mi">6000</span><span class="n">M</span> +</pre></div> +</div> +<p>Please not that relative paths must only be specified for the files that reside inside web application directory, all other paths must be supplied as absolute!</p> +<p>Furthermore, you should avoid using environment variables within the paths or options - since these will not be evaluated correctly. Instead, please explicitly specify the absolute path to anything normally evaluated from an environment variable at execution time.</p> +<p>If you are using JABAWS to submit jobs to the cluster (with cluster engine enabled), executables must be available from all cluster nodes the task can be sent to, also paths to the executables on the cluster e.g. <code class="docutils literal"><span class="pre">cluster.<exec_name>.bin</span></code> must be absolute.</p> +<p>Executables can be located anywhere in your system, they do not have to reside on the server as long as the web application server can access and execute them.</p> +<p>Cluster settings are treated as a black box, the system will just pass whatever is specified in this line directly to the cluster submission library. This is how DRMAA itself treats this settings. More exactly DRMAA <code class="docutils literal"><span class="pre">JobTemplate.setNativeSpecification()</span></code> function will be called.</p> +<p>For further details and examples of configuration please refer to the <code class="docutils literal"><span class="pre">Executable.properties</span></code> file supplied with JABAWS.</p> +<hr class="docutils" /> +</div> +<div class="section" id="defining-environment-variables-for-executables"> +<span id="jabaws-config-env-exe"></span><h3>Defining Environment Variables for Executables<a class="headerlink" href="#defining-environment-variables-for-executables" title="Permalink to this headline">¶</a></h3> +<p>Environment variables can be defined in property</p> +<div class="code bash highlight-default"><div class="highlight"><pre><span></span><span class="n">x</span><span class="o">.</span><span class="n">bin</span><span class="o">.</span><span class="n">env</span> +</pre></div> +</div> +<p>Where x is one of thw executables supported by JABAWS. Several environment variables can be specified in the same line. For example.</p> +<div class="code bash highlight-default"><div class="highlight"><pre><span></span><span class="n">mafft</span><span class="o">.</span><span class="n">bin</span><span class="o">.</span><span class="n">env</span><span class="o">=</span><span class="n">MAFFT_BINARIES</span><span class="c1">#/homes/cengine/mafft;FASTA_4_MAFFT#/bin/fasta34;</span> +</pre></div> +</div> +<p>The example above defines two environment variables with names <code class="docutils literal"><span class="pre">MAFFT-BINARIES</span></code> and <code class="docutils literal"><span class="pre">FASTA_4_MAFFT</span></code> and values <code class="docutils literal"><span class="pre">/homes/cengine/mafft</span> <span class="pre">and</span> <span class="pre">/bin/fasta34</span></code> respectively. Semicolon is used as a separator between different environment variables whereas hash is used as a separator for name and value of the variable.</p> +<hr class="docutils" /> +</div> +<div class="section" id="configure-jabaws-to-work-with-mafft"> +<span id="jabaws-config-env-mafft"></span><h3>Configure JABAWS to Work with Mafft<a class="headerlink" href="#configure-jabaws-to-work-with-mafft" title="Permalink to this headline">¶</a></h3> +<p>If you use default configuration you do not need to read any further. The default configuration will work for you without any changes, however, if you want to install Mafft yourself then there is a couple of more steps to do.</p> +<p>Mafft executable needs to know the location of other files supplied with Mafft. In addition some Mafft functions depends on the fasta executable, which is not supplied with Mafft, but is a separate package. Mafft needs to know the location of fasta34 executable.</p> +<p>To let Mafft know where the other files from its package are, change the value of MAFFT-BINARIES environment variables. To let Mafft know where is the fasta34 executable set the value of FASTA_4_MAFFT environment variable to point to a location of fasta34 program. The latter can be added to the PATH variable instead. If you are using executables supplied with JABAWS, the path to Mafft binaries would be like <code class="docutils literal"><span class="pre"><relative</span> <span class="pre">path</span> <span class="pre">to</span> <span class="pre">web</span> <span class="pre">application</span> <span class="pre">directory>/binaries/src/mafft/binaries</span></code> and the path to fasta34 binary would be <code class="docutils literal"><span class="pre"><relative</span> <span class="pre">path</span> <span class="pre">to</span> <span class="pre">web</span> <span class="pre">application</span> <span class="pre">directory>/binaries/src/fasta34/fasta34</span></code>. You can specify the location of Mafft binaries as well as fasta34 program elsewhere by providing an absolute path to them. All these settings are defined in <code class="docutils literal"><span class="pre">conf/Executable.properties</span></code> file.</p> +<hr class="docutils" /> +</div> +<div class="section" id="limiting-the-size-of-the-job-accepted-by-jabaws"> +<span id="jabaws-config-env-limit"></span><h3>Limiting the size of the job accepted by JABAWS<a class="headerlink" href="#limiting-the-size-of-the-job-accepted-by-jabaws" title="Permalink to this headline">¶</a></h3> +<p>JABAWS can be configured to reject excessively large tasks. This is useful if you operate JABAWS service for many users. By defining a maximum allowed task size you can provide an even service for all users and prevents waste of resources on the tasks too large to complete successfully. You can define the maximum number of sequences and the maximum average sequence length that JABAWS accepts for each JABA Web Service independently. Furthermore, you can define different limits for different presets of the same web service.</p> +<p>By default limits are disabled. You can enable them by editing <code class="docutils literal"><span class="pre">conf/Executable.properties</span></code> file. You can adjust the limits according to your needs by editing <code class="docutils literal"><span class="pre">conf/settings/<X>Limit.xml</span></code> files.</p> +</div> +<div class="section" id="pre-compiled-binaries"> +<span id="war-precompiled-bin"></span><h3>Pre-compiled binaries<a class="headerlink" href="#pre-compiled-binaries" title="Permalink to this headline">¶</a></h3> +<p>JABAWS comes with pre-compiled x86 Linux binaries, thus on such systems JABAWS should work straight out of the box. If you are in any doubts or experience problems you may want to make sure that the binaries supplied work under your OS. The source code for these programs is also provided so you can <a class="reference external" href="advanced.html#recompiling-binaries-for-your-system">recompile the binaries</a> for your own architecture and exploit any optimizations that your system can provide.</p> +<p>To check if the bundled binaries are working in your system execute each binary, without any command line options or input files. If you see an error message complaining about missing libraries or other problems, then you probably need to <a class="reference external" href="advanced.html#recompiling-binaries-for-your-system">recompile the binaries</a>.</p> +<p>Alternately, if you have already got binaries on your system, then you can simply <a class="reference external" href="advanced.html#obtaining_or_reusing_binaries">reuse the existing binaries</a> by updating the paths in JABAWS’s <a class="reference external" href="advanced.html#jabaws-configuration">configuration files</a> so these are used instead. If you have a different version of an executable (e.g. an alignment program) which you prefer, you could use it as long as it supports all the functions JABAWS executable require. This could be the case with more recent executable. If the options supported by your chosen executable is different from the standard JABAWS executable, then you need to edit the <code class="docutils literal"><span class="pre">ExecutableNameParamaters.xml</span></code> configuration file.</p> +<p>You can try all the JABAWS functionality with the JABAWS test client or have a look at <a class="reference external" href="war.html">deploying on Tomcat tips</a> if you experience any problems.</p> +<div class="admonition note"> +<p class="first admonition-title">Note</p> +<p class="last">You may want to enable logging for testing different executables as described in section ‘JABAWS Internal Logging’</p> +</div> +<hr class="docutils" /> +</div> +<div class="section" id="recompiling-binaries-for-your-system"> +<span id="war-recompile-bin"></span><h3>Recompiling binaries for your system<a class="headerlink" href="#recompiling-binaries-for-your-system" title="Permalink to this headline">¶</a></h3> +<p>If you have a fully equipped build environment on your (POSIX-like) system, then you should be able to recompile the programs from the source distributions which are included in the JABAWS war file. A script called ‘compilebin.sh’ is provided to automate this task.</p> +<ol class="arabic"> +<li><p class="first">In a terminal window, change the working directory to <code class="docutils literal"><span class="pre">binaries/src</span></code></p> +</li> +<li><p class="first">Execute the compilebin.sh script:</p> +<blockquote> +<div><div class="code bash highlight-default"><div class="highlight"><pre><span></span><span class="n">chmod</span> <span class="o">+</span><span class="n">x</span> <span class="n">compilebin</span><span class="o">.</span><span class="n">sh</span><span class="p">;</span> <span class="n">compilebin</span><span class="o">.</span><span class="n">sh</span> <span class="o">></span> <span class="n">compilebin</span><span class="o">.</span><span class="n">out</span><span class="p">;</span> +</pre></div> +</div> +</div></blockquote> +</li> +<li><p class="first">Then run:</p> +<blockquote> +<div><div class="code bash highlight-default"><div class="highlight"><pre><span></span><span class="n">chmod</span> <span class="o">+</span><span class="n">x</span> <span class="n">setexecflag</span><span class="o">.</span><span class="n">sh</span><span class="p">;</span> <span class="n">sh</span> <span class="n">setexecflag</span><span class="o">.</span><span class="n">sh</span> +</pre></div> +</div> +<p>If any of the binaries was not recompiled, then a ‘file not found’ error will be raised.</p> +</div></blockquote> +</li> +<li><p class="first">Finally, restart your Tomcat server (or JABAWS application only), and <a class="reference external" href="advanced.html#testing-the-jabaws-server">test JABAWS</a> to check that it can use the new binaries.</p> +</li> +</ol> +<p>If you couldn’t compile everything, then it may be that your system does not have all the tools required for compiling the programs. At the very least check that you have gcc, g++ and make installed in your system. If not install these packages and repeat the compilation steps again. You should also review the compilebin.sh output - which was redirected to compilebin.out, and any errors output to the terminal.</p> +<hr class="docutils" /> +</div> +<div class="section" id="obtaining-or-reusing-binaries"> +<span id="war-reusing-bin"></span><h3>Obtaining or reusing binaries<a class="headerlink" href="#obtaining-or-reusing-binaries" title="Permalink to this headline">¶</a></h3> +<p>You could search for pre-packaged compiled executable in your system package repository or alternately, download pre-compiled binaries from each alignment program’s home page. Then, either replace the executables supplied with the downloaded ones, or modify the paths defined in <code class="docutils literal"><span class="pre">executable.properties</span></code> as described below. +.. Below are some suggestions on where you may be able to get the binaries for your system.</p> +<p>If you would like to use the binaries you already have, then you just need to let JABAWS know where they are. To do this, edit: <code class="docutils literal"><span class="pre">conf/Executable.properties</span></code></p> +<p>When specifying paths to executables that already exist on your system, make sure you provide an absolute path, or one relative to the JABAWS directory inside webapps. For example, the default path for clustalw is defined as <code class="docutils literal"><span class="pre">local.clustalw.bin=binaries/src/clustalw/src/clustalw2</span></code> Alternatively, instead of changing <code class="docutils literal"><span class="pre">Executable.properties</span></code> you could also replace the executables bundled with JABAWS with the ones that you have, or make symbolic links to them. Then the default configuration will work for you. More information about the Executable.properties file is given in the JABAWS Configuration page.</p> +<hr class="docutils" /> +</div> +</div> +<div class="section" id="load-balancing"> +<span id="jabaws-config-lb"></span><h2>Load balancing<a class="headerlink" href="#load-balancing" title="Permalink to this headline">¶</a></h2> +<p>If your cluster is busy and has significant waiting times, you can achieve a faster response by allowing the server machine to calculate small tasks and then reserve the cluster for bigger jobs. This works especially well if your server is a powerful machine with many CPUs. To do this you need to enable and configure both the cluster and the local engines. Once this is done decide on the maximum size of a task to be run on the server locally. Then, edit “# LocalEngineExecutionLimit #” preset in <code class="docutils literal"><span class="pre"><ServiceName>Limits.xml</span></code> file accordingly. JABAWS server then will balance the load according to the following rule: If the task size is smaller than the maximum task size for local engine, and the local engine has idle threads, then it calculates task locally otherwise it submit the task to the cluster.</p> +<hr class="docutils" /> +</div> +<div class="section" id="testing-the-jabaws-server"> +<span id="war-testing"></span><h2>Testing the JABAWS Server<a class="headerlink" href="#testing-the-jabaws-server" title="Permalink to this headline">¶</a></h2> +<p>Access <code class="docutils literal"><span class="pre"><your_JABAWS_server_URL>/ServiceStatus</span></code> to test all web services. Each time you access this URL, all services are tested. For production configuration we recommend prohibiting requests to this URL for non authenticated users to prevent excessive load on the server.</p> +<p>Alternatively, you can use a command line client (part of the client only package) to test your JABAWS installation as described here. If you downloaded a JABAWS server package, you can use <code class="docutils literal"><span class="pre"><your_jaba_context_name>/WEB-INF/lib/jaba-client.jar</span></code> to test JABAWS installation as described here. If you downloaded the source code, then you could run a number of test suites defined in the build.xml Apache Ant file.</p> +<p>First of all make sure that Tomcat server is started successfully. If this was the case, then you should see JABAWS home page when you navigate to your Tomcat JABAWS context path in your browser (e.g. at <code class="docutils literal"><span class="pre">http://myhost.compbio.ac.uk:8080/jabaws</span></code> => <code class="docutils literal"><span class="pre"><jabaws_server></span></code>)</p> +<p>If you see it, then it is time to make sure that web services are working too. The easiest way to do this is to access Services Status page available from the main JABAWS web page menu.</p> +<p>If you need to monitor web service health automatically when the best option is to use service checker that responds with the standard HTTP status code. To access this checker use the following URL:</p> +<p><strong>Using JABAWS service status checker</strong></p> +<p>If you see it, then it is time to make sure that web services are working too. The easiest way to do this is to access Services Status page available from the main JABAWS web page menu.</p> +<p>If you need to monitor web service health automatically when the best option is to use service checker that responds with the standard HTTP status code. To access this checker use the following URL: <code class="docutils literal"><span class="pre"><jabaws-server>/HttpCodeResponseServiceStatus</span></code> or alternatively <code class="docutils literal"><span class="pre"><jabaws-server>/man_serverwar.jsp</span></code></p> +<p>This page returns code 200, and no page context if all services are operational, 503 if one of the services have problems. You can also check each web service individually by providing the name of the web service to check at the end of the service checker URL like this: <code class="docutils literal"><span class="pre"><jabaws_server>/HttpCodeResponseServiceStatus/ClustalWS</span></code></p> +<p>Upon request, the service status checker will examine the health of the ClustalWS web service only. If the service name is not valid, then the service checker will return code 400.</p> +<p><strong>Using command line client</strong></p> +<p>Alternatively, you should be able to use the test program which can be found in <code class="docutils literal"><span class="pre"><webapplicationpath>/WEB-INF/lib/jabaws-client.jar</span></code> file. To run the tests type:</p> +<div class="code bash highlight-default"><div class="highlight"><pre><span></span><span class="n">java</span> <span class="o">-</span><span class="n">jar</span> <span class="n">jabaws</span><span class="o">-</span><span class="n">client</span><span class="o">.</span><span class="n">jar</span> <span class="o">-</span><span class="n">h</span><span class="o">=<</span><span class="n">Your</span> <span class="n">web</span> <span class="n">application</span> <span class="n">server</span> <span class="n">host</span> <span class="n">name</span><span class="p">,</span> <span class="n">port</span> <span class="ow">and</span> <span class="n">JABAWS</span> <span class="n">context</span> <span class="n">path</span><span class="o">></span> +</pre></div> +</div> +<p>For example to test all JABAWS web services on host myhost.compbio.ac.uk type:</p> +<div class="code bash highlight-default"><div class="highlight"><pre><span></span><span class="n">java</span> <span class="o">-</span><span class="n">jar</span> <span class="n">jabaws</span><span class="o">-</span><span class="n">client</span><span class="o">.</span><span class="n">jar</span> <span class="o">-</span><span class="n">h</span><span class="o">=</span><span class="n">http</span><span class="p">:</span><span class="o">//</span><span class="n">myhost</span><span class="o">.</span><span class="n">compbio</span><span class="o">.</span><span class="n">ac</span><span class="o">.</span><span class="n">uk</span><span class="p">:</span><span class="mi">8080</span><span class="o">/</span><span class="n">jabaws</span> +</pre></div> +</div> +<p>You can choose a particular web server using -s option like this java -jar jabaws-client.jar -h=http://myhost.compbio.ac.uk:8080/jabaws -s=ClustalWS This command line assumes that java executable is in your path and jabaws-client.jar is located in the current directory.</p> +<p>An example of the report testing tool produces for operating web service looks like this:</p> +<div class="code bash highlight-default"><div class="highlight"><pre><span></span><span class="n">Connecting</span> <span class="n">to</span> <span class="n">service</span> <span class="n">MuscleWS</span> <span class="n">on</span> <span class="n">http</span><span class="p">:</span><span class="o">//</span><span class="n">myhost</span><span class="o">.</span><span class="n">compbio</span><span class="o">.</span><span class="n">ac</span><span class="o">.</span><span class="n">uk</span><span class="p">:</span><span class="mi">8080</span><span class="o">/</span><span class="n">jabaws</span> <span class="o">...</span> <span class="n">OK</span> +<span class="n">Testing</span> <span class="n">alignment</span> <span class="k">with</span> <span class="n">default</span> <span class="n">parameters</span><span class="p">:</span> +<span class="n">Queering</span> <span class="n">job</span> <span class="n">status</span><span class="o">...</span><span class="n">OK</span> +<span class="n">Retrieving</span> <span class="n">results</span><span class="o">...</span><span class="n">OK</span> +<span class="n">Testing</span> <span class="n">alignment</span> <span class="k">with</span> <span class="n">presets</span><span class="p">:</span> +<span class="n">Aligning</span> <span class="k">with</span> <span class="n">preset</span> <span class="s1">'Protein alignment(Fastest speed)'</span><span class="o">...</span> <span class="n">OK</span> +<span class="n">Aligning</span> <span class="k">with</span> <span class="n">preset</span> <span class="s1">'Nucleotide alignment(Fastest speed)'</span><span class="o">...</span> <span class="n">OK</span> +<span class="n">Aligning</span> <span class="k">with</span> <span class="n">preset</span> <span class="s1">'Huge alignments (speed-oriented)'</span><span class="o">...</span> <span class="n">OK</span> +<span class="n">Queering</span> <span class="n">presets</span><span class="o">...</span><span class="n">OK</span> +<span class="n">Queering</span> <span class="n">Parameters</span><span class="o">...</span><span class="n">OK</span> +<span class="n">Queering</span> <span class="n">Limits</span><span class="o">...</span><span class="n">OK</span> +<span class="n">Queering</span> <span class="n">Local</span> <span class="n">Engine</span> <span class="n">Limits</span><span class="o">...</span><span class="n">OK</span> +<span class="n">Check</span> <span class="ow">is</span> <span class="n">completed</span> <span class="n">service</span> <span class="n">MuscleWS</span> <span class="n">IS</span> <span class="n">WORKING</span> +</pre></div> +</div> +<p>An example of the response of a web service which is deployed but is not operating is below:</p> +<div class="code bash highlight-default"><div class="highlight"><pre><span></span><span class="n">Connecting</span> <span class="n">to</span> <span class="n">service</span> <span class="n">ProbconsWS</span> <span class="n">on</span> <span class="n">http</span><span class="p">:</span><span class="o">//</span><span class="n">localhost</span><span class="p">:</span><span class="mi">8080</span><span class="o">/</span><span class="n">ws</span> <span class="o">...</span> <span class="n">OK</span> +<span class="n">Testing</span> <span class="n">alignment</span> <span class="k">with</span> <span class="n">default</span> <span class="n">parameters</span><span class="p">:</span><span class="n">FAILED</span> +<span class="n">Service</span> <span class="n">ProbconsWS</span> <span class="n">IS</span> <span class="n">NOT</span> <span class="n">FUNCTIONAL</span> +</pre></div> +</div> +<p>If the web server did not respond the message looks like following:</p> +<div class="code bash highlight-default"><div class="highlight"><pre><span></span><span class="n">Connecting</span> <span class="n">to</span> <span class="n">service</span> <span class="n">TcoffeeWS</span> <span class="n">on</span> <span class="n">http</span><span class="p">:</span><span class="o">//</span><span class="n">localhost</span><span class="p">:</span><span class="mi">8080</span><span class="o">/</span><span class="n">ws</span> <span class="o">...</span> <span class="n">FAILED</span> +</pre></div> +</div> +<hr class="docutils" /> +</div> +<div class="section" id="jabaws-internal-logging"> +<span id="war-logging"></span><h2>JABAWS internal logging<a class="headerlink" href="#jabaws-internal-logging" title="Permalink to this headline">¶</a></h2> +<p>JABAWS can be configured to log what it is doing. This comes in handy if you would like to see who is using your web services or need to chase some problems. JABAWS uses log4j to do the logging, the example of log4j configuration is bundled with JABAWS war file. You will find it in the <code class="docutils literal"><span class="pre">/WEB-INF/classes/log4j.properties</span></code> file. All the lines in this file are commented out. The reason why the logging is disabled by default it simple, log4j has to know the exact location of where the log files are stored. This is not known up until the deployment time. To enable the logging you need to define logDir property in the log4j.properties and uncomment section of the file which corresponds to your need. More information is given in the log4j.properties file itself. Restart the Tomcat or the JABAWS web application to apply the settings.</p> +<p>After you have done this, assuming that you did not change the log4j.properties file yourself, you should see the application log file called activity.log. The file called activity.log. The amount of information logged can be adjusted using different logging levels, it is reduced in the following order of log levels TRACE, DEBUG, INFO, WARN, ERROR, FATAL.</p> +<p>If you would like to know who is using your services, you might want to enable Tomcat request logging.</p> +<hr class="docutils" /> +<div class="section" id="jabaws-requests-logging"> +<span id="war-logging-req"></span><h3>JABAWS requests logging<a class="headerlink" href="#jabaws-requests-logging" title="Permalink to this headline">¶</a></h3> +<p>Enable Tomcat log valve. To do this uncomment the following section of <tomcat_root>/conf/server.xml configuration file.</p> +<div class="highlight-xml"><div class="highlight"><pre><span></span><span class="nt"><Valve</span> <span class="na">className=</span><span class="s">"org.apache.catalina.valves.AccessLogValve"</span> <span class="na">directory=</span><span class="s">"logs"</span> + <span class="na">prefix=</span><span class="s">"localhost_access_log."</span> <span class="na">suffix=</span><span class="s">".txt"</span> <span class="na">pattern=</span><span class="s">"common"</span> <span class="na">resolveHosts=</span><span class="s">"false"</span><span class="nt">/></span> +</pre></div> +</div> +<p>The following information will be logged:</p> +<table border="1" class="docutils"> +<colgroup> +<col width="12%" /> +<col width="26%" /> +<col width="27%" /> +<col width="13%" /> +<col width="21%" /> +</colgroup> +<thead valign="bottom"> +<tr class="row-odd"><th class="head">Remote IP</th> +<th class="head" colspan="2">Date | Method server_URL protocol</th> +<th class="head">HTTP status</th> +<th class="head">Response size in bytes</th> +</tr> +</thead> +<tbody valign="top"> +<tr class="row-even"><td>10.31.11.159</td> +<td>[10/Feb/2010:16:51:32 +0000]</td> +<td>“POST /jws2/MafftWS HTTP/1.1”</td> +<td>200</td> +<td>2067</td> +</tr> +</tbody> +</table> +<p>Which can be processed in various programs for log analysis, such as WebAlizer, Analog, AWStats.</p> +<hr class="docutils" /> +</div> +</div> +<div class="section" id="jabaws-and-google-analytics"> +<span id="jabaws-config-ga"></span><h2>JABAWS and Google Analytics<a class="headerlink" href="#jabaws-and-google-analytics" title="Permalink to this headline">¶</a></h2> +<p>JABAWS reports web services usage to our group Google Analytics (GA) account. JABAWS usage statistics are collected for funding and reporting purposes, and no private information is collected. The data sent by JABAWS is as follows:</p> +<ol class="arabic simple"> +<li>The IP address of the JABAWS server machine (the server IP can anonymized see <code class="docutils literal"><span class="pre">conf/GA.properties</span></code> config file)</li> +<li>The name of the web service that was called.</li> +<li>A few details of the system such as JABAWS version, java version, user language, color depth, screen resolution and character encoding.</li> +</ol> +<p>Google Analytics can be disabled or adjusted by removing/editing <code class="docutils literal"><span class="pre">conf/GA.properties</span></code> Google Analytics (GA) settings file. We would appreciate it greatly if you could leave it on!</p> +<p>All calls to GA are very lightweight, completed asynchronously, create very little overhead and do not influence the server response time or performance.</p> +<hr class="docutils" /> +</div> +<div class="section" id="jabaws-war-file-content"> +<span id="war-contents"></span><h2>JABAWS War File Content<a class="headerlink" href="#jabaws-war-file-content" title="Permalink to this headline">¶</a></h2> +<table border="1" class="docutils"> +<colgroup> +<col width="12%" /> +<col width="88%" /> +</colgroup> +<thead valign="bottom"> +<tr class="row-odd"><th class="head">Directory</th> +<th class="head">Content description</th> +</tr> +</thead> +<tbody valign="top"> +<tr class="row-even"><td>conf/ contains</td> +<td>configuration files such as Executable.properties, Engine.local.properties, Engine.cluster.properties</td> +</tr> +<tr class="row-odd"><td>conf/settings</td> +<td>Contains individual executable description files. In particular XXXParameters.xml, XXXPresets.xml, XXXLimits.xml where XXX is the name of the executable</td> +</tr> +<tr class="row-even"><td>ExecutionStatistics</td> +<td>The database for storing the execution statistics</td> +</tr> +<tr class="row-odd"><td>statpages</td> +<td>Web pages for usage statistics visialization and webservices status queries</td> +</tr> +<tr class="row-even"><td>jobsout/</td> +<td>Contains directories generated when running an individual executable. E.g. input and output files and some other task related data (optional)</td> +</tr> +<tr class="row-odd"><td>binaries/</td> +<td>Directory contains native executables - programs, windows binaries (optional)</td> +</tr> +<tr class="row-even"><td>binaries/src</td> +<td>Contains source of native executables and Linux i386 binaries</td> +</tr> +<tr class="row-odd"><td>binaries/windows</td> +<td>Contains binaries for MS Windows operating system</td> +</tr> +<tr class="row-even"><td>binaries/matrices</td> +<td>Substitution matrices</td> +</tr> +<tr class="row-odd"><td>WEB-INF</td> +<td>Web application descriptor</td> +</tr> +<tr class="row-even"><td>WEB-INF/lib</td> +<td>Web application libraries</td> +</tr> +<tr class="row-odd"><td>WEB-INF/classes</td> +<td>log4j.properties - log configuration file (optional)</td> +</tr> +<tr class="row-even"><td>static</td> +<td>Static content such as CSS, JavaScript and Image files</td> +</tr> +</tbody> +</table> +<table border="1" class="docutils"> +<colgroup> +<col width="12%" /> +<col width="88%" /> +</colgroup> +<thead valign="bottom"> +<tr class="row-odd"><th class="head"><strong>Help Pages</strong></th> +<th class="head"> </th> +</tr> +</thead> +<tbody valign="top"> +<tr class="row-even"><td>/</td> +<td>help pages, index.html is the starting page</td> +</tr> +<tr class="row-odd"><td><a class="reference external" href="http://www.compbio.dundee.ac.uk/jabaws/dm_javadoc/index.html">dm_javadoc</a></td> +<td>JavaDoc for the JABAWS Data Model</td> +</tr> +<tr class="row-even"><td><a class="reference external" href="http://www.compbio.dundee.ac.uk/jabaws/full_javadoc/index.html">full_javadoc</a></td> +<td>JavaDoc for the complete JABAWS</td> +</tr> +<tr class="row-odd"><td><a class="reference external" href="http://www.compbio.dundee.ac.uk/jabaws/prog_docs/">prog_docs</a></td> +<td>Documentation for programs that are included in JABAWS</td> +</tr> +</tbody> +</table> +</div> +</div> + + + </div> + <div class="articleComments"> + + </div> + </div> + <footer> + + <div class="rst-footer-buttons" role="navigation" aria-label="footer navigation"> + + <a href="develop.html" class="btn btn-neutral float-right" title="For Developers" accesskey="n" rel="next">Next <span class="fa fa-arrow-circle-right"></span></a> + + + <a href="va.html" class="btn btn-neutral" title="Virtual Appliance (VA)" accesskey="p" rel="prev"><span class="fa fa-arrow-circle-left"></span> Previous</a> + + </div> + + + <hr/> + + <div role="contentinfo"> + <p><a href="../">JABAWS 2.2</a> + © Copyright 2017, Peter Troshin, Alexander Sherstnev, Jim Procter, Alexey Drozdetskiy, Daniel Barton, Suzanne Duce, Fábio Madeira and Geoff Barton. + + </p> + </div> + Built with <a href="http://sphinx-doc.org/">Sphinx</a> using a <a href="https://github.com/snide/sphinx_rtd_theme">theme</a> provided by <a href="https://readthedocs.org">Read the Docs</a>. + +</footer> + </div> + </div> + + </section> + + </div> + + + + + + <script type="text/javascript"> + var DOCUMENTATION_OPTIONS = { + URL_ROOT:'./', + VERSION:'2.2', + LANGUAGE:'None', + COLLAPSE_INDEX:false, + FILE_SUFFIX:'.html', + HAS_SOURCE: true, + SOURCELINK_SUFFIX: '.txt' + }; + </script> + <script type="text/javascript" src="_static/jquery.js"></script> + <script type="text/javascript" src="_static/underscore.js"></script> + <script type="text/javascript" src="_static/doctools.js"></script> + + + + + + <script type="text/javascript" src="_static/js/theme.js"></script> + + + + + <script type="text/javascript"> + jQuery(function () { + SphinxRtdTheme.StickyNav.enable(); + }); + </script> + + +</body> +</html> \ No newline at end of file diff --git a/website/docs/changelog.html b/website/docs/changelog.html new file mode 100644 index 0000000..7b72a65 --- /dev/null +++ b/website/docs/changelog.html @@ -0,0 +1,323 @@ + + +<!DOCTYPE html> +<!--[if IE 8]><html class="no-js lt-ie9" lang="en" > <![endif]--> +<!--[if gt IE 8]><!--> <html class="no-js" lang="en" > <!--<![endif]--> +<head> + <meta charset="utf-8"> + + <meta name="viewport" content="width=device-width, initial-scale=1.0"> + + <title>Changelog — JABAWS 2.2 documentation</title> + + + + + + + + + + + + + + + + + + <link rel="stylesheet" href="_static/css/theme.css" type="text/css" /> + + + + + + <link rel="index" title="Index" + href="genindex.html"/> + <link rel="search" title="Search" href="search.html"/> + <link rel="top" title="JABAWS 2.2 documentation" href="index.html"/> + <link rel="prev" title="Citations" href="citations.html"/> + + + <script src="_static/js/modernizr.min.js"></script> + +</head> + +<body class="wy-body-for-nav" role="document"> + + + <div class="wy-grid-for-nav"> + + + <nav data-toggle="wy-nav-shift" class="wy-nav-side"> + <div class="wy-side-scroll"> + <div class="wy-side-nav-search"> + + + + <a href="index.html" class="icon icon-home"> JABAWS + + + + </a> + + + + + <div class="version"> + 2.2 + </div> + + + + +<div role="search"> + <form id="rtd-search-form" class="wy-form" action="search.html" method="get"> + <input type="text" name="q" placeholder="Search docs" /> + <input type="hidden" name="check_keywords" value="yes" /> + <input type="hidden" name="area" value="default" /> + </form> +</div> + + + </div> + + <div class="wy-menu wy-menu-vertical" data-spy="affix" role="navigation" aria-label="main navigation"> + + + + + + + <p class="caption"><span class="caption-text">Contents:</span></p> +<ul class="current"> +<li class="toctree-l1"><a class="reference internal" href="getting_started.html">Getting Started</a></li> +<li class="toctree-l1"><a class="reference internal" href="included_tools.html">Included Tools</a></li> +<li class="toctree-l1"><a class="reference internal" href="client.html">Command Line Client (CLI)</a></li> +<li class="toctree-l1"><a class="reference internal" href="war.html">Web Application Archive (WAR)</a></li> +<li class="toctree-l1"><a class="reference internal" href="va.html">Virtual Appliance (VA)</a></li> +<li class="toctree-l1"><a class="reference internal" href="advanced.html">Advanced Usage</a></li> +<li class="toctree-l1"><a class="reference internal" href="develop.html">For Developers</a></li> +<li class="toctree-l1"><a class="reference internal" href="stats.html">Usage Statistics</a></li> +<li class="toctree-l1"><a class="reference internal" href="citations.html">Citations</a></li> +<li class="toctree-l1 current"><a class="current reference internal" href="#">Changelog</a><ul> +<li class="toctree-l2"><a class="reference internal" href="#version-2-2-released-xx-april-2017">Version 2.2 (Released XX April 2017)</a></li> +<li class="toctree-l2"><a class="reference internal" href="#version-2-1-released-1st-oct-2013">Version 2.1 (Released 1st Oct 2013)</a></li> +<li class="toctree-l2"><a class="reference internal" href="#version-2-0-1-released-2nd-jul-2013">Version 2.0.1 (Released 2nd Jul 2013)</a></li> +<li class="toctree-l2"><a class="reference internal" href="#version-2-released-16th-dec-2011">Version 2 (Released 16th Dec 2011)</a></li> +</ul> +</li> +</ul> + + + + </div> + </div> + </nav> + + <section data-toggle="wy-nav-shift" class="wy-nav-content-wrap"> + + + <nav class="wy-nav-top" role="navigation" aria-label="top navigation"> + + <i data-toggle="wy-nav-top" class="fa fa-bars"></i> + <a href="index.html">JABAWS</a> + + </nav> + + + + <div class="wy-nav-content"> + <div class="rst-content"> + + + + + + + + + + + + + + + + +<div role="navigation" aria-label="breadcrumbs navigation"> + + <ul class="wy-breadcrumbs"> + + <li><a href="index.html">Docs</a> »</li> + + <li>Changelog</li> + + + <li class="wy-breadcrumbs-aside"> + + + <a href="_sources/changelog.rst.txt" rel="nofollow"> View page source</a> + + + </li> + + </ul> + + + <hr/> +</div> + <div role="main" class="document" itemscope="itemscope" itemtype="http://schema.org/Article"> + <div itemprop="articleBody"> + + <div class="section" id="changelog"> +<h1>Changelog<a class="headerlink" href="#changelog" title="Permalink to this headline">¶</a></h1> +<div class="section" id="version-2-2-released-xx-april-2017"> +<span id="v2-2"></span><h2>Version 2.2 (Released XX April 2017)<a class="headerlink" href="#version-2-2-released-xx-april-2017" title="Permalink to this headline">¶</a></h2> +<p>The website and documentation were improved:</p> +<ul class="simple"> +<li><a class="reference external" href="http://www.sphinx-doc.org/en/stable/">Sphinx</a> is now used to generate our documentation pages.</li> +<li>Documentation was updated to reflect the latest changes introduced in the project.</li> +<li>Downloading the JABAWS distributions no longer require ‘sign in’ or ‘sign up’ to a user account.</li> +<li>The pre-configured JABAWS Amazon Machine Image (AMI), which allowed for JABAWS to be run in the Amazon EC2 cloud, is no longer provided due to very limited use by the scientific community peers.</li> +</ul> +<p>The versions of several application programs provided by JABAWS were bumped to the latest available.</p> +<ul class="simple"> +<li>Clustal Omega was updated to version 1.2.4</li> +<li>ClustalW was updated to version 2.1</li> +<li>Mafft was updated to version 7.3.10</li> +<li>T-Coffee was updated to version 11.00.8cbe486</li> +<li>Protein secondary structure prediction with Jpred (version 3.0.3) was dropped from the list of provided services, as the use of the dedicated Jpred REST API (Jpred 4) is encouraged and recommended. This is the version that is currently provided within Jalview 2.9 or later.</li> +</ul> +<div class="admonition note"> +<p class="first admonition-title">Note</p> +<p class="last">JABAWS version 2.2 is fully backward compatible with JABAWS v1.0 and v2.0. This means all JABAWS 1.0, 2.0, 2.0.1 and 2.1 clients should also be able to use JABAWS 2.2 services.</p> +</div> +<hr class="docutils" /> +</div> +<div class="section" id="version-2-1-released-1st-oct-2013"> +<span id="v2-1"></span><h2>Version 2.1 (Released 1st Oct 2013)<a class="headerlink" href="#version-2-1-released-1st-oct-2013" title="Permalink to this headline">¶</a></h2> +<p>Several new web services are available in this version of JABAWS:</p> +<ul class="simple"> +<li>Two multiple sequence aligners (MSAprobs and GLprobs), both services return the standard Alignment object</li> +<li>RNAalifoldWS returns RNAStructScoreManager, which is the standard ScoreManager objects with several additional methods</li> +<li>JpredWS returns the JpredAligment object, which is the standard alignment with additional methods for extracting Jpred predictions. These predictions are supplied as additional sequences in the aligment</li> +</ul> +<p>Some bugs have been fixed and several improvements have been done:</p> +<ul class="simple"> +<li>WS status servlet returns version and some additional information on each web service</li> +<li>a bug with path to help in the client</li> +<li>Fix two bug with the Google Analytics library: no-stop due to running thread</li> +<li>GoogleAnalytics gets proper JABAWS version</li> +</ul> +<hr class="docutils" /> +</div> +<div class="section" id="version-2-0-1-released-2nd-jul-2013"> +<span id="v2-0-1"></span><h2>Version 2.0.1 (Released 2nd Jul 2013)<a class="headerlink" href="#version-2-0-1-released-2nd-jul-2013" title="Permalink to this headline">¶</a></h2> +<p>JABAWS 2.0.1 includes several bug fixes and minor updates for JABAWS Version 2.0. These are listed below:</p> +<ul class="simple"> +<li>Disembl returned swapped strings for HOTLOOPS and REM465</li> +<li>Jronn failed to process jobs with more than 3 sequences</li> +<li>JABAWS could not deal with FASTA records with ‘>’ symbols in the record identificator</li> +<li>Change of parameter description for AAcon: parameters have been replaced with options for calculation methods. This allows a user to get several AAcon’s conservation scores in one call</li> +<li>JABAWS never cleaned up job directories. Now JABAWS deletes the job directory if it exist longer than a period defined in Engine.properties</li> +<li>Default web security has been incompatible with Tomcat 7.0.31 and newer</li> +<li>Documentation has been updated</li> +</ul> +<hr class="docutils" /> +</div> +<div class="section" id="version-2-released-16th-dec-2011"> +<span id="v2-0"></span><h2>Version 2 (Released 16th Dec 2011)<a class="headerlink" href="#version-2-released-16th-dec-2011" title="Permalink to this headline">¶</a></h2> +<p>Compared to JABAWS 1, JABAWS 2 offers a greater number and diversity of web services, Amazon EC2 integration and improved ease of use.</p> +<p>It now contains:</p> +<ul class="simple"> +<li>Updates for all multiple sequence alignment services</li> +<li>Four new protein disorder prediction services</li> +<li>Clustal Omega multiple sequence alignment web service</li> +<li>Amino acid conservation service</li> +<li>Web services execution statistics visualization</li> +<li>Web services status check from a web page</li> +<li>VirtualBox support was dropped in favour of VMware</li> +<li>New WAR package for Mac users</li> +<li>Amazon Machine Image (AMI) distributive to enable users to use JABAWS on the EC2 cloud</li> +<li>Improved web services client API</li> +<li>Simplified WAR package installation</li> +</ul> +<div class="admonition warning"> +<p class="first admonition-title">Warning</p> +<p class="last">To access the analysis web services introduced in JABAWS 2.0, clients that were designed for JABAWS v1.0 must be updated.</p> +</div> +</div> +</div> + + + </div> + <div class="articleComments"> + + </div> + </div> + <footer> + + <div class="rst-footer-buttons" role="navigation" aria-label="footer navigation"> + + + <a href="citations.html" class="btn btn-neutral" title="Citations" accesskey="p" rel="prev"><span class="fa fa-arrow-circle-left"></span> Previous</a> + + </div> + + + <hr/> + + <div role="contentinfo"> + <p><a href="../">JABAWS 2.2</a> + © Copyright 2017, Peter Troshin, Alexander Sherstnev, Jim Procter, Alexey Drozdetskiy, Daniel Barton, Suzanne Duce, Fábio Madeira and Geoff Barton. + + </p> + </div> + Built with <a href="http://sphinx-doc.org/">Sphinx</a> using a <a href="https://github.com/snide/sphinx_rtd_theme">theme</a> provided by <a href="https://readthedocs.org">Read the Docs</a>. + +</footer> + </div> + </div> + + </section> + + </div> + + + + + + <script type="text/javascript"> + var DOCUMENTATION_OPTIONS = { + URL_ROOT:'./', + VERSION:'2.2', + LANGUAGE:'None', + COLLAPSE_INDEX:false, + FILE_SUFFIX:'.html', + HAS_SOURCE: true, + SOURCELINK_SUFFIX: '.txt' + }; + </script> + <script type="text/javascript" src="_static/jquery.js"></script> + <script type="text/javascript" src="_static/underscore.js"></script> + <script type="text/javascript" src="_static/doctools.js"></script> + + + + + + <script type="text/javascript" src="_static/js/theme.js"></script> + + + + + <script type="text/javascript"> + jQuery(function () { + SphinxRtdTheme.StickyNav.enable(); + }); + </script> + + +</body> +</html> \ No newline at end of file diff --git a/website/docs/citations.html b/website/docs/citations.html new file mode 100644 index 0000000..0db9016 --- /dev/null +++ b/website/docs/citations.html @@ -0,0 +1,249 @@ + + +<!DOCTYPE html> +<!--[if IE 8]><html class="no-js lt-ie9" lang="en" > <![endif]--> +<!--[if gt IE 8]><!--> <html class="no-js" lang="en" > <!--<![endif]--> +<head> + <meta charset="utf-8"> + + <meta name="viewport" content="width=device-width, initial-scale=1.0"> + + <title>Citations — JABAWS 2.2 documentation</title> + + + + + + + + + + + + + + + + + + <link rel="stylesheet" href="_static/css/theme.css" type="text/css" /> + + + + + + <link rel="index" title="Index" + href="genindex.html"/> + <link rel="search" title="Search" href="search.html"/> + <link rel="top" title="JABAWS 2.2 documentation" href="index.html"/> + <link rel="next" title="Changelog" href="changelog.html"/> + <link rel="prev" title="Usage Statistics" href="stats.html"/> + + + <script src="_static/js/modernizr.min.js"></script> + +</head> + +<body class="wy-body-for-nav" role="document"> + + + <div class="wy-grid-for-nav"> + + + <nav data-toggle="wy-nav-shift" class="wy-nav-side"> + <div class="wy-side-scroll"> + <div class="wy-side-nav-search"> + + + + <a href="index.html" class="icon icon-home"> JABAWS + + + + </a> + + + + + <div class="version"> + 2.2 + </div> + + + + +<div role="search"> + <form id="rtd-search-form" class="wy-form" action="search.html" method="get"> + <input type="text" name="q" placeholder="Search docs" /> + <input type="hidden" name="check_keywords" value="yes" /> + <input type="hidden" name="area" value="default" /> + </form> +</div> + + + </div> + + <div class="wy-menu wy-menu-vertical" data-spy="affix" role="navigation" aria-label="main navigation"> + + + + + + + <p class="caption"><span class="caption-text">Contents:</span></p> +<ul class="current"> +<li class="toctree-l1"><a class="reference internal" href="getting_started.html">Getting Started</a></li> +<li class="toctree-l1"><a class="reference internal" href="included_tools.html">Included Tools</a></li> +<li class="toctree-l1"><a class="reference internal" href="client.html">Command Line Client (CLI)</a></li> +<li class="toctree-l1"><a class="reference internal" href="war.html">Web Application Archive (WAR)</a></li> +<li class="toctree-l1"><a class="reference internal" href="va.html">Virtual Appliance (VA)</a></li> +<li class="toctree-l1"><a class="reference internal" href="advanced.html">Advanced Usage</a></li> +<li class="toctree-l1"><a class="reference internal" href="develop.html">For Developers</a></li> +<li class="toctree-l1"><a class="reference internal" href="stats.html">Usage Statistics</a></li> +<li class="toctree-l1 current"><a class="current reference internal" href="#">Citations</a></li> +<li class="toctree-l1"><a class="reference internal" href="changelog.html">Changelog</a></li> +</ul> + + + + </div> + </div> + </nav> + + <section data-toggle="wy-nav-shift" class="wy-nav-content-wrap"> + + + <nav class="wy-nav-top" role="navigation" aria-label="top navigation"> + + <i data-toggle="wy-nav-top" class="fa fa-bars"></i> + <a href="index.html">JABAWS</a> + + </nav> + + + + <div class="wy-nav-content"> + <div class="rst-content"> + + + + + + + + + + + + + + + + +<div role="navigation" aria-label="breadcrumbs navigation"> + + <ul class="wy-breadcrumbs"> + + <li><a href="index.html">Docs</a> »</li> + + <li>Citations</li> + + + <li class="wy-breadcrumbs-aside"> + + + <a href="_sources/citations.rst.txt" rel="nofollow"> View page source</a> + + + </li> + + </ul> + + + <hr/> +</div> + <div role="main" class="document" itemscope="itemscope" itemtype="http://schema.org/Article"> + <div itemprop="articleBody"> + + <div class="section" id="citations"> +<h1>Citations<a class="headerlink" href="#citations" title="Permalink to this headline">¶</a></h1> +<div class="admonition note"> +<p class="first admonition-title">Note</p> +<p class="last">It is important that you cite JABAWS when you use it. Citing us helps us funding the work we do and allow us to continue to improve the project further.</p> +</div> +<p id="id1">Peter V. Troshin, James B. Procter and Geoffrey J. Barton - <strong>Java Bioinformatics Analysis Web Services for Multiple Sequence Alignment - JABAWS:MS</strong> Bioinformatics 2011. 27 (14): 2001-2002. doi: <a class="reference external" href="https://doi.org/10.1093/bioinformatics/btr304">10.1093/bioinformatics/btr304</a></p> +</div> + + + </div> + <div class="articleComments"> + + </div> + </div> + <footer> + + <div class="rst-footer-buttons" role="navigation" aria-label="footer navigation"> + + <a href="changelog.html" class="btn btn-neutral float-right" title="Changelog" accesskey="n" rel="next">Next <span class="fa fa-arrow-circle-right"></span></a> + + + <a href="stats.html" class="btn btn-neutral" title="Usage Statistics" accesskey="p" rel="prev"><span class="fa fa-arrow-circle-left"></span> Previous</a> + + </div> + + + <hr/> + + <div role="contentinfo"> + <p><a href="../">JABAWS 2.2</a> + © Copyright 2017, Peter Troshin, Alexander Sherstnev, Jim Procter, Alexey Drozdetskiy, Daniel Barton, Suzanne Duce, Fábio Madeira and Geoff Barton. + + </p> + </div> + Built with <a href="http://sphinx-doc.org/">Sphinx</a> using a <a href="https://github.com/snide/sphinx_rtd_theme">theme</a> provided by <a href="https://readthedocs.org">Read the Docs</a>. + +</footer> + </div> + </div> + + </section> + + </div> + + + + + + <script type="text/javascript"> + var DOCUMENTATION_OPTIONS = { + URL_ROOT:'./', + VERSION:'2.2', + LANGUAGE:'None', + COLLAPSE_INDEX:false, + FILE_SUFFIX:'.html', + HAS_SOURCE: true, + SOURCELINK_SUFFIX: '.txt' + }; + </script> + <script type="text/javascript" src="_static/jquery.js"></script> + <script type="text/javascript" src="_static/underscore.js"></script> + <script type="text/javascript" src="_static/doctools.js"></script> + + + + + + <script type="text/javascript" src="_static/js/theme.js"></script> + + + + + <script type="text/javascript"> + jQuery(function () { + SphinxRtdTheme.StickyNav.enable(); + }); + </script> + + +</body> +</html> \ No newline at end of file diff --git a/website/docs/client.html b/website/docs/client.html new file mode 100644 index 0000000..4858aef --- /dev/null +++ b/website/docs/client.html @@ -0,0 +1,325 @@ + + +<!DOCTYPE html> +<!--[if IE 8]><html class="no-js lt-ie9" lang="en" > <![endif]--> +<!--[if gt IE 8]><!--> <html class="no-js" lang="en" > <!--<![endif]--> +<head> + <meta charset="utf-8"> + + <meta name="viewport" content="width=device-width, initial-scale=1.0"> + + <title>Command Line Client (CLI) — JABAWS 2.2 documentation</title> + + + + + + + + + + + + + + + + + + <link rel="stylesheet" href="_static/css/theme.css" type="text/css" /> + + + + + + <link rel="index" title="Index" + href="genindex.html"/> + <link rel="search" title="Search" href="search.html"/> + <link rel="top" title="JABAWS 2.2 documentation" href="index.html"/> + <link rel="next" title="Web Application Archive (WAR)" href="war.html"/> + <link rel="prev" title="Included Tools" href="included_tools.html"/> + + + <script src="_static/js/modernizr.min.js"></script> + +</head> + +<body class="wy-body-for-nav" role="document"> + + + <div class="wy-grid-for-nav"> + + + <nav data-toggle="wy-nav-shift" class="wy-nav-side"> + <div class="wy-side-scroll"> + <div class="wy-side-nav-search"> + + + + <a href="index.html" class="icon icon-home"> JABAWS + + + + </a> + + + + + <div class="version"> + 2.2 + </div> + + + + +<div role="search"> + <form id="rtd-search-form" class="wy-form" action="search.html" method="get"> + <input type="text" name="q" placeholder="Search docs" /> + <input type="hidden" name="check_keywords" value="yes" /> + <input type="hidden" name="area" value="default" /> + </form> +</div> + + + </div> + + <div class="wy-menu wy-menu-vertical" data-spy="affix" role="navigation" aria-label="main navigation"> + + + + + + + <p class="caption"><span class="caption-text">Contents:</span></p> +<ul class="current"> +<li class="toctree-l1"><a class="reference internal" href="getting_started.html">Getting Started</a></li> +<li class="toctree-l1"><a class="reference internal" href="included_tools.html">Included Tools</a></li> +<li class="toctree-l1 current"><a class="current reference internal" href="#">Command Line Client (CLI)</a><ul> +<li class="toctree-l2"><a class="reference internal" href="#installing">Installing</a></li> +<li class="toctree-l2"><a class="reference internal" href="#usage">Usage</a></li> +<li class="toctree-l2"><a class="reference internal" href="#example-usage">Example Usage</a></li> +</ul> +</li> +<li class="toctree-l1"><a class="reference internal" href="war.html">Web Application Archive (WAR)</a></li> +<li class="toctree-l1"><a class="reference internal" href="va.html">Virtual Appliance (VA)</a></li> +<li class="toctree-l1"><a class="reference internal" href="advanced.html">Advanced Usage</a></li> +<li class="toctree-l1"><a class="reference internal" href="develop.html">For Developers</a></li> +<li class="toctree-l1"><a class="reference internal" href="stats.html">Usage Statistics</a></li> +<li class="toctree-l1"><a class="reference internal" href="citations.html">Citations</a></li> +<li class="toctree-l1"><a class="reference internal" href="changelog.html">Changelog</a></li> +</ul> + + + + </div> + </div> + </nav> + + <section data-toggle="wy-nav-shift" class="wy-nav-content-wrap"> + + + <nav class="wy-nav-top" role="navigation" aria-label="top navigation"> + + <i data-toggle="wy-nav-top" class="fa fa-bars"></i> + <a href="index.html">JABAWS</a> + + </nav> + + + + <div class="wy-nav-content"> + <div class="rst-content"> + + + + + + + + + + + + + + + + +<div role="navigation" aria-label="breadcrumbs navigation"> + + <ul class="wy-breadcrumbs"> + + <li><a href="index.html">Docs</a> »</li> + + <li>Command Line Client (CLI)</li> + + + <li class="wy-breadcrumbs-aside"> + + + <a href="_sources/client.rst.txt" rel="nofollow"> View page source</a> + + + </li> + + </ul> + + + <hr/> +</div> + <div role="main" class="document" itemscope="itemscope" itemtype="http://schema.org/Article"> + <div itemprop="articleBody"> + + <div class="section" id="command-line-client-cli"> +<h1>Command Line Client (CLI)<a class="headerlink" href="#command-line-client-cli" title="Permalink to this headline">¶</a></h1> +<p>The JABAWS client is a Java application that lets you run the programs for which a JABAWS server provides web services. This command line application this is able to call any of the JABAWS web services on any instance of JABAWS Server available over the web. The basic client is useful if you would like to test or execute the programs provided by the JABAWS server in your own scripts, but you do not want to handle any web service specific details. The client is an open source software, so you can also use the source code to as an example how to manipulate with JABAWS web services in your own code. The JABA Web Services are <a class="reference external" href="http://www.ws-i.org/">WS-I</a> compliant. This means that you can access them from any language that has libraries or functions for consuming interoperable SOAP web services. More information on how to develop software that access JABAWS services is provided in the <a class="reference external" href="develop.html#accessing-jabaws-from-your-program">documentation pages</a>.</p> +<p>The command line client comes as a part of <a class="reference external" href="../download.jsp#client">client package</a> which you are welcome to download. The command line client can be used to align sequences using any of JABAWS supported web services. The client is OS independent and supports most of the functions which can be accessed programmatically via <a class="reference external" href="http://www.compbio.dundee.ac.uk/jabaws/full_javadoc/index.html">JABAWS API</a>. Using this client you could align sequences using presets or custom parameters, please see examples of this below. Here is the list of options supported by the command line client.</p> +<hr class="docutils" /> +<div class="section" id="installing"> +<span id="client-installing"></span><h2>Installing<a class="headerlink" href="#installing" title="Permalink to this headline">¶</a></h2> +<div class="admonition tip"> +<p class="first admonition-title">Tip</p> +<p class="last">Check if you are running the recommended version of Java.</p> +</div> +<p>You need Java 7 or higher installed in your machine to be able to run the JABAWS CLI client. +Please see the <cite>Java</cite> web site for up to date instructions and downloads.</p> +<hr class="docutils" /> +</div> +<div class="section" id="usage"> +<span id="cli-usage"></span><h2>Usage<a class="headerlink" href="#usage" title="Permalink to this headline">¶</a></h2> +<div class="code bash highlight-default"><div class="highlight"><pre><span></span><span class="n">java</span> <span class="o">-</span><span class="n">jar</span> <span class="n">jaba</span><span class="o">-</span><span class="n">client</span><span class="o">.</span><span class="n">jar</span> +</pre></div> +</div> +<div class="highlight-default"><div class="highlight"><pre><span></span>Usage: +java -jar <path_to_jar_file> -h=host_and_context -s=serviceName ACTION [OPTIONS] +-h=<host_and_context> - a full URL to the JABAWS web server including context path e.g. http://10.31.10.159:8080/ws +-s=<ServiceName> - one of [MafftWS, MuscleWS, ClustalWS, ClustalOWS, TcoffeeWS, ProbconsWS, AAConWS, JronnWS, DisemblWS, GlobPlotWS, IUPredWS] + + +ACTIONS: +-i=<inputFile> - full path to fasta formatted sequence file, from which to align sequences +-parameters - lists parameters supported by web service +-presets - lists presets supported by web service +-limits - lists web services limits +Please note that if input file is specified other actions are ignored + + + OPTIONS: (only for use with -i action): +-r=<presetName> - name of the preset to use +-o=<outputFile> - full path to the file where to write an alignment +-f=<parameterInputFile> - the name of the file with the list of parameters to use. + +Please note that -r and -f options cannot be used together. Alignment is done with either preset or aparameters from the file, but not both! +</pre></div> +</div> +<hr class="docutils" /> +</div> +<div class="section" id="example-usage"> +<span id="cli-example"></span><h2>Example Usage<a class="headerlink" href="#example-usage" title="Permalink to this headline">¶</a></h2> +<p>Align sequences from input.fasta file using Mafft web service with default settings, print alignment in Clustal format to console.</p> +<div class="code bash highlight-default"><div class="highlight"><pre><span></span><span class="n">java</span> <span class="o">-</span><span class="n">jar</span> <span class="n">jabaws</span><span class="o">-</span><span class="nb">min</span><span class="o">-</span><span class="n">client</span><span class="o">.</span><span class="n">jar</span> <span class="o">-</span><span class="n">h</span><span class="o">=</span><span class="n">http</span><span class="p">:</span><span class="o">//</span><span class="n">myhost</span><span class="o">.</span><span class="n">compbio</span><span class="o">.</span><span class="n">ac</span><span class="o">.</span><span class="n">uk</span><span class="p">:</span><span class="mi">8080</span><span class="o">/</span><span class="n">jabaws</span> <span class="o">-</span><span class="n">s</span><span class="o">=</span><span class="n">MafftWS</span> <span class="o">-</span><span class="n">i</span><span class="o">=</span><span class="n">d</span><span class="p">:</span>\<span class="nb">input</span><span class="o">.</span><span class="n">fasta</span> +</pre></div> +</div> +<p>Content of input.fasta file is show below (please note sequences has been trimmed for clarity)</p> +<div class="highlight-default"><div class="highlight"><pre><span></span><span class="o">></span><span class="n">Foobar</span> +<span class="n">MTADGPRELLQLRAAVRHRPQDFVAWL</span> +<span class="o">></span><span class="n">Bar</span> +<span class="n">MGDTTAGEMAVQRGLALHQ</span> +<span class="o">></span><span class="n">Foofriend</span> +<span class="n">MTADGPRELLQLRAAV</span> +</pre></div> +</div> +<p>Align as in above example, but write output alignment in a file out.clustal, using parameters defined in prm.in file</p> +<div class="code bash highlight-default"><div class="highlight"><pre><span></span><span class="n">java</span> <span class="o">-</span><span class="n">jar</span> <span class="n">jabaws</span><span class="o">-</span><span class="nb">min</span><span class="o">-</span><span class="n">client</span><span class="o">.</span><span class="n">jar</span> <span class="o">-</span><span class="n">h</span><span class="o">=</span><span class="n">http</span><span class="p">:</span><span class="o">//</span><span class="n">myhost</span><span class="o">.</span><span class="n">compbio</span><span class="o">.</span><span class="n">ac</span><span class="o">.</span><span class="n">uk</span><span class="p">:</span><span class="mi">8080</span><span class="o">/</span><span class="n">jabaws</span> <span class="o">-</span><span class="n">s</span><span class="o">=</span><span class="n">MafftWS</span> <span class="o">-</span><span class="n">i</span><span class="o">=</span><span class="n">d</span><span class="p">:</span>\<span class="nb">input</span><span class="o">.</span><span class="n">fasta</span> <span class="o">-</span><span class="n">o</span><span class="o">=</span><span class="n">d</span><span class="p">:</span>\<span class="n">out</span><span class="o">.</span><span class="n">clustal</span> <span class="o">-</span><span class="n">f</span><span class="o">=</span><span class="n">prm</span><span class="o">.</span><span class="ow">in</span> +</pre></div> +</div> +<p>The content of the prm.in file is shown below</p> +<div class="highlight-default"><div class="highlight"><pre><span></span><span class="o">--</span><span class="n">nofft</span> +<span class="o">--</span><span class="n">noscore</span> +<span class="o">--</span><span class="n">fastaparttree</span> +<span class="o">--</span><span class="n">retree</span><span class="o">=</span><span class="mi">10</span> +<span class="o">--</span><span class="n">op</span><span class="o">=</span><span class="mf">2.2</span> +</pre></div> +</div> +<p>The format of the file is the same for all JABAWS web services. Parameters are specified in exactly the same way as for native executables - alignment programs like Mafft etc. So parameters which you can use with command line version of an alignment program can be used with JABAWS. Most of the settings controlling alignment process are supported, but because any output has to be handled by JABAWS, settings controlling output are not allowed to be changed. For a list of parameters supported by a web service see the next example. In prm.in parameters are separated by the new line, and name of the parameter is separated from its value with an equals sign. This format is constant no matter which JABAWS web service is used.</p> +<div class="code bash highlight-default"><div class="highlight"><pre><span></span><span class="n">java</span> <span class="o">-</span><span class="n">jar</span> <span class="n">jabaws</span><span class="o">-</span><span class="nb">min</span><span class="o">-</span><span class="n">client</span><span class="o">.</span><span class="n">jar</span> <span class="o">-</span><span class="n">h</span><span class="o">=</span><span class="n">http</span><span class="p">:</span><span class="o">//</span><span class="n">myhost</span><span class="o">.</span><span class="n">compbio</span><span class="o">.</span><span class="n">ac</span><span class="o">.</span><span class="n">uk</span><span class="p">:</span><span class="mi">8080</span><span class="o">/</span><span class="n">jabaws</span> <span class="o">-</span><span class="n">s</span><span class="o">=</span><span class="n">MafftWS</span> <span class="o">-</span><span class="n">parameters</span> +</pre></div> +</div> +<p>The same client can be used to access JABAWS on different hosts. Just point the client to the host you want to use by changing the value of -h key.</p> +<p>For example you used <code class="docutils literal"><span class="pre">-h=http://myhost.compbio.ac.uk:8080/jabaws</span></code> server, now you want to use another server to <code class="docutils literal"><span class="pre">-h=http://mylabserver.myuni.edu</span></code>. This comes handy if your favorite server is off and you need to do the job yesterday.</p> +</div> +</div> + + + </div> + <div class="articleComments"> + + </div> + </div> + <footer> + + <div class="rst-footer-buttons" role="navigation" aria-label="footer navigation"> + + <a href="war.html" class="btn btn-neutral float-right" title="Web Application Archive (WAR)" accesskey="n" rel="next">Next <span class="fa fa-arrow-circle-right"></span></a> + + + <a href="included_tools.html" class="btn btn-neutral" title="Included Tools" accesskey="p" rel="prev"><span class="fa fa-arrow-circle-left"></span> Previous</a> + + </div> + + + <hr/> + + <div role="contentinfo"> + <p><a href="../">JABAWS 2.2</a> + © Copyright 2017, Peter Troshin, Alexander Sherstnev, Jim Procter, Alexey Drozdetskiy, Daniel Barton, Suzanne Duce, Fábio Madeira and Geoff Barton. + + </p> + </div> + Built with <a href="http://sphinx-doc.org/">Sphinx</a> using a <a href="https://github.com/snide/sphinx_rtd_theme">theme</a> provided by <a href="https://readthedocs.org">Read the Docs</a>. + +</footer> + </div> + </div> + + </section> + + </div> + + + + + + <script type="text/javascript"> + var DOCUMENTATION_OPTIONS = { + URL_ROOT:'./', + VERSION:'2.2', + LANGUAGE:'None', + COLLAPSE_INDEX:false, + FILE_SUFFIX:'.html', + HAS_SOURCE: true, + SOURCELINK_SUFFIX: '.txt' + }; + </script> + <script type="text/javascript" src="_static/jquery.js"></script> + <script type="text/javascript" src="_static/underscore.js"></script> + <script type="text/javascript" src="_static/doctools.js"></script> + + + + + + <script type="text/javascript" src="_static/js/theme.js"></script> + + + + + <script type="text/javascript"> + jQuery(function () { + SphinxRtdTheme.StickyNav.enable(); + }); + </script> + + +</body> +</html> \ No newline at end of file diff --git a/website/docs/develop.html b/website/docs/develop.html new file mode 100644 index 0000000..fb1d0f8 --- /dev/null +++ b/website/docs/develop.html @@ -0,0 +1,749 @@ + + +<!DOCTYPE html> +<!--[if IE 8]><html class="no-js lt-ie9" lang="en" > <![endif]--> +<!--[if gt IE 8]><!--> <html class="no-js" lang="en" > <!--<![endif]--> +<head> + <meta charset="utf-8"> + + <meta name="viewport" content="width=device-width, initial-scale=1.0"> + + <title>For Developers — JABAWS 2.2 documentation</title> + + + + + + + + + + + + + + + + + + <link rel="stylesheet" href="_static/css/theme.css" type="text/css" /> + + + + + + <link rel="index" title="Index" + href="genindex.html"/> + <link rel="search" title="Search" href="search.html"/> + <link rel="top" title="JABAWS 2.2 documentation" href="index.html"/> + <link rel="next" title="Usage Statistics" href="stats.html"/> + <link rel="prev" title="Advanced Usage" href="advanced.html"/> + + + <script src="_static/js/modernizr.min.js"></script> + +</head> + +<body class="wy-body-for-nav" role="document"> + + + <div class="wy-grid-for-nav"> + + + <nav data-toggle="wy-nav-shift" class="wy-nav-side"> + <div class="wy-side-scroll"> + <div class="wy-side-nav-search"> + + + + <a href="index.html" class="icon icon-home"> JABAWS + + + + </a> + + + + + <div class="version"> + 2.2 + </div> + + + + +<div role="search"> + <form id="rtd-search-form" class="wy-form" action="search.html" method="get"> + <input type="text" name="q" placeholder="Search docs" /> + <input type="hidden" name="check_keywords" value="yes" /> + <input type="hidden" name="area" value="default" /> + </form> +</div> + + + </div> + + <div class="wy-menu wy-menu-vertical" data-spy="affix" role="navigation" aria-label="main navigation"> + + + + + + + <p class="caption"><span class="caption-text">Contents:</span></p> +<ul class="current"> +<li class="toctree-l1"><a class="reference internal" href="getting_started.html">Getting Started</a></li> +<li class="toctree-l1"><a class="reference internal" href="included_tools.html">Included Tools</a></li> +<li class="toctree-l1"><a class="reference internal" href="client.html">Command Line Client (CLI)</a></li> +<li class="toctree-l1"><a class="reference internal" href="war.html">Web Application Archive (WAR)</a></li> +<li class="toctree-l1"><a class="reference internal" href="va.html">Virtual Appliance (VA)</a></li> +<li class="toctree-l1"><a class="reference internal" href="advanced.html">Advanced Usage</a></li> +<li class="toctree-l1 current"><a class="current reference internal" href="#">For Developers</a><ul> +<li class="toctree-l2"><a class="reference internal" href="#source-code">Source Code</a></li> +<li class="toctree-l2"><a class="reference internal" href="#the-api">The API</a></li> +<li class="toctree-l2"><a class="reference internal" href="#structure-of-the-project">Structure of the project</a></li> +<li class="toctree-l2"><a class="reference internal" href="#the-code-structure">The code structure</a></li> +<li class="toctree-l2"><a class="reference internal" href="#unit-testing">Unit Testing</a></li> +<li class="toctree-l2"><a class="reference internal" href="#accessing-jabaws-from-your-program">Accessing JABAWS from your program</a><ul> +<li class="toctree-l3"><a class="reference internal" href="#web-services-functions-overview">Web services functions overview</a></li> +<li class="toctree-l3"><a class="reference internal" href="#structure-of-the-template-command-line-client">Structure of the template command line client</a></li> +<li class="toctree-l3"><a class="reference internal" href="#connecting-to-jabaws">Connecting to JABAWS</a></li> +<li class="toctree-l3"><a class="reference internal" href="#aligning-sequences">Aligning Sequences</a></li> +<li class="toctree-l3"><a class="reference internal" href="#checking-the-status-of-the-calculation">Checking the status of the calculation</a></li> +<li class="toctree-l3"><a class="reference internal" href="#aligning-with-presets">Aligning with presets</a></li> +<li class="toctree-l3"><a class="reference internal" href="#aligning-with-custom-parameters">Aligning with custom parameters</a></li> +<li class="toctree-l3"><a class="reference internal" href="#writing-alignments-to-a-file">Writing alignments to a file</a></li> +<li class="toctree-l3"><a class="reference internal" href="#a-complete-client-example">A complete client example</a></li> +</ul> +</li> +<li class="toctree-l2"><a class="reference internal" href="#adding-new-web-services">Adding new web-services</a><ul> +<li class="toctree-l3"><a class="reference internal" href="#brief-guide">Brief Guide</a></li> +<li class="toctree-l3"><a class="reference internal" href="#building-web-services-artifacts">Building web services artifacts</a></li> +<li class="toctree-l3"><a class="reference internal" href="#preparing-distributives">Preparing Distributives</a></li> +</ul> +</li> +</ul> +</li> +<li class="toctree-l1"><a class="reference internal" href="stats.html">Usage Statistics</a></li> +<li class="toctree-l1"><a class="reference internal" href="citations.html">Citations</a></li> +<li class="toctree-l1"><a class="reference internal" href="changelog.html">Changelog</a></li> +</ul> + + + + </div> + </div> + </nav> + + <section data-toggle="wy-nav-shift" class="wy-nav-content-wrap"> + + + <nav class="wy-nav-top" role="navigation" aria-label="top navigation"> + + <i data-toggle="wy-nav-top" class="fa fa-bars"></i> + <a href="index.html">JABAWS</a> + + </nav> + + + + <div class="wy-nav-content"> + <div class="rst-content"> + + + + + + + + + + + + + + + + +<div role="navigation" aria-label="breadcrumbs navigation"> + + <ul class="wy-breadcrumbs"> + + <li><a href="index.html">Docs</a> »</li> + + <li>For Developers</li> + + + <li class="wy-breadcrumbs-aside"> + + + <a href="_sources/develop.rst.txt" rel="nofollow"> View page source</a> + + + </li> + + </ul> + + + <hr/> +</div> + <div role="main" class="document" itemscope="itemscope" itemtype="http://schema.org/Article"> + <div itemprop="articleBody"> + + <div class="section" id="for-developers"> +<h1>For Developers<a class="headerlink" href="#for-developers" title="Permalink to this headline">¶</a></h1> +<div class="section" id="source-code"> +<span id="jabaws-source"></span><h2>Source Code<a class="headerlink" href="#source-code" title="Permalink to this headline">¶</a></h2> +<div class="admonition note"> +<p class="first admonition-title">Note</p> +<p class="last">This is an open source project. If you want to contribute or report an issue have a look at our <a class="reference external" href="https://source.jalview.org/crucible/changelog/jabaws">Git-tracker</a>.</p> +</div> +<p>Publicly available Git repository: <a class="reference external" href="http://source.jalview.org/gitweb/?p=jabaws.git">http://source.jalview.org/gitweb/?p=jabaws.git</a></p> +<div class="code bash highlight-default"><div class="highlight"><pre><span></span><span class="n">git</span> <span class="n">clone</span> <span class="n">http</span><span class="p">:</span><span class="o">//</span><span class="n">source</span><span class="o">.</span><span class="n">jalview</span><span class="o">.</span><span class="n">org</span><span class="o">/</span><span class="n">git</span><span class="o">/</span><span class="n">jabaws</span><span class="o">.</span><span class="n">git</span> +</pre></div> +</div> +<hr class="docutils" /> +</div> +<div class="section" id="the-api"> +<span id="jabaws-api"></span><h2>The API<a class="headerlink" href="#the-api" title="Permalink to this headline">¶</a></h2> +<p><a class="reference external" href="http://www.compbio.dundee.ac.uk/jabaws/dm_javadoc/index.html">Data Model JavaDoc</a> - read this if your are coding against JABA Web Services</p> +<p><a class="reference external" href="http://www.compbio.dundee.ac.uk/jabaws/full_javadoc/index.html">Complete JavaDoc</a> - for developers who want to use JABAWS framework and use Engines and Executables directly</p> +<hr class="docutils" /> +</div> +<div class="section" id="structure-of-the-project"> +<span id="jabaws-structure"></span><h2>Structure of the project<a class="headerlink" href="#structure-of-the-project" title="Permalink to this headline">¶</a></h2> +<div class="line-block"> +<div class="line"><a class="reference internal" href="_images/folder-small.png"><img alt="folder" class="align-middle" src="_images/folder-small.png" style="width: 15px;" /></a> <em>binaries</em> contains native executables e.g. clustalw</div> +<div class="line-block"> +<div class="line"><a class="reference internal" href="_images/folder-small.png"><img alt="folder" class="align-middle" src="_images/folder-small.png" style="width: 15px;" /></a> <em>src</em> contains sources of native executables</div> +<div class="line"><a class="reference internal" href="_images/folder-small.png"><img alt="folder" class="align-middle" src="_images/folder-small.png" style="width: 15px;" /></a> <em>windows</em> contains pre-compiled Windows binaries</div> +<div class="line"><a class="reference internal" href="_images/folder-small.png"><img alt="folder" class="align-middle" src="_images/folder-small.png" style="width: 15px;" /></a> <em>compilebin.sh</em> the script to complile binaries</div> +<div class="line"><a class="reference internal" href="_images/folder-small.png"><img alt="folder" class="align-middle" src="_images/folder-small.png" style="width: 15px;" /></a> <em>setexecflag.sh</em> the script to set executable flag for the binaries</div> +</div> +<div class="line"><a class="reference internal" href="_images/folder-small.png"><img alt="folder" class="align-middle" src="_images/folder-small.png" style="width: 15px;" /></a> <em>conf</em> contains JABAWS configuration files</div> +<div class="line"><a class="reference internal" href="_images/folder-small.png"><img alt="folder" class="align-middle" src="_images/folder-small.png" style="width: 15px;" /></a> <em>ExecutionStatistics</em> the database for storing collected execution statistics</div> +<div class="line"><a class="reference internal" href="_images/folder-small.png"><img alt="folder" class="align-middle" src="_images/folder-small.png" style="width: 15px;" /></a> <em>jobsout</em> a default folder for temporary job directories</div> +<div class="line"><a class="reference internal" href="_images/folder-small.png"><img alt="folder" class="align-middle" src="_images/folder-small.png" style="width: 15px;" /></a> <em>statpages</em> the web pages for execution statistics display</div> +<div class="line"><a class="reference internal" href="_images/folder-small.png"><img alt="folder" class="align-middle" src="_images/folder-small.png" style="width: 15px;" /></a> <em>WEB-INF</em> default</div> +<div class="line"><a class="reference internal" href="_images/folder-small.png"><img alt="folder" class="align-middle" src="_images/folder-small.png" style="width: 15px;" /></a> <em>docs</em> contains the reStructuredText documentation files</div> +<div class="line"><a class="reference internal" href="_images/folder-small.png"><img alt="folder" class="align-middle" src="_images/folder-small.png" style="width: 15px;" /></a> <em>website</em> contains the JABAWS web pages</div> +<div class="line-block"> +<div class="line"><a class="reference internal" href="_images/folder-small.png"><img alt="folder" class="align-middle" src="_images/folder-small.png" style="width: 15px;" /></a> <em>archive</em> contains JABAWS packages, the WAR and JAR files</div> +</div> +<div class="line"><a class="reference internal" href="_images/folder-small.png"><img alt="folder" class="align-middle" src="_images/folder-small.png" style="width: 15px;" /></a> <em>datamodel</em> contains the JABAWS datamodel</div> +<div class="line"><a class="reference internal" href="_images/folder-small.png"><img alt="folder" class="align-middle" src="_images/folder-small.png" style="width: 15px;" /></a> <em>engine</em> contains the JABAWS engine - the code that abstract the execution environment and executes native binaries</div> +<div class="line"><a class="reference internal" href="_images/folder-small.png"><img alt="folder" class="align-middle" src="_images/folder-small.png" style="width: 15px;" /></a> <em>runner</em> contains the JABAWS runners - thin wrappers for native binaries</div> +<div class="line"><a class="reference internal" href="_images/folder-small.png"><img alt="folder" class="align-middle" src="_images/folder-small.png" style="width: 15px;" /></a> <em>webservices</em> contains the JABAWS SOAP web services</div> +<div class="line"><a class="reference internal" href="_images/folder-small.png"><img alt="folder" class="align-middle" src="_images/folder-small.png" style="width: 15px;" /></a> <em>testsrc</em> contains the JABAWS unit tests</div> +</div> +<hr class="docutils" /> +</div> +<div class="section" id="the-code-structure"> +<span id="jabaws-code"></span><h2>The code structure<a class="headerlink" href="#the-code-structure" title="Permalink to this headline">¶</a></h2> +<a class="reference internal image-reference" href="_images/ws-structure.png"><img alt="_images/ws-structure.png" class="align-left" src="_images/ws-structure.png" style="width: 267.9px; height: 393.29999999999995px;" /></a> +<p>Each source folder depends on the upper folders for compilation. For example, the datamodel is the top level folder so it has no other dependencies on other JABAWS code. The Engine level depends on the datamodel to compile etc. The web services folder is the bottom layer and depends on all the other source code.</p> +<p>So the JABAWS project is split into 4 layers. From bottom-up the first layer consists from the value classes used by all other layers of the hierarchy, in particular web services. So, to be able to use JABAWS one needs to have these classes. At the same time classes on this layer does not have any dependencies on the layers above.</p> +<p>The second layer contains code for execution of the wrappers, which are the abstraction describing native executables. JABAWS can execute tasks locally that is on the same machine as JVM and on the cluster. Thus currently code on this layer contain two engines. This layer depends on the layer underneath, the data model layer, but is completely independent from the code above.</p> +<p>The third layer consists of the wrappers for the native executables and classes to handle their configuration. It depends on the engines and the data model, but know nothing about the web services.</p> +<p>Finally, the upper layer contains the web services, that depend on all the layers below.</p> +<p>The layer isolation is archived though specially designed compilation task which is executed sequentially in several stages so that the first layer compiles before any other layers, second layer compiles after that and process continies before all the code is compiled. Any violation of the layer boundaries results in the compilation failure. Use Ant “Compile” or “Complile_with_debug” tasks to perform the staged compilation.</p> +<p>A client package contains only classes from data model layer and a simple web services client. Framework package is for anyone who want to use JABAWS framework for controlling native executables in local or cluster environments. Framework exclude the web services layer. Server package contains all the code.</p> +<hr class="docutils" /> +</div> +<div class="section" id="unit-testing"> +<span id="jabaws-tests"></span><h2>Unit Testing<a class="headerlink" href="#unit-testing" title="Permalink to this headline">¶</a></h2> +<p>JABAWS uses <a class="reference external" href="http://testng.org/doc/index.html">TestNG</a> framework for testing. The test results for the JABAWS package offered for download can be found at: <a class="reference external" href="http://www.compbio.dundee.ac.uk/user/www-jws2/tests/index.html">Test Results</a> +JABAWS uses TestNG for testing. There is a TestNG plugin available for Eclipse which has functionality similar to JUnit. However, no plugins are necessary to run the test cases, as testng jar is supplied with JABAWS together with an ant tasks to run the test cases.</p> +<p>Several testing groups are supported:</p> +<ul class="simple"> +<li>All tests (‘Test’)</li> +<li>Cluster tests (‘Run_cluster_dependent_test’)</li> +<li>Cluster independent tests (‘All_cluster_independent_tests’)</li> +<li>Windows only tests (‘All_cluster_independent_windows_only_tests’)</li> +<li>Performance and stability tests (‘Long_tests’)</li> +<li>Re-run failed tests (‘Rerun_failed_tests’)</li> +<li>Run custom test (‘CustomTest’)</li> +</ul> +<p>To run the tests you need to download all sources from repository. Once you have done that, enter into the command line mode, change directory to the project directory and type:</p> +<div class="code bash highlight-default"><div class="highlight"><pre><span></span><span class="n">ant</span> <span class="o">-</span><span class="n">f</span> <span class="n">build</span><span class="o">.</span><span class="n">xml</span> <span class="o"><</span><span class="n">test</span> <span class="n">group</span> <span class="n">name</span><span class="o">></span> +</pre></div> +</div> +<p>Make sure you have <a class="reference external" href="http://ant.apache.org/">Apache Ant</a> installed and path to ant executable is defined in your path environmental variable. Replace test group name with the one of the names given in the list above to run required group of tests e.g for running cluster only tests use the following command:</p> +<div class="code bash highlight-default"><div class="highlight"><pre><span></span><span class="n">ant</span> <span class="o">-</span><span class="n">f</span> <span class="n">build</span><span class="o">.</span><span class="n">xml</span> <span class="n">Run_cluster_dependent_test</span> +</pre></div> +</div> +<p>If you work under Linux you could use a simple script from the root folder of repository called <code class="docutils literal"><span class="pre">runtests.sh</span></code>. This script simply contains a collection of the test commands described above and paths to java home directory and an ant executable, which you can define once for your system and then reuse.</p> +<p>A handy feature of TestNG is its ability to re-run failed tests. Failed test ant file is stored in <code class="docutils literal"><span class="pre">test-output/testng-failed.xml</span></code>. and is used in the ant task called <code class="docutils literal"><span class="pre">Rerun_failed_tests</span></code>. So re-running failed tests requires no more work than running any other test group and could be accomplished with the command:</p> +<div class="code bash highlight-default"><div class="highlight"><pre><span></span><span class="n">ant</span> <span class="o">-</span><span class="n">f</span> <span class="n">build</span><span class="o">.</span><span class="n">xml</span> <span class="n">Rerun_failed_tests</span> +</pre></div> +</div> +<p>CustomTest runs the test defined in the project root directory file called <code class="docutils literal"><span class="pre">temp-testng-customsuite.xml</span></code>. This file is generated by TestNG plugin every time you run the test from Eclipse. Thus an easy way to run a test in a different environment is to run it from Eclipse first and then from ant using a custom test procedure.</p> +<p>For cluster execution make sure that the property <code class="docutils literal"><span class="pre">LD_LIBRARY_PATH</span></code> defined in build.xml points to cluster engine LD libraries directory in your local system.</p> +<hr class="docutils" /> +</div> +<div class="section" id="accessing-jabaws-from-your-program"> +<span id="jabaws-conn-services"></span><h2>Accessing JABAWS from your program<a class="headerlink" href="#accessing-jabaws-from-your-program" title="Permalink to this headline">¶</a></h2> +<div class="section" id="web-services-functions-overview"> +<span id="jabaws-conn-functions"></span><h3>Web services functions overview<a class="headerlink" href="#web-services-functions-overview" title="Permalink to this headline">¶</a></h3> +<p>All JABAWS multiple sequence alignment web services comply to the same interface, thus the function described below are available from all the services.</p> +<p>Functions for initiating the alignment</p> +<div class="code bash highlight-default"><div class="highlight"><pre><span></span><span class="n">String</span> <span class="nb">id</span> <span class="o">=</span> <span class="n">align</span><span class="p">(</span><span class="n">List</span><span class="o"><</span><span class="n">FastaSequence</span><span class="o">></span> <span class="nb">list</span><span class="p">)</span> +<span class="n">String</span> <span class="nb">id</span> <span class="o">=</span> <span class="n">customAlign</span><span class="p">(</span><span class="n">List</span><span class="o"><</span><span class="n">FastaSequence</span><span class="o">></span> <span class="n">sequenceList</span><span class="p">,</span> <span class="n">List</span><span class="o"><</span><span class="n">Option</span><span class="o">></span> <span class="n">optionList</span><span class="p">)</span> +<span class="n">String</span> <span class="nb">id</span> <span class="o">=</span> <span class="n">presetAlign</span><span class="p">(</span><span class="n">List</span><span class="o"><</span><span class="n">FastaSequence</span><span class="o">></span> <span class="n">sequenceList</span><span class="p">,</span> <span class="n">Preset</span> <span class="n">preset</span><span class="p">)</span> +</pre></div> +</div> +<p>Functions pertaining to job monitoring and control</p> +<div class="code bash highlight-default"><div class="highlight"><pre><span></span><span class="n">JobStatus</span> <span class="n">status</span> <span class="o">=</span> <span class="n">getJobStatus</span><span class="p">(</span><span class="n">String</span> <span class="nb">id</span><span class="p">)</span> +<span class="n">Alignment</span> <span class="n">al</span> <span class="o">=</span> <span class="n">getResult</span><span class="p">(</span><span class="n">String</span> <span class="nb">id</span><span class="p">)</span> +<span class="n">boolean</span> <span class="n">cancelled</span> <span class="o">=</span> <span class="n">cancelJob</span><span class="p">(</span><span class="n">String</span> <span class="nb">id</span><span class="p">)</span> +<span class="n">ChunkHolder</span> <span class="n">chunk</span> <span class="o">=</span> <span class="n">pullExecStatistics</span><span class="p">(</span><span class="n">String</span> <span class="nb">id</span><span class="p">,</span> <span class="n">long</span> <span class="n">marker</span><span class="p">)</span> +</pre></div> +</div> +<p>Functions relating to service features discovery</p> +<div class="code bash highlight-default"><div class="highlight"><pre><span></span><span class="n">RunnerConfig</span> <span class="n">rc</span> <span class="o">=</span> <span class="n">getRunnerOptions</span><span class="p">()</span> +<span class="n">Limit</span> <span class="n">limit</span> <span class="o">=</span> <span class="n">getLimit</span><span class="p">(</span><span class="n">String</span> <span class="n">name</span><span class="p">)</span> +<span class="n">LimitsManager</span> <span class="n">lm</span> <span class="o">=</span> <span class="n">getLimits</span><span class="p">()</span> +<span class="n">PresetManager</span> <span class="n">pm</span> <span class="o">=</span> <span class="n">getPresets</span><span class="p">()</span> +</pre></div> +</div> +<p>Please refer to a Data Model JavaDoc for a detailed description of each methods.</p> +<hr class="docutils" /> +</div> +<div class="section" id="structure-of-the-template-command-line-client"> +<span id="jabaws-conn-functions2"></span><h3>Structure of the template command line client<a class="headerlink" href="#structure-of-the-template-command-line-client" title="Permalink to this headline">¶</a></h3> +<table border="1" class="docutils"> +<colgroup> +<col width="25%" /> +<col width="75%" /> +</colgroup> +<thead valign="bottom"> +<tr class="row-odd"><th class="head">Packages</th> +<th class="head">Classes and Interfaces</th> +</tr> +</thead> +<tbody valign="top"> +<tr class="row-even"><td>compbio.data.msa</td> +<td>MsaWS the interface for all multiple sequence alignment web services</td> +</tr> +<tr class="row-odd"><td>compbio.data.sequence</td> +<td>JABAWS data types</td> +</tr> +<tr class="row-even"><td>compbio.metadata</td> +<td>JABAWS meta data types</td> +</tr> +<tr class="row-odd"><td>compbio.ws.client</td> +<td>JABAWS command line client</td> +</tr> +</tbody> +</table> +<p>Additional utility libraries that this client depend upon is the compbio-util-1.3.jar and compbio-annotation-1.0.jar.</p> +<p>Please refer to a <a class="reference external" href="http://www.compbio.dundee.ac.uk/jabaws/dm_javadoc/index.html">Data Model JavaDoc</a> for a detailed description of each class and its methods.</p> +<hr class="docutils" /> +</div> +<div class="section" id="connecting-to-jabaws"> +<span id="jabaws-conn-conn"></span><h3>Connecting to JABAWS<a class="headerlink" href="#connecting-to-jabaws" title="Permalink to this headline">¶</a></h3> +<p>For a complete working example of JABAWS command line client please see compbio.ws.client.Jws2Client class. JABAWS command line client source code is available from the <a class="reference external" href="download.jsp">download page</a>. Please note that for now all the examples are in Java, other languages will follow if there is sufficient demand.</p> +<p>Download a binary JABAWS client. Add the client to the class path. The following code excerpt will connect your program to Clustal web service deployed in the University of Dundee.</p> +<div class="highlight-java"><div class="highlight"><pre><span></span><span class="kn">import</span> <span class="nn">java.net.URL</span><span class="o">;</span> +<span class="kn">import</span> <span class="nn">javax.xml.namespace.QName</span><span class="o">;</span> +<span class="kn">import</span> <span class="nn">javax.xml.ws.Service</span><span class="o">;</span> +<span class="c1">// (...)</span> +<span class="n">String</span> <span class="n">qualifiedName</span> <span class="o">=</span> <span class="s">"http://msa.data.compbio/01/01/2010/"</span><span class="o">;</span> +<span class="n">URL</span> <span class="n">url</span> <span class="o">=</span> <span class="k">new</span> <span class="n">URL</span><span class="o">(</span><span class="s">"http://www.compbio.dundee.ac.uk/jabaws/ClustalWS?wsdl"</span><span class="o">);</span> +<span class="n">QName</span> <span class="n">qname</span> <span class="o">=</span> <span class="k">new</span> <span class="n">QName</span><span class="o">(,</span> <span class="s">"ClustalWS"</span><span class="o">);</span> +<span class="n">Service</span> <span class="n">serv</span> <span class="o">=</span> <span class="n">Service</span><span class="o">.</span><span class="na">create</span><span class="o">(</span><span class="n">url</span><span class="o">,</span> <span class="n">qname</span><span class="o">);</span> +<span class="n">MsaWS</span> <span class="n">msaws</span> <span class="o">=</span> <span class="n">serv</span><span class="o">.</span><span class="na">getPort</span><span class="o">(</span><span class="k">new</span> <span class="n">QName</span><span class="o">(</span><span class="n">qualifiedName</span><span class="o">,</span> <span class="s">"ClustalWSPort"</span><span class="o">),</span> +<span class="n">MsaWS</span><span class="o">.</span><span class="na">class</span><span class="o">);</span> +</pre></div> +</div> +<p>Line 1 makes a qualified name for JABA web services.</p> +<p>Line 2 constructs the URL to the web services WSDL.</p> +<p>Line 3 makes a qualified name instance for Clustal JABA web service.</p> +<p>Line 4 creates a service instance.</p> +<p>Line 5 makes a connection to the server.</p> +<p>A more generic connection method would look like this</p> +<div class="highlight-java"><div class="highlight"><pre><span></span><span class="kn">import</span> <span class="nn">java.net.URL</span><span class="o">;</span> +<span class="kn">import</span> <span class="nn">javax.xml.namespace.QName</span><span class="o">;</span> +<span class="kn">import</span> <span class="nn">javax.xml.ws.Service</span><span class="o">;</span> +<span class="kn">import</span> <span class="nn">compbio.ws.client.Services</span> +<span class="c1">// (...)</span> +<span class="n">String</span> <span class="n">qualifiedServiceName</span> <span class="o">=</span> <span class="s">"http://msa.data.compbio/01/01/2010/"</span><span class="o">;</span> +<span class="n">String</span> <span class="n">host</span> <span class="o">=</span> <span class="s">"http://www.compbio.dundee.ac.uk/jabaws"</span><span class="o">;</span> +<span class="c1">// In real life the service name can come from args</span> +<span class="n">Services</span> <span class="n">clustal</span> <span class="o">=</span> <span class="n">Services</span><span class="o">.</span><span class="na">ClustalWS</span><span class="o">;</span> +<span class="n">URL</span> <span class="n">url</span> <span class="o">=</span> <span class="k">new</span> <span class="n">URL</span><span class="o">(</span><span class="n">host</span> <span class="o">+</span> <span class="s">"/"</span> <span class="o">+</span> <span class="n">clustal</span><span class="o">.</span><span class="na">toString</span><span class="o">()</span> <span class="o">+</span> <span class="s">"?wsdl"</span><span class="o">);</span> +<span class="n">QName</span> <span class="n">qname</span> <span class="o">=</span> <span class="k">new</span> <span class="n">QName</span><span class="o">(</span><span class="n">qualifiedServiceName</span><span class="o">,</span> <span class="n">clustal</span><span class="o">.</span><span class="na">toString</span><span class="o">());</span> +<span class="n">Service</span> <span class="n">serv</span> <span class="o">=</span> <span class="n">Service</span><span class="o">.</span><span class="na">create</span><span class="o">(</span><span class="n">url</span><span class="o">,</span> <span class="n">qname</span><span class="o">);</span> +<span class="n">MsaWS</span> <span class="n">msaws</span> <span class="o">=</span> <span class="n">serv</span><span class="o">.</span><span class="na">getPort</span><span class="o">(</span><span class="k">new</span> <span class="n">QName</span><span class="o">(</span><span class="n">qualifiedServiceName</span><span class="o">,</span> <span class="n">clustal</span> <span class="o">+</span> <span class="s">"Port"</span><span class="o">),</span> <span class="n">MsaWS</span><span class="o">.</span><span class="na">class</span><span class="o">);</span> +</pre></div> +</div> +<p>Where Services is enumeration of JABAWS web services. All JABAWS multiple sequence alignment methods confirm to MsaWS specification, thus from the caller point of view all JABAWS web services can be represented by MsaWS interface. The full documentation of MsaWS functions is available from the <a class="reference external" href="http://www.compbio.dundee.ac.uk/jabaws/full_javadoc/index.html">JavaDoc</a>.</p> +<hr class="docutils" /> +</div> +<div class="section" id="aligning-sequences"> +<span id="jabaws-conn-aln"></span><h3>Aligning Sequences<a class="headerlink" href="#aligning-sequences" title="Permalink to this headline">¶</a></h3> +<p>Given that <em>msaws</em> is web service proxy, created as described in “Connecting to JABAWS” section, the actual alignment can be obtained as follows:</p> +<div class="code bash highlight-default"><div class="highlight"><pre><span></span><span class="n">List</span><span class="o"><</span><span class="n">FastaSequence</span><span class="o">></span> <span class="n">fastalist</span> <span class="o">=</span> <span class="n">SequenceUtil</span><span class="o">.</span><span class="n">readFasta</span><span class="p">(</span><span class="n">new</span> <span class="n">FileInputStream</span><span class="p">(</span><span class="n">file</span><span class="p">));</span> +<span class="n">String</span> <span class="n">jobId</span> <span class="o">=</span> <span class="n">msaws</span><span class="o">.</span><span class="n">align</span><span class="p">(</span><span class="n">fastalist</span><span class="p">);</span> +<span class="n">Alignment</span> <span class="n">alignment</span> <span class="o">=</span> <span class="n">msaws</span><span class="o">.</span><span class="n">getResult</span><span class="p">(</span><span class="n">jobId</span><span class="p">);</span> +<span class="n">Line</span> <span class="n">one</span> <span class="n">loads</span> <span class="n">FASTA</span> <span class="n">sequence</span> <span class="kn">from</span> <span class="nn">the</span> <span class="n">file</span><span class="o">.</span> +</pre></div> +</div> +<p>Line two submits them to web service represented by msaws proxy.</p> +<p>Line three retrieves the alignment from a web service. This line will block the execution until the result is available. Use this with caution. In general, you should make sure that the calculation has been completed before attempting retrieving results. This is to avoid keeping the connection to the server on hold for a prolonged periods of time. While this may be ok with your local server, our public server (www.compbio.dundee.ac.uk/jabaws) will not let you hold the connection for longer than 10 minutes. This is done to prevent excessive load on the server. The next section describes how to check the status of the calculation. +Methods and classes mentioned in the excerpt are available from the JABAWS client library.</p> +<hr class="docutils" /> +</div> +<div class="section" id="checking-the-status-of-the-calculation"> +<span id="jabaws-conn-status"></span><h3>Checking the status of the calculation<a class="headerlink" href="#checking-the-status-of-the-calculation" title="Permalink to this headline">¶</a></h3> +<p>You may have noticed that there was no pause between submitting the job and retrieving of the results. This is because getResult(jobId) method block the processing until the calculation is completed. However, taking into account that the connection holds server resources, our public server (www.compbio.dundee.ac.uk/jabaws) is configured to reset the connection after 10 minutes of waiting. To work around the connection reset you are encouraged to check whether the calculation has been completed before accessing the results. You can do it like this:</p> +<div class="highlight-java"><div class="highlight"><pre><span></span><span class="k">while</span> <span class="o">(</span><span class="n">msaws</span><span class="o">.</span><span class="na">getJobStatus</span><span class="o">(</span><span class="n">jobId</span><span class="o">)</span> <span class="o">!=</span> <span class="n">JobStatus</span><span class="o">.</span><span class="na">FINISHED</span><span class="o">)</span> <span class="o">{</span> + <span class="n">Thread</span><span class="o">.</span><span class="na">sleep</span><span class="o">(</span><span class="mi">2000</span><span class="o">);</span> <span class="c1">// wait two seconds, then recheck the status</span> +<span class="o">}</span> +</pre></div> +</div> +<hr class="docutils" /> +</div> +<div class="section" id="aligning-with-presets"> +<span id="jabaws-conn-aln-presets"></span><h3>Aligning with presets<a class="headerlink" href="#aligning-with-presets" title="Permalink to this headline">¶</a></h3> +<div class="code bash highlight-default"><div class="highlight"><pre><span></span><span class="n">PresetManager</span> <span class="n">presetman</span> <span class="o">=</span> <span class="n">msaws</span><span class="o">.</span><span class="n">getPresets</span><span class="p">();</span> +<span class="n">Preset</span> <span class="n">preset</span> <span class="o">=</span> <span class="n">presetman</span><span class="o">.</span><span class="n">getPresetByName</span><span class="p">(</span><span class="n">presetName</span><span class="p">);</span> +<span class="n">List</span><span class="o"><</span><span class="n">FastaSequence</span><span class="o">></span> <span class="n">fastalist</span> <span class="o">=</span> <span class="n">SequenceUtil</span><span class="o">.</span><span class="n">readFasta</span><span class="p">(</span><span class="n">new</span> <span class="n">FileInputStream</span><span class="p">(</span><span class="n">file</span><span class="p">));</span> +<span class="n">String</span> <span class="n">jobId</span> <span class="o">=</span> <span class="n">msaws</span><span class="o">.</span><span class="n">presetAlign</span><span class="p">(</span><span class="n">fastalist</span><span class="p">,</span> <span class="n">preset</span><span class="p">);</span> +<span class="n">Alignment</span> <span class="n">alignment</span> <span class="o">=</span> <span class="n">msaws</span><span class="o">.</span><span class="n">getResult</span><span class="p">(</span><span class="n">jobId</span><span class="p">);</span> +</pre></div> +</div> +<p>Line one obtains the lists of presets supported by a web service.</p> +<p>Line two return a particular Preset by its name.</p> +<p>Lines three to five are doing the same job as in the <a class="reference external" href="develop.html#aligning-sequences">first aligning sequences example</a>.</p> +<hr class="docutils" /> +</div> +<div class="section" id="aligning-with-custom-parameters"> +<span id="jabaws-conn-aln-params"></span><h3>Aligning with custom parameters<a class="headerlink" href="#aligning-with-custom-parameters" title="Permalink to this headline">¶</a></h3> +<div class="code bash highlight-default"><div class="highlight"><pre><span></span><span class="n">RunnerConfig</span> <span class="n">options</span> <span class="o">=</span> <span class="n">msaws</span><span class="o">.</span><span class="n">getRunnerOptions</span><span class="p">();</span> +<span class="n">Argument</span> <span class="n">matrix</span> <span class="o">=</span> <span class="n">options</span><span class="o">.</span><span class="n">getArgument</span><span class="p">(</span><span class="s2">"MATRIX"</span><span class="p">);</span> +<span class="n">matrix</span><span class="o">.</span><span class="n">setValue</span><span class="p">(</span><span class="s2">"PAM300"</span><span class="p">);</span> +<span class="n">Argument</span> <span class="n">gapopenpenalty</span> <span class="o">=</span> <span class="n">options</span><span class="o">.</span><span class="n">getArgument</span><span class="p">(</span><span class="s2">"GAPOPEN"</span><span class="p">);</span> +<span class="n">gapopenpenalty</span><span class="o">.</span><span class="n">setValue</span><span class="p">(</span><span class="s2">"20"</span><span class="p">);</span> +<span class="n">List</span><span class="o"><</span><span class="n">Argument</span><span class="o">></span> <span class="n">arguments</span> <span class="o">=</span> <span class="n">new</span> <span class="n">ArrayList</span><span class="o"><</span><span class="n">Argument</span><span class="o">></span><span class="p">();</span> +<span class="n">arguments</span><span class="o">.</span><span class="n">add</span><span class="p">(</span><span class="n">matrix</span><span class="p">);</span> <span class="n">arguments</span><span class="o">.</span><span class="n">add</span><span class="p">(</span><span class="n">gapopenpenalty</span><span class="p">);</span> +<span class="n">List</span><span class="o"><</span><span class="n">FastaSequence</span><span class="o">></span> <span class="n">fastalist</span> <span class="o">=</span> <span class="n">SequenceUtil</span><span class="o">.</span><span class="n">readFasta</span><span class="p">(</span><span class="n">new</span> <span class="n">FileInputStream</span><span class="p">(</span><span class="n">file</span><span class="p">));</span> +<span class="n">String</span> <span class="n">jobId</span> <span class="o">=</span> <span class="n">msaws</span><span class="o">.</span><span class="n">customAlign</span><span class="p">(</span><span class="n">fastalist</span><span class="p">,</span> <span class="n">arguments</span><span class="p">);</span> +<span class="n">Alignment</span> <span class="n">alignment</span> <span class="o">=</span> <span class="n">msaws</span><span class="o">.</span><span class="n">getResult</span><span class="p">(</span><span class="n">jobId</span><span class="p">);</span> +</pre></div> +</div> +<p>Line one obtains the <code class="docutils literal"><span class="pre">RunnerConfig</span></code> object that holds information on supported parameters and their values</p> +<p>Line two retrieve a particular parameter from the holder by its name.</p> +<p>Lines three sets a value to this parameter which will be used in the calculation.</p> +<p>Line four and five do the same but for another parameter.</p> +<p>Line six makes a List to hold the parameters.</p> +<p>Line seven puts the parameters into that list.</p> +<p>Line eight and ten is the same as in previous examples.</p> +<p>Line nine submit an alignment request with the sequences and the parameters.</p> +<p>The names of all the parameters supported by a web service e.g. “PAM300” can be obtained using <code class="docutils literal"><span class="pre">options.getArguments()</span></code> method. Further details on the methods available from <code class="docutils literal"><span class="pre">RunnerConfig</span></code> object are available from the JavaDoc.</p> +<hr class="docutils" /> +</div> +<div class="section" id="writing-alignments-to-a-file"> +<span id="jabaws-conn-aln-file"></span><h3>Writing alignments to a file<a class="headerlink" href="#writing-alignments-to-a-file" title="Permalink to this headline">¶</a></h3> +<p>There is a utility method in the client library that does exactly that.</p> +<div class="highlight-java"><div class="highlight"><pre><span></span><span class="n">Alignment</span> <span class="n">alignment</span> <span class="o">=</span> <span class="n">align</span><span class="o">(...)</span> +<span class="n">FileOutputStream</span> <span class="n">outStream</span> <span class="o">=</span> <span class="k">new</span> <span class="n">FileOutputStream</span><span class="o">(</span><span class="n">file</span><span class="o">);</span> +<span class="n">ClustalAlignmentUtil</span><span class="o">.</span><span class="na">writeClustalAlignment</span><span class="o">(</span><span class="n">outStream</span><span class="o">,</span> <span class="n">align</span><span class="o">);</span> +</pre></div> +</div> +<hr class="docutils" /> +</div> +<div class="section" id="a-complete-client-example"> +<span id="jabaws-conn-aln-example"></span><h3>A complete client example<a class="headerlink" href="#a-complete-client-example" title="Permalink to this headline">¶</a></h3> +<p>Finally, a complete example of the program that connects to JABAWS Clustal service and aligns sequences using one of the Clustal web service presets. All you need for this to work is a <a class="reference external" href="download.jsp#client">JABAWS CLI client</a>. Please make sure that the client is in the Java class path before running this example.</p> +<div class="highlight-java"><div class="highlight"><pre><span></span><span class="kn">import</span> <span class="nn">java.io.ByteArrayInputStream</span><span class="o">;</span> +<span class="kn">import</span> <span class="nn">java.io.FileNotFoundException</span><span class="o">;</span> +<span class="kn">import</span> <span class="nn">java.io.IOException</span><span class="o">;</span> +<span class="kn">import</span> <span class="nn">java.net.URL</span><span class="o">;</span> +<span class="kn">import</span> <span class="nn">java.util.List</span><span class="o">;</span> + +<span class="kn">import</span> <span class="nn">javax.xml.namespace.QName</span><span class="o">;</span> +<span class="kn">import</span> <span class="nn">javax.xml.ws.Service</span><span class="o">;</span> + +<span class="kn">import</span> <span class="nn">compbio.data.msa.MsaWS</span><span class="o">;</span> +<span class="kn">import</span> <span class="nn">compbio.data.sequence.Alignment</span><span class="o">;</span> +<span class="kn">import</span> <span class="nn">compbio.data.sequence.FastaSequence</span><span class="o">;</span> +<span class="kn">import</span> <span class="nn">compbio.data.sequence.SequenceUtil</span><span class="o">;</span> +<span class="kn">import</span> <span class="nn">compbio.metadata.JobSubmissionException</span><span class="o">;</span> +<span class="kn">import</span> <span class="nn">compbio.metadata.LimitExceededException</span><span class="o">;</span> +<span class="kn">import</span> <span class="nn">compbio.metadata.Preset</span><span class="o">;</span> +<span class="kn">import</span> <span class="nn">compbio.metadata.PresetManager</span><span class="o">;</span> +<span class="kn">import</span> <span class="nn">compbio.metadata.ResultNotAvailableException</span><span class="o">;</span> +<span class="kn">import</span> <span class="nn">compbio.metadata.UnsupportedRuntimeException</span><span class="o">;</span> +<span class="kn">import</span> <span class="nn">compbio.metadata.WrongParameterException</span><span class="o">;</span> + +<span class="kd">public</span> <span class="kd">class</span> <span class="nc">Example</span> <span class="o">{</span> + + <span class="cm">/*</span> +<span class="cm"> * Input sequences for alignment</span> +<span class="cm"> */</span> + <span class="kd">static</span> <span class="kd">final</span> <span class="n">String</span> <span class="n">input</span> <span class="o">=</span> <span class="s">">Foo\r\n"</span> + <span class="o">+</span> <span class="s">"MTADGPRELLQLRAAVRHRPQDFVAWLMLADAELGMGDTTAGEMAVQRGLALHPGHPEAVARLGR"</span> + <span class="o">+</span> <span class="s">"VRWTQQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDAGQAEAAAAAYTRAHQLLPEEPYITAQ"</span> + <span class="o">+</span> <span class="s">"LLNWRRRLCDWRALDVLSAQVRAAVAQGVGAVEPFAFLSEDASAAEQLACARTRAQAIAASVRPL"</span> + <span class="o">+</span> <span class="s">"APTRVRSKGPLRVGFVSNGFGAHPTGLLTVALFEALQRRQPDLQMHLFATSGDDGSTLRTRLAQA"</span> + <span class="o">+</span> <span class="s">"STLHDVTALGHLATAKHIRHHGIDLLFDLRGWGGGGRPEVFALRPAPVQVNWLAYPGTSGAPWMD"</span> + <span class="o">+</span> <span class="s">"YVLGDAFALPPALEPFYSEHVLRLQGAFQPSDTSRVVAEPPSRTQCGLPEQGVVLCCFNNSYKLN"</span> + <span class="o">+</span> <span class="s">"PQSMARMLAVLREVPDSVLWLLSGPGEADARLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHAD"</span> + <span class="o">+</span> <span class="s">"LFLDTHPYNAHTTASDALWTGCPVLTTPGETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALAS"</span> + <span class="o">+</span> <span class="s">"DPAALTALHARVDVLRRESGVFEMDGFADDFGALLQALARRHGWLGI\r\n"</span> + <span class="o">+</span> <span class="s">"\r\n"</span> + <span class="o">+</span> <span class="s">">Bar\r\n"</span> + <span class="o">+</span> <span class="s">"MGDTTAGEMAVQRGLALHQQRHAEAAVLLQQASDAAPEHPGIALWLHALEDAGQAEAAAAYTRAH"</span> + <span class="o">+</span> <span class="s">"QLLPEEPYITAQLLNAVAQGVGAVEPFAFLSEDASAAESVRPLAPTRVRSKGPLRVGFVSNGFGA"</span> + <span class="o">+</span> <span class="s">"HPTGLLTVALFEALQRRQPDLQMHLFATSGDDGSTLRTRLAQASTLHDVTALGHLATAKHIRHHG"</span> + <span class="o">+</span> <span class="s">"IDLLFDLRGWGGGGRPEVFALRPAPVQVNWLAYPGTSGAPWMDYVLGDAFALPPALEPFYSEHVL"</span> + <span class="o">+</span> <span class="s">"RLQGAFQPSDTSRVVAEPPSRTQCGLPEQGVVLCCFNNSYKLNPQSMARMLAVLREVPDSVLWLL"</span> + <span class="o">+</span> <span class="s">"SGPGEADARLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHADLFLDTHPYNAHTTASDALWTGC"</span> + <span class="o">+</span> <span class="s">"PVLTTPGETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALASDPAALTALHARVDVLRRESGV"</span> + <span class="o">+</span> <span class="s">"FEMDGFADDFGALLQALARRHGWLGI\r\n"</span> + <span class="o">+</span> <span class="s">"\r\n"</span> + <span class="o">+</span> <span class="s">">Friends\r\n"</span> + <span class="o">+</span> <span class="s">"MTADGPRELLQLRAAVRHRPQDVAWLMLADAELGMGDTTAGEMAVQRGLALHPGHPEAVARLGRV"</span> + <span class="o">+</span> <span class="s">"RWTQQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDHQLLPEEPYITAQLDVLSAQVRAAVAQG"</span> + <span class="o">+</span> <span class="s">"VGAVEPFAFLSEDASAAEQLACARTRAQAIAASVRPLAPTRVRSKGPLRVGFVSNGFGAHPTGLL"</span> + <span class="o">+</span> <span class="s">"TVALFEALQRRQPDLQMHLFATSGDDGSTLRTRLAQASTLHDVTALGHLATAKHIRHHGIDLLFD"</span> + <span class="o">+</span> <span class="s">"LRGWGGGGRPEVFALRPAPVQVNWLAYPGTSGAPWMDYVLGDAFALPPALEPFYSEHVLRLQGAF"</span> + <span class="o">+</span> <span class="s">"QPSDTSRVVAEPPSRTQCGLPEQGVVLCCFNNSYKLNPQSMARMLAVLREVPDSVLWLLSGPGEA"</span> + <span class="o">+</span> <span class="s">"DARLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHADLFLDTHPYNAHTTASDALWTGCPVLTTP"</span> + <span class="o">+</span> <span class="s">"GETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALASDPAALTALHARVDVLRRESI"</span><span class="o">;</span> + + <span class="kd">public</span> <span class="kd">static</span> <span class="kt">void</span> <span class="nf">main</span><span class="o">(</span><span class="n">String</span><span class="o">[]</span> <span class="n">args</span><span class="o">)</span> <span class="kd">throws</span> <span class="n">UnsupportedRuntimeException</span><span class="o">,</span> + <span class="n">LimitExceededException</span><span class="o">,</span> <span class="n">JobSubmissionException</span><span class="o">,</span> + <span class="n">WrongParameterException</span><span class="o">,</span> <span class="n">FileNotFoundException</span><span class="o">,</span> <span class="n">IOException</span><span class="o">,</span> + <span class="n">ResultNotAvailableException</span><span class="o">,</span> <span class="n">InterruptedException</span> <span class="o">{</span> + + <span class="n">String</span> <span class="n">qualifiedServiceName</span> <span class="o">=</span> <span class="s">"http://msa.data.compbio/01/01/2010/"</span><span class="o">;</span> + + <span class="cm">/* Make a URL pointing to web service WSDL */</span> + <span class="n">URL</span> <span class="n">url</span> <span class="o">=</span> <span class="k">new</span> <span class="n">URL</span><span class="o">(</span><span class="s">"http://www.compbio.dundee.ac.uk/jabaws/ClustalWS?wsdl"</span><span class="o">);</span> + + <span class="cm">/*</span> +<span class="cm"> * If you are making a client that connects to different web services</span> +<span class="cm"> * you can use something like this:</span> +<span class="cm"> */</span> + <span class="c1">// URL url = new URL(host + "/" + Services.ClustalWS.toString() +</span> + <span class="c1">// "?wsdl");</span> + + <span class="n">QName</span> <span class="n">qname</span> <span class="o">=</span> <span class="k">new</span> <span class="n">QName</span><span class="o">(</span><span class="n">qualifiedServiceName</span><span class="o">,</span> <span class="s">"ClustalWS"</span><span class="o">);</span> + <span class="n">Service</span> <span class="n">serv</span> <span class="o">=</span> <span class="n">Service</span><span class="o">.</span><span class="na">create</span><span class="o">(</span><span class="n">url</span><span class="o">,</span> <span class="n">qname</span><span class="o">);</span> + <span class="cm">/*</span> +<span class="cm"> * Multiple sequence alignment interface for Clustal web service</span> +<span class="cm"> * instance</span> +<span class="cm"> */</span> + <span class="n">MsaWS</span> <span class="n">msaws</span> <span class="o">=</span> <span class="n">serv</span><span class="o">.</span><span class="na">getPort</span><span class="o">(</span><span class="k">new</span> <span class="n">QName</span><span class="o">(</span><span class="n">qualifiedServiceName</span><span class="o">,</span> <span class="s">"ClustalWS"</span> + <span class="o">+</span> <span class="s">"Port"</span><span class="o">),</span> <span class="n">MsaWS</span><span class="o">.</span><span class="na">class</span><span class="o">);</span> + + <span class="cm">/* Get the list of available presets */</span> + <span class="n">PresetManager</span> <span class="n">presetman</span> <span class="o">=</span> <span class="n">msaws</span><span class="o">.</span><span class="na">getPresets</span><span class="o">();</span> + + <span class="cm">/* Get the Preset object by preset name */</span> + <span class="n">Preset</span> <span class="n">preset</span> <span class="o">=</span> <span class="n">presetman</span> + <span class="o">.</span><span class="na">getPresetByName</span><span class="o">(</span><span class="s">"Disable gap weighting (Speed-oriented)"</span><span class="o">);</span> + + <span class="cm">/*</span> +<span class="cm"> * Load sequences in FASTA format from the file You can use something</span> +<span class="cm"> * like new FileInputStream(<filename>) to load sequence from the file</span> +<span class="cm"> */</span> + <span class="n">List</span><span class="o"><</span><span class="n">FastaSequence</span><span class="o">></span> <span class="n">fastalist</span> <span class="o">=</span> <span class="n">SequenceUtil</span> + <span class="o">.</span><span class="na">readFasta</span><span class="o">(</span><span class="k">new</span> <span class="n">ByteArrayInputStream</span><span class="o">(</span><span class="n">input</span><span class="o">.</span><span class="na">getBytes</span><span class="o">()));</span> + + <span class="cm">/*</span> +<span class="cm"> * Submit loaded sequences for an alignment using preset. The job</span> +<span class="cm"> * identifier is returned by this method, you can retrieve the results</span> +<span class="cm"> * with it sometime later.</span> +<span class="cm"> */</span> + <span class="n">String</span> <span class="n">jobId</span> <span class="o">=</span> <span class="n">msaws</span><span class="o">.</span><span class="na">presetAlign</span><span class="o">(</span><span class="n">fastalist</span><span class="o">,</span> <span class="n">preset</span><span class="o">);</span> + + <span class="cm">/* This method will block for the duration of the calculation */</span> + <span class="n">Alignment</span> <span class="n">alignment</span> <span class="o">=</span> <span class="n">msaws</span><span class="o">.</span><span class="na">getResult</span><span class="o">(</span><span class="n">jobId</span><span class="o">);</span> + + <span class="cm">/*</span> +<span class="cm"> * This is a better way of obtaining results, it does not involve</span> +<span class="cm"> * holding the connection open for the duration of the calculation,</span> +<span class="cm"> * Besides, as the University of Dundee public server will reset the</span> +<span class="cm"> * connection after 10 minutes of idling, this is the only way to obtain</span> +<span class="cm"> * the results of long running task from our public server.</span> +<span class="cm"> */</span> + <span class="c1">// while (msaws.getJobStatus(jobId) != JobStatus.FINISHED) {</span> + <span class="c1">// Thread.sleep(1000); // wait a second, then recheck the status</span> + <span class="c1">// }</span> + + <span class="cm">/* Output the alignment to standard out */</span> + <span class="n">System</span><span class="o">.</span><span class="na">out</span><span class="o">.</span><span class="na">println</span><span class="o">(</span><span class="n">alignment</span><span class="o">);</span> + + <span class="c1">// Alternatively, you can record retrieved alignment into the file in</span> + <span class="c1">// ClustalW format</span> + + <span class="c1">// ClustalAlignmentUtil.writeClustalAlignment(new FileOutputStream(</span> + <span class="c1">// "output.al"), alignment);</span> + + <span class="o">}</span> +<span class="o">}</span> +</pre></div> +</div> +<p>For a more detailed description of all available types and their functions please refer to the <a class="reference external" href="http://www.compbio.dundee.ac.uk/jabaws/dm_javadoc/index.html">Data Model JavaDoc</a>.</p> +<hr class="docutils" /> +</div> +</div> +<div class="section" id="adding-new-web-services"> +<span id="jabaws-new-services"></span><h2>Adding new web-services<a class="headerlink" href="#adding-new-web-services" title="Permalink to this headline">¶</a></h2> +<div class="section" id="brief-guide"> +<span id="jabaws-new-guide"></span><h3>Brief Guide<a class="headerlink" href="#brief-guide" title="Permalink to this headline">¶</a></h3> +<ol class="arabic"> +<li><p class="first">Add a new executable which you’d like to wrap as a JABAWS web service to the binaries folder. If it has the source code and can be recompiled for different platforms include it under <code class="docutils literal"><span class="pre">binaries/src</span></code>. Edit <code class="docutils literal"><span class="pre">setexecutableflag.sh</span></code> and <code class="docutils literal"><span class="pre">compilebin.sh</span></code> scripts in <code class="docutils literal"><span class="pre">binaries/src</span></code> accordingly.</p> +</li> +<li><p class="first">Make sure that all the dependencies of the software being installed are satisfied. If there are other binaries they should be included as well. Keep the dependent binaries in a subfolder for the main executable. Update <code class="docutils literal"><span class="pre">compilebin.sh</span></code> and <code class="docutils literal"><span class="pre">setexecflag.sh</span></code> scripts accordingly.</p> +</li> +<li><p class="first">Make sure that the new executable does not have any hard links to its dependencies, e.g. is able to run from any installation folder and does not contain any hard coded paths.</p> +</li> +<li><p class="first">Describe executable in <code class="docutils literal"><span class="pre">conf/Exectuable.properties</span></code> file. The lowercase name of the wrapper should be included in the name of the property for example Clustal properties all include clustal as a part of the name e.g. <code class="docutils literal"><span class="pre">local.clustalw.bin</span></code>. The same property for MAFFT will be called <code class="docutils literal"><span class="pre">local.mafft.bin</span></code>. For more help please refer to the Executable.properties file.</p> +</li> +<li><p class="first">Describe the executable supported parameters in the <code class="docutils literal"><span class="pre"><ExecutableName>Parameters.xml</span></code>, presets in the <code class="docutils literal"><span class="pre"><ExecutableName>Presets.xml</span></code> and the execution limits in the <code class="docutils literal"><span class="pre"><ExecutableName>Limit.xml</span></code>. By convention these files are stored in <code class="docutils literal"><span class="pre">conf/settings</span></code>. All of these are optional. If the executable does not support parameters you do not have to mention the <code class="docutils literal"><span class="pre">XXXParameter.xml</span></code> file in the <code class="docutils literal"><span class="pre">Executable.properties</span></code> file at all. The same is true for Presets and Limits.</p> +</li> +<li><p class="first">Create a Java wrapper class for your executable. Create it within runner source directory. Examples of other wrappers can be found in <code class="docutils literal"><span class="pre">compbio.runner.msa</span></code> or in other <code class="docutils literal"><span class="pre">compbio.runner.*</span></code> packages. Wrapper should extend <code class="docutils literal"><span class="pre">SkeletalExecutable<T></span></code> and implement <code class="docutils literal"><span class="pre">PipedExecutable<T></span></code> if you need to pass the input or collect the results from the standard in/out. Please see Mafft code as example. Wrapper should expend <code class="docutils literal"><span class="pre">SkeletalExecutable<T></span></code> if input/output can be set as a parameter for an executable. Please see the ClustalW code as example.</p> +</li> +<li><p class="first">Create a testcase suit for your wrapper in <code class="docutils literal"><span class="pre">testsrc</span></code> and run the test cases.</p> +</li> +<li><p class="first">Create parser for the output files of your executable. Suggested location <code class="docutils literal"><span class="pre">compbio.data.sequence.SequenceUtil</span></code>.</p> +</li> +<li><p class="first">Test the parser.</p> +</li> +<li><p class="first">Decide which web services interfaces your executable is going to match. For example if the executable output can be represented as SequenceAnnotation then SequenceAnnotation interface might be appropriate. For multiple sequence alignment an Msa interface should be used.</p> +</li> +<li><p class="first">If you find a web interface that matches your returning data type, then implement a web service which confirms to it within a webservices source folder.</p> +</li> +<li><p class="first">Register web service in <code class="docutils literal"><span class="pre">WEB-INF/web.xml</span></code> and <code class="docutils literal"><span class="pre">WEB-INF/sun-jaxws.xml</span></code>.</p> +</li> +<li><p class="first">Add generated wsdl to wsbuild.xml ant script to generate the stubs.</p> +</li> +<li><p class="first">Run build-server task in wsbuild file. Watch for errors. If the task fails that means that JAXB cannot serialize some of your new data structures. Add appropriate annotations to your data types. Also check that:</p> +<blockquote> +<div><ul class="simple"> +<li>you do not have interfaces to serialize, since JAXB cannot serialize them</li> +<li>you have a default no args constructor (can be private if you do not need it)</li> +<li>JAXB cannot serialize Java Map class, use a custom data structure instead</li> +<li>Enum cannot be serialized as its abstract class (do not confuse with enum which is fine)</li> +<li>Fields serialization leaves a little more space for manoeuvre. If you do this then you may accept and return interfaces, e.g. List, Map; abstract classes etc, from your methods</li> +</ul> +</div></blockquote> +<p>If you have the data on the server side, but nothing is coming through to the client, this is a JAXB serialization problem. They tend to be very silent and thus hard to debug. Check your data structure can be serialized!</p> +</li> +<li><p class="first">Modify the client to work with your new web service. Update Services enumeration to include new service and ensure that all the methods of this enumeration take into account the new service. Update the client help text (<code class="docutils literal"><span class="pre">client_help.txt</span></code>) and insert it into the Constraints class.</p> +</li> +<li><p class="first">Test the web service with the client.</p> +</li> +<li><p class="first">Test on the cluster.</p> +</li> +</ol> +<hr class="docutils" /> +</div> +<div class="section" id="building-web-services-artifacts"> +<span id="jabaws-artifacts"></span><h3>Building web services artifacts<a class="headerlink" href="#building-web-services-artifacts" title="Permalink to this headline">¶</a></h3> +<p>JABAWS are the standard <a class="reference external" href="http://jax-ws.java.net/">JAX-WS</a> SOAP web services, which are <a class="reference external" href="http://www.ws-i.org/">WS-I</a> basic profile compatible. This means that you could use whatever tool your language has to work with web services. Below is how you can generate portable artifacts to work with JABAWS from Java. However if programming in Java, we recommend using our client library as it provides a handful of useful methods in addition to plain data types.</p> +<div class="code bash highlight-default"><div class="highlight"><pre><span></span>wsimport -keep http://www.compbio.dundee.ac.uk/jabaws/ClustalWS?wsdl +</pre></div> +</div> +<p>Server side artifacts should be rebuild whenever the data model, meta model or MSA interface were changed. To do that run build-server task from wsbuild.xml ant build file. WSDL files will be generated in <code class="docutils literal"><span class="pre">webservices/compbio/ws/server/resource</span></code> directory. It is not necessary to edit them if any of the JABAWS clients are used. JABAWS are the standard JAX-WS web services, which are WS-I basic profile compatible.</p> +<hr class="docutils" /> +</div> +<div class="section" id="preparing-distributives"> +<span id="jabaws-distributives"></span><h3>Preparing Distributives<a class="headerlink" href="#preparing-distributives" title="Permalink to this headline">¶</a></h3> +<p>There are a number of ant tasks aimed for preparing distributives for download. Currently a few types of JABAWS packages are offered:</p> +<ol class="arabic simple"> +<li>Client only (contains classes required to access JABA Web Services)</li> +<li>Platform specific JABAWS (windows and other)</li> +<li>JABAWS without binaries</li> +<li>JABAWS framework</li> +</ol> +<p>Corresponding build task names are:</p> +<ol class="arabic simple"> +<li>min-jaba-client</li> +<li>jaba-windows, jaba-complete</li> +<li>jaba-no-binaries</li> +<li>full-jaba-client</li> +</ol> +<p>The easiest way to build all distributives is to call <code class="docutils literal"><span class="pre">build-all</span></code> ant task. There are more tasks defined in build.xml than described here. They are mostly self explanatory.</p> +<p>If you made any changes to the data model and would like to generate a complete JABAWS distro make sure you have rebuilt jaxws artifact as described below.</p> +</div> +</div> +</div> + + + </div> + <div class="articleComments"> + + </div> + </div> + <footer> + + <div class="rst-footer-buttons" role="navigation" aria-label="footer navigation"> + + <a href="stats.html" class="btn btn-neutral float-right" title="Usage Statistics" accesskey="n" rel="next">Next <span class="fa fa-arrow-circle-right"></span></a> + + + <a href="advanced.html" class="btn btn-neutral" title="Advanced Usage" accesskey="p" rel="prev"><span class="fa fa-arrow-circle-left"></span> Previous</a> + + </div> + + + <hr/> + + <div role="contentinfo"> + <p><a href="../">JABAWS 2.2</a> + © Copyright 2017, Peter Troshin, Alexander Sherstnev, Jim Procter, Alexey Drozdetskiy, Daniel Barton, Suzanne Duce, Fábio Madeira and Geoff Barton. + + </p> + </div> + Built with <a href="http://sphinx-doc.org/">Sphinx</a> using a <a href="https://github.com/snide/sphinx_rtd_theme">theme</a> provided by <a href="https://readthedocs.org">Read the Docs</a>. + +</footer> + </div> + </div> + + </section> + + </div> + + + + + + <script type="text/javascript"> + var DOCUMENTATION_OPTIONS = { + URL_ROOT:'./', + VERSION:'2.2', + LANGUAGE:'None', + COLLAPSE_INDEX:false, + FILE_SUFFIX:'.html', + HAS_SOURCE: true, + SOURCELINK_SUFFIX: '.txt' + }; + </script> + <script type="text/javascript" src="_static/jquery.js"></script> + <script type="text/javascript" src="_static/underscore.js"></script> + <script type="text/javascript" src="_static/doctools.js"></script> + + + + + + <script type="text/javascript" src="_static/js/theme.js"></script> + + + + + <script type="text/javascript"> + jQuery(function () { + SphinxRtdTheme.StickyNav.enable(); + }); + </script> + + +</body> +</html> \ No newline at end of file diff --git a/website/docs/genindex.html b/website/docs/genindex.html new file mode 100644 index 0000000..0aeab05 --- /dev/null +++ b/website/docs/genindex.html @@ -0,0 +1,235 @@ + + + +<!DOCTYPE html> +<!--[if IE 8]><html class="no-js lt-ie9" lang="en" > <![endif]--> +<!--[if gt IE 8]><!--> <html class="no-js" lang="en" > <!--<![endif]--> +<head> + <meta charset="utf-8"> + + <meta name="viewport" content="width=device-width, initial-scale=1.0"> + + <title>Index — JABAWS 2.2 documentation</title> + + + + + + + + + + + + + + + + + + <link rel="stylesheet" href="_static/css/theme.css" type="text/css" /> + + + + + + <link rel="index" title="Index" + href="#"/> + <link rel="search" title="Search" href="search.html"/> + <link rel="top" title="JABAWS 2.2 documentation" href="index.html"/> + + + <script src="_static/js/modernizr.min.js"></script> + +</head> + +<body class="wy-body-for-nav" role="document"> + + + <div class="wy-grid-for-nav"> + + + <nav data-toggle="wy-nav-shift" class="wy-nav-side"> + <div class="wy-side-scroll"> + <div class="wy-side-nav-search"> + + + + <a href="index.html" class="icon icon-home"> JABAWS + + + + </a> + + + + + <div class="version"> + 2.2 + </div> + + + + +<div role="search"> + <form id="rtd-search-form" class="wy-form" action="search.html" method="get"> + <input type="text" name="q" placeholder="Search docs" /> + <input type="hidden" name="check_keywords" value="yes" /> + <input type="hidden" name="area" value="default" /> + </form> +</div> + + + </div> + + <div class="wy-menu wy-menu-vertical" data-spy="affix" role="navigation" aria-label="main navigation"> + + + + + + + <p class="caption"><span class="caption-text">Contents:</span></p> +<ul> +<li class="toctree-l1"><a class="reference internal" href="getting_started.html">Getting Started</a></li> +<li class="toctree-l1"><a class="reference internal" href="included_tools.html">Included Tools</a></li> +<li class="toctree-l1"><a class="reference internal" href="client.html">Command Line Client (CLI)</a></li> +<li class="toctree-l1"><a class="reference internal" href="war.html">Web Application Archive (WAR)</a></li> +<li class="toctree-l1"><a class="reference internal" href="va.html">Virtual Appliance (VA)</a></li> +<li class="toctree-l1"><a class="reference internal" href="advanced.html">Advanced Usage</a></li> +<li class="toctree-l1"><a class="reference internal" href="develop.html">For Developers</a></li> +<li class="toctree-l1"><a class="reference internal" href="stats.html">Usage Statistics</a></li> +<li class="toctree-l1"><a class="reference internal" href="citations.html">Citations</a></li> +<li class="toctree-l1"><a class="reference internal" href="changelog.html">Changelog</a></li> +</ul> + + + + </div> + </div> + </nav> + + <section data-toggle="wy-nav-shift" class="wy-nav-content-wrap"> + + + <nav class="wy-nav-top" role="navigation" aria-label="top navigation"> + + <i data-toggle="wy-nav-top" class="fa fa-bars"></i> + <a href="index.html">JABAWS</a> + + </nav> + + + + <div class="wy-nav-content"> + <div class="rst-content"> + + + + + + + + + + + + + + + + +<div role="navigation" aria-label="breadcrumbs navigation"> + + <ul class="wy-breadcrumbs"> + + <li><a href="index.html">Docs</a> »</li> + + <li>Index</li> + + + <li class="wy-breadcrumbs-aside"> + + + + </li> + + </ul> + + + <hr/> +</div> + <div role="main" class="document" itemscope="itemscope" itemtype="http://schema.org/Article"> + <div itemprop="articleBody"> + + +<h1 id="index">Index</h1> + +<div class="genindex-jumpbox"> + +</div> + + + </div> + <div class="articleComments"> + + </div> + </div> + <footer> + + + <hr/> + + <div role="contentinfo"> + <p><a href="../">JABAWS 2.2</a> + © Copyright 2017, Peter Troshin, Alexander Sherstnev, Jim Procter, Alexey Drozdetskiy, Daniel Barton, Suzanne Duce, Fábio Madeira and Geoff Barton. + + </p> + </div> + Built with <a href="http://sphinx-doc.org/">Sphinx</a> using a <a href="https://github.com/snide/sphinx_rtd_theme">theme</a> provided by <a href="https://readthedocs.org">Read the Docs</a>. + +</footer> + </div> + </div> + + </section> + + </div> + + + + + + <script type="text/javascript"> + var DOCUMENTATION_OPTIONS = { + URL_ROOT:'./', + VERSION:'2.2', + LANGUAGE:'None', + COLLAPSE_INDEX:false, + FILE_SUFFIX:'.html', + HAS_SOURCE: true, + SOURCELINK_SUFFIX: '.txt' + }; + </script> + <script type="text/javascript" src="_static/jquery.js"></script> + <script type="text/javascript" src="_static/underscore.js"></script> + <script type="text/javascript" src="_static/doctools.js"></script> + + + + + + <script type="text/javascript" src="_static/js/theme.js"></script> + + + + + <script type="text/javascript"> + jQuery(function () { + SphinxRtdTheme.StickyNav.enable(); + }); + </script> + + +</body> +</html> \ No newline at end of file diff --git a/website/docs/getting_started.html b/website/docs/getting_started.html new file mode 100644 index 0000000..80d9a93 --- /dev/null +++ b/website/docs/getting_started.html @@ -0,0 +1,382 @@ + + +<!DOCTYPE html> +<!--[if IE 8]><html class="no-js lt-ie9" lang="en" > <![endif]--> +<!--[if gt IE 8]><!--> <html class="no-js" lang="en" > <!--<![endif]--> +<head> + <meta charset="utf-8"> + + <meta name="viewport" content="width=device-width, initial-scale=1.0"> + + <title>Getting Started — JABAWS 2.2 documentation</title> + + + + + + + + + + + + + + + + + + <link rel="stylesheet" href="_static/css/theme.css" type="text/css" /> + + + + + + <link rel="index" title="Index" + href="genindex.html"/> + <link rel="search" title="Search" href="search.html"/> + <link rel="top" title="JABAWS 2.2 documentation" href="index.html"/> + <link rel="next" title="Included Tools" href="included_tools.html"/> + <link rel="prev" title="Welcome to JABAWSâs documentation!" href="index.html"/> + + + <script src="_static/js/modernizr.min.js"></script> + +</head> + +<body class="wy-body-for-nav" role="document"> + + + <div class="wy-grid-for-nav"> + + + <nav data-toggle="wy-nav-shift" class="wy-nav-side"> + <div class="wy-side-scroll"> + <div class="wy-side-nav-search"> + + + + <a href="index.html" class="icon icon-home"> JABAWS + + + + </a> + + + + + <div class="version"> + 2.2 + </div> + + + + +<div role="search"> + <form id="rtd-search-form" class="wy-form" action="search.html" method="get"> + <input type="text" name="q" placeholder="Search docs" /> + <input type="hidden" name="check_keywords" value="yes" /> + <input type="hidden" name="area" value="default" /> + </form> +</div> + + + </div> + + <div class="wy-menu wy-menu-vertical" data-spy="affix" role="navigation" aria-label="main navigation"> + + + + + + + <p class="caption"><span class="caption-text">Contents:</span></p> +<ul class="current"> +<li class="toctree-l1 current"><a class="current reference internal" href="#">Getting Started</a><ul> +<li class="toctree-l2"><a class="reference internal" href="#jabaws-benefits">JABAWS Benefits</a></li> +<li class="toctree-l2"><a class="reference internal" href="#jabaws-distributions">JABAWS Distributions</a><ul> +<li class="toctree-l3"><a class="reference internal" href="#jalview-and-the-jabaws-public-server">Jalview and the JABAWS Public Server</a></li> +<li class="toctree-l3"><a class="reference internal" href="#command-line-client-cli">Command Line Client (CLI)</a></li> +<li class="toctree-l3"><a class="reference internal" href="#web-application-archive-war">Web Application aRchive (WAR)</a></li> +<li class="toctree-l3"><a class="reference internal" href="#virtual-appliance-va">Virtual Appliance (VA)</a></li> +</ul> +</li> +</ul> +</li> +<li class="toctree-l1"><a class="reference internal" href="included_tools.html">Included Tools</a></li> +<li class="toctree-l1"><a class="reference internal" href="client.html">Command Line Client (CLI)</a></li> +<li class="toctree-l1"><a class="reference internal" href="war.html">Web Application Archive (WAR)</a></li> +<li class="toctree-l1"><a class="reference internal" href="va.html">Virtual Appliance (VA)</a></li> +<li class="toctree-l1"><a class="reference internal" href="advanced.html">Advanced Usage</a></li> +<li class="toctree-l1"><a class="reference internal" href="develop.html">For Developers</a></li> +<li class="toctree-l1"><a class="reference internal" href="stats.html">Usage Statistics</a></li> +<li class="toctree-l1"><a class="reference internal" href="citations.html">Citations</a></li> +<li class="toctree-l1"><a class="reference internal" href="changelog.html">Changelog</a></li> +</ul> + + + + </div> + </div> + </nav> + + <section data-toggle="wy-nav-shift" class="wy-nav-content-wrap"> + + + <nav class="wy-nav-top" role="navigation" aria-label="top navigation"> + + <i data-toggle="wy-nav-top" class="fa fa-bars"></i> + <a href="index.html">JABAWS</a> + + </nav> + + + + <div class="wy-nav-content"> + <div class="rst-content"> + + + + + + + + + + + + + + + + +<div role="navigation" aria-label="breadcrumbs navigation"> + + <ul class="wy-breadcrumbs"> + + <li><a href="index.html">Docs</a> »</li> + + <li>Getting Started</li> + + + <li class="wy-breadcrumbs-aside"> + + + <a href="_sources/getting_started.rst.txt" rel="nofollow"> View page source</a> + + + </li> + + </ul> + + + <hr/> +</div> + <div role="main" class="document" itemscope="itemscope" itemtype="http://schema.org/Article"> + <div itemprop="articleBody"> + + <div class="section" id="getting-started"> +<h1>Getting Started<a class="headerlink" href="#getting-started" title="Permalink to this headline">¶</a></h1> +<p>JABAWS stands for <em>JAva Bioinformatics Analysis Web Services</em>. As the name suggests, JABAWS is a collection of web services for bioinformatics, and currently provides services that make it easy to access well-known multiple sequence alignment and protein disorder prediction programs (see the list of <a class="reference external" href="included_tools.html">currently supported programs</a>). Future versions of JABAWS will incorporate other tools.</p> +<p>JABAWS consists of a server and a client, but unlike most bioinformatics web-service systems, you can download and run both parts on your own computer! If you want a server just for yourself, then download and install the <a class="reference external" href="va.html">JABAWS Virtual Appliance (VA)</a>. It requires no configuration and is simple to install. If you want to install JABAWS for your lab or institution then download the <a class="reference external" href="war.html">JABAWS Web Application aRchive (WAR)</a>. It is slightly more complicated to configure but is very straightforward too. Finally, if you want to script against any version of JABAWS or are interested in writing your own client, the <a class="reference external" href="client.html">JABAWS Command Line Interface (CLI)</a> client is what you need.</p> +<hr class="docutils" /> +<div class="section" id="jabaws-benefits"> +<span id="benefits"></span><h2>JABAWS Benefits<a class="headerlink" href="#jabaws-benefits" title="Permalink to this headline">¶</a></h2> +<ul class="simple"> +<li>Can be deployed on most operating systems, as a VMware or compatible Virtual Appliance, as well as a Tomcat Java Web Application.</li> +<li>Comes complete with sources and binaries for all the bioinformatics programs that it runs.</li> +<li>Can operate as a stand alone server or one that submits jobs to a cluster via <cite>DRMAA</cite>.</li> +<li>Easy to access from <a class="reference external" href="http://www.jalview.org/">Jalview</a> using its graphical client, or using the JABAWS command line client.</li> +<li>Clients can submit jobs to any JABAWS servers that they might want to access, such as the one running on your local computer, your lab’s server, or the publicly available services at the <a class="reference external" href="http://www.compbio.dundee.ac.uk/">University of Dundee</a>.</li> +<li>Local or intranet installation eliminates any security concerns you might have about sending sensitive data over the internet.</li> +<li>Wide range of configuration options to control size of jobs accepted by a server, and the command line options available for the program run by a service.</li> +</ul> +<hr class="docutils" /> +</div> +<div class="section" id="jabaws-distributions"> +<span id="distributions"></span><h2>JABAWS Distributions<a class="headerlink" href="#jabaws-distributions" title="Permalink to this headline">¶</a></h2> +<div class="admonition tip"> +<p class="first admonition-title">Tip</p> +<p class="last">To help you choose the JABAWS distribution that better suits your needs and read on the quickstart guides below.</p> +</div> +<p><strong>I want to use JABAWS for...</strong></p> +<ul class="simple"> +<li><a class="reference internal" href="#jabaws-jalview-public"><span class="std std-ref">Jalview and the JABAWS Public Server</span></a> - Running JABAWS services through Jalview on the JABAWS <em>public</em> server</li> +<li><a class="reference internal" href="#jabaws-cli"><span class="std std-ref">Command Line Client (CLI)</span></a> - Accessing a <em>public</em> or <em>private</em> JABAWS server using the JABAWS client</li> +<li><a class="reference internal" href="#jabaws-war"><span class="std std-ref">Web Application aRchive (WAR)</span></a> - Running JABAWS for my group, lab, or organization on the <em>local</em> infrastructure</li> +<li><a class="reference internal" href="#jabaws-va"><span class="std std-ref">Virtual Appliance (VA)</span></a> - Running JABAWS services through Jalview or the CLI client on a <em>private</em> virtual machine server</li> +</ul> +<hr class="docutils" /> +<div class="section" id="jalview-and-the-jabaws-public-server"> +<span id="jabaws-jalview-public"></span><h3>Jalview and the JABAWS Public Server<a class="headerlink" href="#jalview-and-the-jabaws-public-server" title="Permalink to this headline">¶</a></h3> +<p><a class="reference external" href="http://www.jalview.org/">Jalview</a>, a multiple sequence alignment and analysis application, is a good example of a graphical JABAWS client. This client uses the same functionality as the <a class="reference external" href="client.html">JABAWS Command Line Interface (CLI)</a> client, but instead allows JABAWS services to be accessed in a more user-friendly manner, through a graphical user interface. In this way, this is the easiest way to run JABAWS web services. Simply launch <a class="reference external" href="http://www.jalview.org/">Jalview</a> and run any of the methods provided under the ‘Web Service’ menu. Jalview uses the public JABAWS server by default. If you are concerned about privacy or want to run sensitive analysis on your own hardware, you can either setup a local <a class="reference external" href="va.html">JABAWS Virtual Appliance (VA)</a> or configure the <a class="reference external" href="war.html">JABAWS Web Application aRchive (WAR)</a> in your infrastructure.</p> +<hr class="docutils" /> +</div> +<div class="section" id="command-line-client-cli"> +<span id="jabaws-cli"></span><h3>Command Line Client (CLI)<a class="headerlink" href="#command-line-client-cli" title="Permalink to this headline">¶</a></h3> +<p>This is a single Java archive which contains the JABAWS command line interface (CLI) client. It allows anyone who wants to connect to the JABAWS web-services running at the University of Dundee’s Public Server, or to run a local private JABAWS server from their own software. You can read more about how to use JABAWS command line (CLI) client given in the <a class="reference external" href="client.html">CLI documentation pages</a>, but a brief instructions are given below:</p> +<ol class="arabic"> +<li><p class="first">Download the <a class="reference external" href="../download.jsp#client">Client Jar file</a></p> +</li> +<li><p class="first">Download and install <a class="reference external" href="http://www.oracle.com/technetwork/java/javase/downloads/jre7-downloads-1880261.html">Java</a> (version 1.7)</p> +</li> +<li><p class="first">Provided that you have the Java ready to run, you can get command line help by changing to the directory where you downloaded the client jar, and typing:</p> +<blockquote> +<div><div class="code bash highlight-default"><div class="highlight"><pre><span></span><span class="n">java</span> <span class="o">-</span><span class="n">jar</span> <span class="n">jaba</span><span class="o">-</span><span class="n">client</span><span class="o">.</span><span class="n">jar</span> +</pre></div> +</div> +</div></blockquote> +</li> +</ol> +<p>The JABA Web Services are WS-I compliant. This means that you can access them from any language that has libraries or functions for consuming interoperable SOAP web services. More information on how to develop software that access JABAWS services is provided in the <a class="reference external" href="develop.html#accessing-jabaws-from-your-program">documentation pages</a>.</p> +<hr class="docutils" /> +</div> +<div class="section" id="web-application-archive-war"> +<span id="jabaws-war"></span><h3>Web Application aRchive (WAR)<a class="headerlink" href="#web-application-archive-war" title="Permalink to this headline">¶</a></h3> +<p>The JABAWS Web Application aRchive (WAR) is for anyone who wants to run JABAWS for their group, lab or organization, or wants to enable their local JABAWS server to use the cluster or perform very large tasks. Complete documentation is provided in the <a class="reference external" href="war.html">WAR documentation pages</a>, but brief instructions are given below:</p> +<ol class="arabic"> +<li><p class="first">Download the <a class="reference external" href="../download.jsp#war">JABAWS WAR file</a></p> +</li> +<li><p class="first">Download and install <a class="reference external" href="http://tomcat.apache.org/download-80.cgi">Apache-Tomcat</a></p> +<blockquote> +<div><p>You will need at least Tomcat version 5.5 of (we would recommend version 8.5) and at least <cite>Java</cite> 1.7 (i.e. JAVA 7).</p> +</div></blockquote> +</li> +<li><p class="first">Drop the JABAWS WAR file into <code class="docutils literal"><span class="pre">tomcat/webapps</span></code> directory.</p> +</li> +<li><p class="first">(Re)start the Tomcat.</p> +</li> +<li><p class="first">Once the tomcat has started, it should automatically unpack the WAR into the webapps directory (if it doesn’t, simply unpack the WAR archive).</p> +</li> +<li><p class="first">If you are on Mac or other unix-like architecture with GNU compilers available or you’d like to get a maximum performance</p> +<blockquote> +<div><p><code class="docutils literal"><span class="pre">cd</span></code> to <code class="docutils literal"><span class="pre">webapps/jabaws/binaries/src/</span></code> and execute <code class="docutils literal"><span class="pre">./compilebin.sh</span></code> script to compile all binaries JABAWS depends on.</p> +</div></blockquote> +</li> +</ol> +<p><strong>Testing</strong></p> +<p>You can test that your JABAWS server is working in several ways.</p> +<ol class="arabic"> +<li><p class="first">Visit Services Status page available from the JABAWS main page using your web browser.</p> +</li> +<li><p class="first">If you are working on the command line, then use the command line client shipped with the JABAWS war to test it by running:</p> +<blockquote> +<div><blockquote> +<div><div class="code bash highlight-default"><div class="highlight"><pre><span></span><span class="n">java</span> <span class="o">-</span><span class="n">jar</span> <span class="o"><</span><span class="n">Path</span> <span class="n">to</span> <span class="n">tomcat</span> <span class="n">WebApp</span> <span class="n">directory</span><span class="o">>/</span><span class="n">jabaws</span><span class="o">/</span><span class="n">WEB</span><span class="o">-</span><span class="n">INF</span><span class="o">/</span><span class="n">lib</span><span class="o">/</span><span class="n">jabaws</span><span class="o">-</span><span class="n">client</span><span class="o">.</span><span class="n">jar</span> <span class="o">-</span><span class="n">h</span><span class="o">=</span><span class="n">http</span><span class="p">:</span><span class="o">//</span><span class="n">localhost</span><span class="p">:</span><span class="mi">8080</span><span class="o">/</span><span class="n">jabaws</span> +</pre></div> +</div> +</div></blockquote> +<p>In this example we assumed that your JABAWS server URL is <code class="docutils literal"><span class="pre">http://localhost:8080</span></code> and JABAWS context path is <em>jabaws</em></p> +</div></blockquote> +</li> +<li><p class="first">Alternately, you can point Jalview at your new server:</p> +<blockquote> +<div><ol class="arabic simple"> +<li>Launch the desktop version of <a class="reference external" href="http://www.jalview.org/">Jalview</a></li> +<li>Open the Jalview desktop’s preferences panel (from the Tools->Preferences menu option), elect the Webservices panel and press the New Service URL button.</li> +<li>Enter the URL for the tomcat server, including the context path for the JABAWS web app (e.g. <a class="reference external" href="http://localhost:8080/jabaws">http://localhost:8080/jabaws</a>).</li> +</ol> +</div></blockquote> +</li> +</ol> +<hr class="docutils" /> +</div> +<div class="section" id="virtual-appliance-va"> +<span id="jabaws-va"></span><h3>Virtual Appliance (VA)<a class="headerlink" href="#virtual-appliance-va" title="Permalink to this headline">¶</a></h3> +<div class="admonition warning"> +<p class="first admonition-title">Warning</p> +<p class="last">The Virtual Appliance (VA) for JABAWS v2.2 will be provided soon.</p> +</div> +<p>The Virtual Appliance (VA) package allows you to run a JABAWS server installed on <a class="reference external" href="https://www.turnkeylinux.org/tomcat">TurnKey Linux</a> as a virtual machine on your laptop or desktop computer. A complete guide to the JABAWS VA is given in the <a class="reference external" href="va.html">VA documentation pages</a>, but for the impatient, brief instructions are given below:</p> +<p>If you work on Windows, Linux or Unix:</p> +<ol class="arabic simple"> +<li>Download <a class="reference external" href="../download.jsp#va">JABAWS Virtual Appliance</a></li> +<li>Download and install <a class="reference external" href="http://www.vmware.com/products/player">VMWare Player</a></li> +<li>Unpack the JABAWS virtual appliance and open it with VMware Player</li> +</ol> +<p>If you work on Mac do the same using <a class="reference external" href="http://www.vmware.com/products/fusion/overview.html">VMware Fusion</a>.</p> +<p><strong>Testing</strong></p> +<p>To check that your JABAWS virtual appliance is working visit the Services Status page available from the main JABAWS menu. For this enter the JABAWS URL for your new server into a web browser. This is shown once the appliance is booted up.</p> +<p>Alternatively you can use Jalview to complete the testing.</p> +<ol class="arabic simple"> +<li>Launch the desktop version of <a class="reference external" href="http://www.jalview.org/">Jalview</a></li> +<li>Open the Jalview desktop’s preferences panel (from the Tools->Preferences menu option), select the <code class="docutils literal"><span class="pre">Webservices</span></code> panel and press the <code class="docutils literal"><span class="pre">New</span> <span class="pre">Service</span> <span class="pre">URL</span></code> button.</li> +<li>Enter the JABAWS URL for your new server. This is shown once the appliance is booted up.</li> +</ol> +</div> +</div> +</div> + + + </div> + <div class="articleComments"> + + </div> + </div> + <footer> + + <div class="rst-footer-buttons" role="navigation" aria-label="footer navigation"> + + <a href="included_tools.html" class="btn btn-neutral float-right" title="Included Tools" accesskey="n" rel="next">Next <span class="fa fa-arrow-circle-right"></span></a> + + + <a href="index.html" class="btn btn-neutral" title="Welcome to JABAWSâs documentation!" accesskey="p" rel="prev"><span class="fa fa-arrow-circle-left"></span> Previous</a> + + </div> + + + <hr/> + + <div role="contentinfo"> + <p><a href="../">JABAWS 2.2</a> + © Copyright 2017, Peter Troshin, Alexander Sherstnev, Jim Procter, Alexey Drozdetskiy, Daniel Barton, Suzanne Duce, Fábio Madeira and Geoff Barton. + + </p> + </div> + Built with <a href="http://sphinx-doc.org/">Sphinx</a> using a <a href="https://github.com/snide/sphinx_rtd_theme">theme</a> provided by <a href="https://readthedocs.org">Read the Docs</a>. + +</footer> + </div> + </div> + + </section> + + </div> + + + + + + <script type="text/javascript"> + var DOCUMENTATION_OPTIONS = { + URL_ROOT:'./', + VERSION:'2.2', + LANGUAGE:'None', + COLLAPSE_INDEX:false, + FILE_SUFFIX:'.html', + HAS_SOURCE: true, + SOURCELINK_SUFFIX: '.txt' + }; + </script> + <script type="text/javascript" src="_static/jquery.js"></script> + <script type="text/javascript" src="_static/underscore.js"></script> + <script type="text/javascript" src="_static/doctools.js"></script> + + + + + + <script type="text/javascript" src="_static/js/theme.js"></script> + + + + + <script type="text/javascript"> + jQuery(function () { + SphinxRtdTheme.StickyNav.enable(); + }); + </script> + + +</body> +</html> \ No newline at end of file diff --git a/website/docs/included_tools.html b/website/docs/included_tools.html new file mode 100644 index 0000000..1de623b --- /dev/null +++ b/website/docs/included_tools.html @@ -0,0 +1,284 @@ + + +<!DOCTYPE html> +<!--[if IE 8]><html class="no-js lt-ie9" lang="en" > <![endif]--> +<!--[if gt IE 8]><!--> <html class="no-js" lang="en" > <!--<![endif]--> +<head> + <meta charset="utf-8"> + + <meta name="viewport" content="width=device-width, initial-scale=1.0"> + + <title>Included Tools — JABAWS 2.2 documentation</title> + + + + + + + + + + + + + + + + + + <link rel="stylesheet" href="_static/css/theme.css" type="text/css" /> + + + + + + <link rel="index" title="Index" + href="genindex.html"/> + <link rel="search" title="Search" href="search.html"/> + <link rel="top" title="JABAWS 2.2 documentation" href="index.html"/> + <link rel="next" title="Command Line Client (CLI)" href="client.html"/> + <link rel="prev" title="Getting Started" href="getting_started.html"/> + + + <script src="_static/js/modernizr.min.js"></script> + +</head> + +<body class="wy-body-for-nav" role="document"> + + + <div class="wy-grid-for-nav"> + + + <nav data-toggle="wy-nav-shift" class="wy-nav-side"> + <div class="wy-side-scroll"> + <div class="wy-side-nav-search"> + + + + <a href="index.html" class="icon icon-home"> JABAWS + + + + </a> + + + + + <div class="version"> + 2.2 + </div> + + + + +<div role="search"> + <form id="rtd-search-form" class="wy-form" action="search.html" method="get"> + <input type="text" name="q" placeholder="Search docs" /> + <input type="hidden" name="check_keywords" value="yes" /> + <input type="hidden" name="area" value="default" /> + </form> +</div> + + + </div> + + <div class="wy-menu wy-menu-vertical" data-spy="affix" role="navigation" aria-label="main navigation"> + + + + + + + <p class="caption"><span class="caption-text">Contents:</span></p> +<ul class="current"> +<li class="toctree-l1"><a class="reference internal" href="getting_started.html">Getting Started</a></li> +<li class="toctree-l1 current"><a class="current reference internal" href="#">Included Tools</a><ul> +<li class="toctree-l2"><a class="reference internal" href="#multiple-sequence-alignment">Multiple Sequence Alignment</a></li> +<li class="toctree-l2"><a class="reference internal" href="#protein-disorder-prediction">Protein Disorder Prediction</a></li> +<li class="toctree-l2"><a class="reference internal" href="#amino-acid-conservation">Amino Acid Conservation</a></li> +<li class="toctree-l2"><a class="reference internal" href="#rna-secondary-structure">RNA Secondary Structure</a></li> +</ul> +</li> +<li class="toctree-l1"><a class="reference internal" href="client.html">Command Line Client (CLI)</a></li> +<li class="toctree-l1"><a class="reference internal" href="war.html">Web Application Archive (WAR)</a></li> +<li class="toctree-l1"><a class="reference internal" href="va.html">Virtual Appliance (VA)</a></li> +<li class="toctree-l1"><a class="reference internal" href="advanced.html">Advanced Usage</a></li> +<li class="toctree-l1"><a class="reference internal" href="develop.html">For Developers</a></li> +<li class="toctree-l1"><a class="reference internal" href="stats.html">Usage Statistics</a></li> +<li class="toctree-l1"><a class="reference internal" href="citations.html">Citations</a></li> +<li class="toctree-l1"><a class="reference internal" href="changelog.html">Changelog</a></li> +</ul> + + + + </div> + </div> + </nav> + + <section data-toggle="wy-nav-shift" class="wy-nav-content-wrap"> + + + <nav class="wy-nav-top" role="navigation" aria-label="top navigation"> + + <i data-toggle="wy-nav-top" class="fa fa-bars"></i> + <a href="index.html">JABAWS</a> + + </nav> + + + + <div class="wy-nav-content"> + <div class="rst-content"> + + + + + + + + + + + + + + + + +<div role="navigation" aria-label="breadcrumbs navigation"> + + <ul class="wy-breadcrumbs"> + + <li><a href="index.html">Docs</a> »</li> + + <li>Included Tools</li> + + + <li class="wy-breadcrumbs-aside"> + + + <a href="_sources/included_tools.rst.txt" rel="nofollow"> View page source</a> + + + </li> + + </ul> + + + <hr/> +</div> + <div role="main" class="document" itemscope="itemscope" itemtype="http://schema.org/Article"> + <div itemprop="articleBody"> + + <div class="section" id="included-tools"> +<h1>Included Tools<a class="headerlink" href="#included-tools" title="Permalink to this headline">¶</a></h1> +<div class="section" id="multiple-sequence-alignment"> +<span id="msa"></span><h2>Multiple Sequence Alignment<a class="headerlink" href="#multiple-sequence-alignment" title="Permalink to this headline">¶</a></h2> +<ul class="simple"> +<li><a class="reference external" href="http://www.clustal.org/omega">Clustal Omega</a> (version 1.2.4)</li> +<li><a class="reference external" href="http://www.clustal.org/clustal2">ClustalW</a> (version 2.1)</li> +<li><a class="reference external" href="http://align.bmr.kyushu-u.ac.jp/mafft/software/">Mafft</a> (version 7.310)</li> +<li><a class="reference external" href="http://www.drive5.com/muscle">Muscle</a> (version 3.8.31)</li> +<li><a class="reference external" href="http://www.tcoffee.org/Projects_home_page/t_coffee_home_page.html">T-coffee</a> (version 11.00.8cbe486)</li> +<li><a class="reference external" href="http://probcons.stanford.edu/">Probcons</a> (version 1.12)</li> +<li><a class="reference external" href="http://msaprobs.sourceforge.net/">MSAProbs</a> (version 0.9.7)</li> +<li><a class="reference external" href="http://sourceforge.net/projects/glprobs/">GLProbs</a> (version 0.9.7)</li> +</ul> +</div> +<div class="section" id="protein-disorder-prediction"> +<span id="pdis"></span><h2>Protein Disorder Prediction<a class="headerlink" href="#protein-disorder-prediction" title="Permalink to this headline">¶</a></h2> +<ul class="simple"> +<li><a class="reference external" href="http://dis.embl.de/">DisEMBL</a> (version 1.5)</li> +<li><a class="reference external" href="http://iupred.enzim.hu">IUPred</a> (version 1.0)</li> +<li>Jronn - Java implementation of <a class="reference external" href="http://www.strubi.ox.ac.uk/RONN">Ronn</a> (version 3.1)</li> +<li><a class="reference external" href="http://globplot.embl.de/">GlobPlot</a> (version 2.3)</li> +</ul> +</div> +<div class="section" id="amino-acid-conservation"> +<span id="aac"></span><h2>Amino Acid Conservation<a class="headerlink" href="#amino-acid-conservation" title="Permalink to this headline">¶</a></h2> +<ul class="simple"> +<li><a class="reference external" href="http://www.compbio.dundee.ac.uk/aacon">AACon</a> (version 1.0)</li> +</ul> +</div> +<div class="section" id="rna-secondary-structure"> +<span id="rnass"></span><h2>RNA Secondary Structure<a class="headerlink" href="#rna-secondary-structure" title="Permalink to this headline">¶</a></h2> +<ul class="simple"> +<li>RNAalifold from <a class="reference external" href="http://www.tbi.univie.ac.at/RNA">ViennaRNA</a> (version 2.0)</li> +</ul> +</div> +</div> + + + </div> + <div class="articleComments"> + + </div> + </div> + <footer> + + <div class="rst-footer-buttons" role="navigation" aria-label="footer navigation"> + + <a href="client.html" class="btn btn-neutral float-right" title="Command Line Client (CLI)" accesskey="n" rel="next">Next <span class="fa fa-arrow-circle-right"></span></a> + + + <a href="getting_started.html" class="btn btn-neutral" title="Getting Started" accesskey="p" rel="prev"><span class="fa fa-arrow-circle-left"></span> Previous</a> + + </div> + + + <hr/> + + <div role="contentinfo"> + <p><a href="../">JABAWS 2.2</a> + © Copyright 2017, Peter Troshin, Alexander Sherstnev, Jim Procter, Alexey Drozdetskiy, Daniel Barton, Suzanne Duce, Fábio Madeira and Geoff Barton. + + </p> + </div> + Built with <a href="http://sphinx-doc.org/">Sphinx</a> using a <a href="https://github.com/snide/sphinx_rtd_theme">theme</a> provided by <a href="https://readthedocs.org">Read the Docs</a>. + +</footer> + </div> + </div> + + </section> + + </div> + + + + + + <script type="text/javascript"> + var DOCUMENTATION_OPTIONS = { + URL_ROOT:'./', + VERSION:'2.2', + LANGUAGE:'None', + COLLAPSE_INDEX:false, + FILE_SUFFIX:'.html', + HAS_SOURCE: true, + SOURCELINK_SUFFIX: '.txt' + }; + </script> + <script type="text/javascript" src="_static/jquery.js"></script> + <script type="text/javascript" src="_static/underscore.js"></script> + <script type="text/javascript" src="_static/doctools.js"></script> + + + + + + <script type="text/javascript" src="_static/js/theme.js"></script> + + + + + <script type="text/javascript"> + jQuery(function () { + SphinxRtdTheme.StickyNav.enable(); + }); + </script> + + +</body> +</html> \ No newline at end of file diff --git a/website/docs/index.html b/website/docs/index.html new file mode 100644 index 0000000..3cecf3c --- /dev/null +++ b/website/docs/index.html @@ -0,0 +1,359 @@ + + +<!DOCTYPE html> +<!--[if IE 8]><html class="no-js lt-ie9" lang="en" > <![endif]--> +<!--[if gt IE 8]><!--> <html class="no-js" lang="en" > <!--<![endif]--> +<head> + <meta charset="utf-8"> + + <meta name="viewport" content="width=device-width, initial-scale=1.0"> + + <title>Welcome to JABAWSâs documentation! — JABAWS 2.2 documentation</title> + + + + + + + + + + + + + + + + + + <link rel="stylesheet" href="_static/css/theme.css" type="text/css" /> + + + + + + <link rel="index" title="Index" + href="genindex.html"/> + <link rel="search" title="Search" href="search.html"/> + <link rel="top" title="JABAWS 2.2 documentation" href="#"/> + <link rel="next" title="Getting Started" href="getting_started.html"/> + + + <script src="_static/js/modernizr.min.js"></script> + +</head> + +<body class="wy-body-for-nav" role="document"> + + + <div class="wy-grid-for-nav"> + + + <nav data-toggle="wy-nav-shift" class="wy-nav-side"> + <div class="wy-side-scroll"> + <div class="wy-side-nav-search"> + + + + <a href="#" class="icon icon-home"> JABAWS + + + + </a> + + + + + <div class="version"> + 2.2 + </div> + + + + +<div role="search"> + <form id="rtd-search-form" class="wy-form" action="search.html" method="get"> + <input type="text" name="q" placeholder="Search docs" /> + <input type="hidden" name="check_keywords" value="yes" /> + <input type="hidden" name="area" value="default" /> + </form> +</div> + + + </div> + + <div class="wy-menu wy-menu-vertical" data-spy="affix" role="navigation" aria-label="main navigation"> + + + + + + + <p class="caption"><span class="caption-text">Contents:</span></p> +<ul> +<li class="toctree-l1"><a class="reference internal" href="getting_started.html">Getting Started</a></li> +<li class="toctree-l1"><a class="reference internal" href="included_tools.html">Included Tools</a></li> +<li class="toctree-l1"><a class="reference internal" href="client.html">Command Line Client (CLI)</a></li> +<li class="toctree-l1"><a class="reference internal" href="war.html">Web Application Archive (WAR)</a></li> +<li class="toctree-l1"><a class="reference internal" href="va.html">Virtual Appliance (VA)</a></li> +<li class="toctree-l1"><a class="reference internal" href="advanced.html">Advanced Usage</a></li> +<li class="toctree-l1"><a class="reference internal" href="develop.html">For Developers</a></li> +<li class="toctree-l1"><a class="reference internal" href="stats.html">Usage Statistics</a></li> +<li class="toctree-l1"><a class="reference internal" href="citations.html">Citations</a></li> +<li class="toctree-l1"><a class="reference internal" href="changelog.html">Changelog</a></li> +</ul> + + + + </div> + </div> + </nav> + + <section data-toggle="wy-nav-shift" class="wy-nav-content-wrap"> + + + <nav class="wy-nav-top" role="navigation" aria-label="top navigation"> + + <i data-toggle="wy-nav-top" class="fa fa-bars"></i> + <a href="#">JABAWS</a> + + </nav> + + + + <div class="wy-nav-content"> + <div class="rst-content"> + + + + + + + + + + + + + + + + +<div role="navigation" aria-label="breadcrumbs navigation"> + + <ul class="wy-breadcrumbs"> + + <li><a href="#">Docs</a> »</li> + + <li>Welcome to JABAWS’s documentation!</li> + + + <li class="wy-breadcrumbs-aside"> + + + <a href="_sources/index.rst.txt" rel="nofollow"> View page source</a> + + + </li> + + </ul> + + + <hr/> +</div> + <div role="main" class="document" itemscope="itemscope" itemtype="http://schema.org/Article"> + <div itemprop="articleBody"> + + <div class="section" id="welcome-to-jabaws-s-documentation"> +<h1>Welcome to JABAWS’s documentation!<a class="headerlink" href="#welcome-to-jabaws-s-documentation" title="Permalink to this headline">¶</a></h1> +<p>Read on these documentation pages or go back to the <a class="reference external" href="../">JABAWS homepage</a>!</p> +<p>JABAWS documentation is also available in <em>pdf</em>. <a class="reference external" href="./jabaws_manual.pdf">Download it here</a>!</p> +<div class="toctree-wrapper compound"> +<p class="caption"><span class="caption-text">Contents:</span></p> +<ul> +<li class="toctree-l1"><a class="reference internal" href="getting_started.html">Getting Started</a><ul> +<li class="toctree-l2"><a class="reference internal" href="getting_started.html#jabaws-benefits">JABAWS Benefits</a></li> +<li class="toctree-l2"><a class="reference internal" href="getting_started.html#jabaws-distributions">JABAWS Distributions</a><ul> +<li class="toctree-l3"><a class="reference internal" href="getting_started.html#jalview-and-the-jabaws-public-server">Jalview and the JABAWS Public Server</a></li> +<li class="toctree-l3"><a class="reference internal" href="getting_started.html#command-line-client-cli">Command Line Client (CLI)</a></li> +<li class="toctree-l3"><a class="reference internal" href="getting_started.html#web-application-archive-war">Web Application aRchive (WAR)</a></li> +<li class="toctree-l3"><a class="reference internal" href="getting_started.html#virtual-appliance-va">Virtual Appliance (VA)</a></li> +</ul> +</li> +</ul> +</li> +<li class="toctree-l1"><a class="reference internal" href="included_tools.html">Included Tools</a><ul> +<li class="toctree-l2"><a class="reference internal" href="included_tools.html#multiple-sequence-alignment">Multiple Sequence Alignment</a></li> +<li class="toctree-l2"><a class="reference internal" href="included_tools.html#protein-disorder-prediction">Protein Disorder Prediction</a></li> +<li class="toctree-l2"><a class="reference internal" href="included_tools.html#amino-acid-conservation">Amino Acid Conservation</a></li> +<li class="toctree-l2"><a class="reference internal" href="included_tools.html#rna-secondary-structure">RNA Secondary Structure</a></li> +</ul> +</li> +<li class="toctree-l1"><a class="reference internal" href="client.html">Command Line Client (CLI)</a><ul> +<li class="toctree-l2"><a class="reference internal" href="client.html#installing">Installing</a></li> +<li class="toctree-l2"><a class="reference internal" href="client.html#usage">Usage</a></li> +<li class="toctree-l2"><a class="reference internal" href="client.html#example-usage">Example Usage</a></li> +</ul> +</li> +<li class="toctree-l1"><a class="reference internal" href="war.html">Web Application Archive (WAR)</a><ul> +<li class="toctree-l2"><a class="reference internal" href="war.html#installing">Installing</a></li> +<li class="toctree-l2"><a class="reference internal" href="war.html#usage">Usage</a></li> +<li class="toctree-l2"><a class="reference internal" href="war.html#troubleshooting">Troubleshooting</a></li> +</ul> +</li> +<li class="toctree-l1"><a class="reference internal" href="va.html">Virtual Appliance (VA)</a><ul> +<li class="toctree-l2"><a class="reference internal" href="va.html#installing">Installing</a></li> +<li class="toctree-l2"><a class="reference internal" href="va.html#usage">Usage</a></li> +<li class="toctree-l2"><a class="reference internal" href="va.html#configuration">Configuration</a><ul> +<li class="toctree-l3"><a class="reference internal" href="va.html#vm-configuration">VM configuration</a></li> +<li class="toctree-l3"><a class="reference internal" href="va.html#jabaws-configuration">JABAWS configuration</a></li> +</ul> +</li> +</ul> +</li> +<li class="toctree-l1"><a class="reference internal" href="advanced.html">Advanced Usage</a><ul> +<li class="toctree-l2"><a class="reference internal" href="advanced.html#valid-wsdl">Valid WSDL</a></li> +<li class="toctree-l2"><a class="reference internal" href="advanced.html#jabaws-configuration">JABAWS Configuration</a><ul> +<li class="toctree-l3"><a class="reference internal" href="advanced.html#local-engine-configuration">Local Engine Configuration</a></li> +<li class="toctree-l3"><a class="reference internal" href="advanced.html#cluster-engine-configuration">Cluster Engine Configuration</a></li> +<li class="toctree-l3"><a class="reference internal" href="advanced.html#executable-configuration">Executable Configuration</a></li> +<li class="toctree-l3"><a class="reference internal" href="advanced.html#defining-environment-variables-for-executables">Defining Environment Variables for Executables</a></li> +<li class="toctree-l3"><a class="reference internal" href="advanced.html#configure-jabaws-to-work-with-mafft">Configure JABAWS to Work with Mafft</a></li> +<li class="toctree-l3"><a class="reference internal" href="advanced.html#limiting-the-size-of-the-job-accepted-by-jabaws">Limiting the size of the job accepted by JABAWS</a></li> +<li class="toctree-l3"><a class="reference internal" href="advanced.html#pre-compiled-binaries">Pre-compiled binaries</a></li> +<li class="toctree-l3"><a class="reference internal" href="advanced.html#recompiling-binaries-for-your-system">Recompiling binaries for your system</a></li> +<li class="toctree-l3"><a class="reference internal" href="advanced.html#obtaining-or-reusing-binaries">Obtaining or reusing binaries</a></li> +</ul> +</li> +<li class="toctree-l2"><a class="reference internal" href="advanced.html#load-balancing">Load balancing</a></li> +<li class="toctree-l2"><a class="reference internal" href="advanced.html#testing-the-jabaws-server">Testing the JABAWS Server</a></li> +<li class="toctree-l2"><a class="reference internal" href="advanced.html#jabaws-internal-logging">JABAWS internal logging</a><ul> +<li class="toctree-l3"><a class="reference internal" href="advanced.html#jabaws-requests-logging">JABAWS requests logging</a></li> +</ul> +</li> +<li class="toctree-l2"><a class="reference internal" href="advanced.html#jabaws-and-google-analytics">JABAWS and Google Analytics</a></li> +<li class="toctree-l2"><a class="reference internal" href="advanced.html#jabaws-war-file-content">JABAWS War File Content</a></li> +</ul> +</li> +<li class="toctree-l1"><a class="reference internal" href="develop.html">For Developers</a><ul> +<li class="toctree-l2"><a class="reference internal" href="develop.html#source-code">Source Code</a></li> +<li class="toctree-l2"><a class="reference internal" href="develop.html#the-api">The API</a></li> +<li class="toctree-l2"><a class="reference internal" href="develop.html#structure-of-the-project">Structure of the project</a></li> +<li class="toctree-l2"><a class="reference internal" href="develop.html#the-code-structure">The code structure</a></li> +<li class="toctree-l2"><a class="reference internal" href="develop.html#unit-testing">Unit Testing</a></li> +<li class="toctree-l2"><a class="reference internal" href="develop.html#accessing-jabaws-from-your-program">Accessing JABAWS from your program</a><ul> +<li class="toctree-l3"><a class="reference internal" href="develop.html#web-services-functions-overview">Web services functions overview</a></li> +<li class="toctree-l3"><a class="reference internal" href="develop.html#structure-of-the-template-command-line-client">Structure of the template command line client</a></li> +<li class="toctree-l3"><a class="reference internal" href="develop.html#connecting-to-jabaws">Connecting to JABAWS</a></li> +<li class="toctree-l3"><a class="reference internal" href="develop.html#aligning-sequences">Aligning Sequences</a></li> +<li class="toctree-l3"><a class="reference internal" href="develop.html#checking-the-status-of-the-calculation">Checking the status of the calculation</a></li> +<li class="toctree-l3"><a class="reference internal" href="develop.html#aligning-with-presets">Aligning with presets</a></li> +<li class="toctree-l3"><a class="reference internal" href="develop.html#aligning-with-custom-parameters">Aligning with custom parameters</a></li> +<li class="toctree-l3"><a class="reference internal" href="develop.html#writing-alignments-to-a-file">Writing alignments to a file</a></li> +<li class="toctree-l3"><a class="reference internal" href="develop.html#a-complete-client-example">A complete client example</a></li> +</ul> +</li> +<li class="toctree-l2"><a class="reference internal" href="develop.html#adding-new-web-services">Adding new web-services</a><ul> +<li class="toctree-l3"><a class="reference internal" href="develop.html#brief-guide">Brief Guide</a></li> +<li class="toctree-l3"><a class="reference internal" href="develop.html#building-web-services-artifacts">Building web services artifacts</a></li> +<li class="toctree-l3"><a class="reference internal" href="develop.html#preparing-distributives">Preparing Distributives</a></li> +</ul> +</li> +</ul> +</li> +<li class="toctree-l1"><a class="reference internal" href="stats.html">Usage Statistics</a><ul> +<li class="toctree-l2"><a class="reference internal" href="stats.html#detailed-view">Detailed View</a></li> +<li class="toctree-l2"><a class="reference internal" href="stats.html#job-list">Job List</a></li> +<li class="toctree-l2"><a class="reference internal" href="stats.html#job-directory-contents">Job Directory Contents</a></li> +<li class="toctree-l2"><a class="reference internal" href="stats.html#configuring-jabaws-execution-statistics">Configuring JABAWS execution statistics</a></li> +<li class="toctree-l2"><a class="reference internal" href="stats.html#configuring-a-privileged-access-for-tomcat-web-application-server">Configuring a privileged access for Tomcat web application server</a></li> +</ul> +</li> +<li class="toctree-l1"><a class="reference internal" href="citations.html">Citations</a></li> +<li class="toctree-l1"><a class="reference internal" href="changelog.html">Changelog</a><ul> +<li class="toctree-l2"><a class="reference internal" href="changelog.html#version-2-2-released-xx-april-2017">Version 2.2 (Released XX April 2017)</a></li> +<li class="toctree-l2"><a class="reference internal" href="changelog.html#version-2-1-released-1st-oct-2013">Version 2.1 (Released 1st Oct 2013)</a></li> +<li class="toctree-l2"><a class="reference internal" href="changelog.html#version-2-0-1-released-2nd-jul-2013">Version 2.0.1 (Released 2nd Jul 2013)</a></li> +<li class="toctree-l2"><a class="reference internal" href="changelog.html#version-2-released-16th-dec-2011">Version 2 (Released 16th Dec 2011)</a></li> +</ul> +</li> +</ul> +</div> +<hr class="docutils" /> +<div class="admonition note"> +<p class="first admonition-title">Note</p> +<p class="last">This is an open source project. If you want to contribute or report an issue have a look at our <a class="reference external" href="https://source.jalview.org/crucible/changelog/jabaws">Git-tracker</a>.</p> +</div> +</div> + + + </div> + <div class="articleComments"> + + </div> + </div> + <footer> + + <div class="rst-footer-buttons" role="navigation" aria-label="footer navigation"> + + <a href="getting_started.html" class="btn btn-neutral float-right" title="Getting Started" accesskey="n" rel="next">Next <span class="fa fa-arrow-circle-right"></span></a> + + + </div> + + + <hr/> + + <div role="contentinfo"> + <p><a href="../">JABAWS 2.2</a> + © Copyright 2017, Peter Troshin, Alexander Sherstnev, Jim Procter, Alexey Drozdetskiy, Daniel Barton, Suzanne Duce, Fábio Madeira and Geoff Barton. + + </p> + </div> + Built with <a href="http://sphinx-doc.org/">Sphinx</a> using a <a href="https://github.com/snide/sphinx_rtd_theme">theme</a> provided by <a href="https://readthedocs.org">Read the Docs</a>. + +</footer> + </div> + </div> + + </section> + + </div> + + + + + + <script type="text/javascript"> + var DOCUMENTATION_OPTIONS = { + URL_ROOT:'./', + VERSION:'2.2', + LANGUAGE:'None', + COLLAPSE_INDEX:false, + FILE_SUFFIX:'.html', + HAS_SOURCE: true, + SOURCELINK_SUFFIX: '.txt' + }; + </script> + <script type="text/javascript" src="_static/jquery.js"></script> + <script type="text/javascript" src="_static/underscore.js"></script> + <script type="text/javascript" src="_static/doctools.js"></script> + + + + + + <script type="text/javascript" src="_static/js/theme.js"></script> + + + + + <script type="text/javascript"> + jQuery(function () { + SphinxRtdTheme.StickyNav.enable(); + }); + </script> + + +</body> +</html> \ No newline at end of file diff --git a/website/docs/jabaws_manual.pdf b/website/docs/jabaws_manual.pdf new file mode 100644 index 0000000..4067897 Binary files /dev/null and b/website/docs/jabaws_manual.pdf differ diff --git a/website/docs/objects.inv b/website/docs/objects.inv new file mode 100644 index 0000000..fa8c963 Binary files /dev/null and b/website/docs/objects.inv differ diff --git a/website/docs/search.html b/website/docs/search.html new file mode 100644 index 0000000..c2141ce --- /dev/null +++ b/website/docs/search.html @@ -0,0 +1,248 @@ + + +<!DOCTYPE html> +<!--[if IE 8]><html class="no-js lt-ie9" lang="en" > <![endif]--> +<!--[if gt IE 8]><!--> <html class="no-js" lang="en" > <!--<![endif]--> +<head> + <meta charset="utf-8"> + + <meta name="viewport" content="width=device-width, initial-scale=1.0"> + + <title>Search — JABAWS 2.2 documentation</title> + + + + + + + + + + + + + + + + + + <link rel="stylesheet" href="_static/css/theme.css" type="text/css" /> + + + + + + <link rel="index" title="Index" + href="genindex.html"/> + <link rel="search" title="Search" href="#"/> + <link rel="top" title="JABAWS 2.2 documentation" href="index.html"/> + + + <script src="_static/js/modernizr.min.js"></script> + +</head> + +<body class="wy-body-for-nav" role="document"> + + + <div class="wy-grid-for-nav"> + + + <nav data-toggle="wy-nav-shift" class="wy-nav-side"> + <div class="wy-side-scroll"> + <div class="wy-side-nav-search"> + + + + <a href="index.html" class="icon icon-home"> JABAWS + + + + </a> + + + + + <div class="version"> + 2.2 + </div> + + + + +<div role="search"> + <form id="rtd-search-form" class="wy-form" action="#" method="get"> + <input type="text" name="q" placeholder="Search docs" /> + <input type="hidden" name="check_keywords" value="yes" /> + <input type="hidden" name="area" value="default" /> + </form> +</div> + + + </div> + + <div class="wy-menu wy-menu-vertical" data-spy="affix" role="navigation" aria-label="main navigation"> + + + + + + + <p class="caption"><span class="caption-text">Contents:</span></p> +<ul> +<li class="toctree-l1"><a class="reference internal" href="getting_started.html">Getting Started</a></li> +<li class="toctree-l1"><a class="reference internal" href="included_tools.html">Included Tools</a></li> +<li class="toctree-l1"><a class="reference internal" href="client.html">Command Line Client (CLI)</a></li> +<li class="toctree-l1"><a class="reference internal" href="war.html">Web Application Archive (WAR)</a></li> +<li class="toctree-l1"><a class="reference internal" href="va.html">Virtual Appliance (VA)</a></li> +<li class="toctree-l1"><a class="reference internal" href="advanced.html">Advanced Usage</a></li> +<li class="toctree-l1"><a class="reference internal" href="develop.html">For Developers</a></li> +<li class="toctree-l1"><a class="reference internal" href="stats.html">Usage Statistics</a></li> +<li class="toctree-l1"><a class="reference internal" href="citations.html">Citations</a></li> +<li class="toctree-l1"><a class="reference internal" href="changelog.html">Changelog</a></li> +</ul> + + + + </div> + </div> + </nav> + + <section data-toggle="wy-nav-shift" class="wy-nav-content-wrap"> + + + <nav class="wy-nav-top" role="navigation" aria-label="top navigation"> + + <i data-toggle="wy-nav-top" class="fa fa-bars"></i> + <a href="index.html">JABAWS</a> + + </nav> + + + + <div class="wy-nav-content"> + <div class="rst-content"> + + + + + + + + + + + + + + + + +<div role="navigation" aria-label="breadcrumbs navigation"> + + <ul class="wy-breadcrumbs"> + + <li><a href="index.html">Docs</a> »</li> + + <li>Search</li> + + + <li class="wy-breadcrumbs-aside"> + + + + </li> + + </ul> + + + <hr/> +</div> + <div role="main" class="document" itemscope="itemscope" itemtype="http://schema.org/Article"> + <div itemprop="articleBody"> + + <noscript> + <div id="fallback" class="admonition warning"> + <p class="last"> + Please activate JavaScript to enable the search + functionality. + </p> + </div> + </noscript> + + + <div id="search-results"> + + </div> + + </div> + <div class="articleComments"> + + </div> + </div> + <footer> + + + <hr/> + + <div role="contentinfo"> + <p><a href="../">JABAWS 2.2</a> + © Copyright 2017, Peter Troshin, Alexander Sherstnev, Jim Procter, Alexey Drozdetskiy, Daniel Barton, Suzanne Duce, Fábio Madeira and Geoff Barton. + + </p> + </div> + Built with <a href="http://sphinx-doc.org/">Sphinx</a> using a <a href="https://github.com/snide/sphinx_rtd_theme">theme</a> provided by <a href="https://readthedocs.org">Read the Docs</a>. + +</footer> + </div> + </div> + + </section> + + </div> + + + + + + <script type="text/javascript"> + var DOCUMENTATION_OPTIONS = { + URL_ROOT:'./', + VERSION:'2.2', + LANGUAGE:'None', + COLLAPSE_INDEX:false, + FILE_SUFFIX:'.html', + HAS_SOURCE: true, + SOURCELINK_SUFFIX: '.txt' + }; + </script> + <script type="text/javascript" src="_static/jquery.js"></script> + <script type="text/javascript" src="_static/underscore.js"></script> + <script type="text/javascript" src="_static/doctools.js"></script> + <script type="text/javascript" src="_static/searchtools.js"></script> + + + + + + <script type="text/javascript" src="_static/js/theme.js"></script> + + + + + <script type="text/javascript"> + jQuery(function () { + SphinxRtdTheme.StickyNav.enable(); + }); + </script> + + <script type="text/javascript"> + jQuery(function() { Search.loadIndex("searchindex.js"); }); + </script> + + <script type="text/javascript" id="searchindexloader"></script> + + + +</body> +</html> \ No newline at end of file diff --git a/website/docs/searchindex.js b/website/docs/searchindex.js new file mode 100644 index 0000000..7bcdf2f --- /dev/null +++ b/website/docs/searchindex.js @@ -0,0 +1 @@ +Search.setIndex({docnames:["advanced","changelog","citations","client","develop","getting_started","included_tools","index","stats","va","war"],envversion:51,filenames:["advanced.rst","changelog.rst","citations.rst","client.rst","develop.rst","getting_started.rst","included_tools.rst","index.rst","stats.rst","va.rst","war.rst"],objects:{},objnames:{},objtypes:{},terms:{"0_17":0,"168h":8,"16th":7,"1st":7,"2nd":7,"378m":9,"512m":9,"6000m":0,"8cbe486":[1,6],"abstract":4,"boolean":4,"byte":[0,8],"case":[0,4,8,9],"class":[0,4],"default":[0,1,3,4,5,8,9],"enum":4,"export":0,"final":[0,4,5],"function":[0,3,5,7,10],"import":[2,4],"long":[0,4],"new":[0,1,3,5,7,9,10],"public":[4,7,10],"return":[0,1,4],"static":[0,4],"throw":4,"true":[0,4,8,10],"try":[0,10],"void":4,"while":4,Adding:7,DNS:9,For:[0,3,5,7,8,9,10],NOT:0,PBS:10,That:9,The:[0,1,3,5,7,8,9,10],Then:0,There:[0,4,8],These:[0,1,10],Use:4,Using:[0,3],aacon:[1,6],aaconw:[0,3],aamatrix:0,abandon:8,abil:4,abl:[0,1,3,4,8,9,10],about:[0,4,5,9,10],abov:[0,3,4,8,9,10],absolut:0,accept:[4,5,7,8],access:[0,1,3,5,7,9,10],accesslogvalv:0,accomplish:4,accord:0,accordingli:[0,4],account:[0,1,4],achiev:0,acid:[0,1,7],action:3,activ:0,actual:4,add:[4,9,10],added:[0,10],addit:[0,1,4],address:[0,9],adjust:0,admin:[8,9],administr:8,adminjabaw:9,advanc:[7,9],advantag:9,after:[0,4,8,9,10],again:0,against:[4,5],aim:4,alig:1,align:[0,1,2,3,5,7,9,10],all:[0,1,3,4,5,8,9,10],all_cluster_independent_test:4,all_cluster_independent_windows_only_test:4,allow:[0,1,2,3,5,8,9,10],allowlink:8,alon:5,alreadi:[0,10],also:[0,1,3,4,7,8,9],altern:[0,4,5,10],amazon:1,amd64:0,ami:1,amino:[0,1,7],amount:[0,8,9],analog:0,analysi:[0,1,2,5],analyt:[1,7],ani:[0,3,4,5,9,10],annot:4,anonym:0,anoth:[3,4,10],ant:[0,4],antiresourcelock:[8,10],anyon:[4,5],anyth:0,anywher:0,apach:[0,4,5,8,10],aparamet:3,apart:9,api:[1,3,7],app:5,appli:0,applianc:[7,8],applic:[0,1,3,7,9],appreci:0,appropri:[0,4],april:7,aptrvrskgplrvgfvsngfgahptglltvalfealqrrqpdlqmhlfatsgddgstlrtrlaqa:4,architectur:[0,5,10],archiv:[4,7,9],arg:4,argument:4,around:4,arraylist:4,artifact:7,ask:9,assum:[0,5,10],asynchron:[0,8],attempt:4,authent:[0,8],auto:9,autogener:0,autom:0,automat:[0,5,8,10],avail:[0,1,3,4,5,7,8,9,10],averag:0,avoid:[0,4,10],awstat:0,back:7,backward:1,balanc:7,bar:[3,4],barton:2,base:[0,8,9,10],basic:[0,3,4,10],batch:10,bear:9,becaus:[3,4,9],been:[1,3,4,8,9],befor:4,being:4,below:[0,1,3,4,5,8,9,10],benefit:7,besid:4,best:[0,9],better:[4,5,10],between:[0,4],bigger:0,bigmem:0,bin:[0,4],binari:[4,5,7,10],bind:0,bioinformat:[0,2,5,9],black:0,block:4,boot:[5,9],both:[0,1,3,5,10],bottom:[4,8],boundari:4,box:[0,9],bridg:9,brief:[5,7],browser:[0,5],btr304:2,bug:1,build:[0,7,10],bump:1,bundl:0,busi:0,button:5,bytearrayinputstream:4,calcul:[0,1,7,8,9],call:[0,1,3,4,10],caller:4,can:[0,3,4,5,8,9,10],cancel:[4,8],canceljob:4,cannot:[3,4,9],capac:10,catalina:[0,8,10],caution:4,cengin:0,chang:[0,1,3,4,5,8,9],changelog:7,charact:0,chase:0,check:[0,1,3,5,7,9,10],checker:0,chmod:0,choos:[0,5,9],chosen:0,chunk:4,chunkhold:4,citat:7,cite:2,clariti:3,classnam:0,clean:1,cli:[4,7],click:9,client:[0,1,7,9],client_help:4,clone:4,cloud:1,clustal:[1,3,4,6,8],clustalalignmentutil:4,clustalow:[0,3],clustalw2:0,clustalw:[0,1,3,4,6],clustalwsport:4,clustengin:0,cluster:[4,5,7,8,10],clusterengin:0,code:[0,3,7,10],coffe:[0,1,6],collect:[0,4,5,8],collector:8,color:0,column:8,come:[0,3,4,5,8,10],command:[0,7,9],comment:0,commerci:9,common:0,commun:[1,9],compar:1,compat:[1,4,5,10],compbio:[0,3,4],compil:[4,5,7,10],compilebin:[0,4,5],complain:0,complet:[0,5,7,8,10],compli:4,compliant:[0,3,5,10],complic:5,complil:4,complile_with_debug:4,compon:8,comput:[5,9],concern:5,condor:10,conf:[0,4,8,10],config:0,configur:[1,4,5,7,10],confirm:4,confus:4,connect:[0,5,7,9],conserv:[0,1,7],consid:8,consist:[4,5],consol:[3,9],constant:3,constraint:4,construct:4,constructor:4,consult:[8,10],consum:[3,5],contain:[0,1,4,5,8],content:[3,7,10],context:[0,3,5,8,10],contini:4,continu:2,contribut:[4,7],control:[3,4,5],convent:4,copi:[8,9],core:[0,9,10],correctli:0,correspond:[0,4],could:[0,1,3,4,10],couldn:0,coupl:0,cours:9,cpu:[0,9],crawler:8,creat:[0,4,8],credenti:9,css:0,current:[0,1,4,5,10],custom:[3,7],customalign:4,customsuit:4,customtest:4,dai:8,darlrafahaqgvdaqrlvfmpklphpqylaryrhadlfldthpynahttasdalwtgcpvlttp:4,data:[0,4,5,9],databas:[0,4,8],datamodel:4,date:[0,3,8,10],deal:[1,9],dealt:10,debian:9,debug:[0,4],dec:7,decid:[0,4],dedic:1,defin:[1,3,4,7,8],definit:0,delet:1,demand:4,depend:[0,4,5,8,10],deploi:[0,4,5,8,9,10],deploy:[0,10],depth:0,describ:[0,4,8,10],descript:[0,1,4,8],descriptor:[0,10],design:[1,4],desktop:5,detail:[0,3,4,7,10],dev2:0,develop:[3,5,7],dhcp:9,did:0,differ:[0,3,4,9,10],directli:[0,4],directori:[0,1,4,5,7,10],disabl:[0,4,8],discoveri:4,disembl:[1,6],disemblw:[0,3],disk:[9,10],disord:[0,1,5,7],displai:[4,8,9],distribut:[0,1,7,9,10],distro:4,divers:1,dm_javadoc:0,doc:4,document:[0,1,3,4,5,10],doe:[0,4,8,9],doesn:5,doi:2,doing:[0,4],done:[0,1,3,4,8],doubt:0,download:[0,1,3,4,5,7],dpaaltalharvdvlrresgvfemdgfaddfgallqalarrhgwlgi:4,drive:9,drmaa:[0,5,10],drop:[1,5,10],due:[1,8],dunde:[0,4,5],durat:4,dure:8,each:[0,1,4,8],eas:1,easi:[4,5],easier:9,easiest:[0,4,5],ec2:1,eclips:4,edit:[0,4,9],edu:3,eight:4,either:[0,3,5],elect:5,elimin:5,elsewher:0,empti:8,enabl:[0,1,5,8,9,10],encod:[0,8,10],encourag:[1,4],end:0,engin:[1,4,7,8,10],ensur:4,enter:[4,5],enumer:4,env:0,environ:[4,7,9,10],environment:4,equal:3,equip:0,error:[0,4,8],especi:0,etc:[0,3,4],evalu:0,even:0,everi:[4,8],everyth:0,exact:0,exactli:[0,3,4],examin:0,exampl:[0,5,7,8,10],excerpt:4,excess:[0,4],exclud:[4,8],exec_nam:0,exectu:4,execut:[1,3,4,5,7,10],executablenam:4,executablenameparamat:0,executionstatist:[0,4],exist:[0,1],expand:9,expend:4,experi:[0,10],explanatori:4,explicit:10,explicitli:0,exploit:0,extend:4,extract:1,fail:[0,1,4,10],failur:[4,8],fals:[0,8,10],fasta34:0,fasta:[0,1,3,4],fasta_4_mafft:0,fastalist:4,fastaparttre:3,fastasequ:4,faster:[0,9],fastest:0,fatal:0,favorit:3,favour:1,featur:4,feb:0,februari:8,femdgfaddfgallqalarrhgwlgi:4,few:[0,4,8],field:4,file:[3,5,7,8,9,10],fileinputstream:4,filenam:4,filenotfoundexcept:4,fileoutputstream:4,find:[0,4],fine:[4,9],finish:[4,8],first:[0,4,8,9],five:4,fix:1,flag:[4,10],flexibl:10,folder:[4,9,10],follow:[0,4,8,10],foo:4,foobar:3,foofriend:3,forget:0,format:[3,4],found:[0,4,8,10],four:[1,4],framework:4,free:9,freeli:9,friend:4,friendli:5,from:[0,1,3,5,6,7,8,9,10],full:[0,3,4],full_javadoc:0,fulli:[0,1],fund:[0,2],further:[0,2,4,8],furthermor:0,fusion:[5,9],futur:5,gap:4,gapopen:4,gapopenpenalti:4,gcc:0,gener:[0,1,4,8,10],geoffrei:2,get:[0,1,4,7],getargu:4,getbyt:4,getfaarvagslnhhlgldemnvaddaafvakavalasdpaaltalharvdvlrresi:4,getjobstatu:4,getlimit:4,getport:4,getpreset:4,getpresetbynam:4,getresult:4,getrunneropt:4,git:[4,7],gitweb:4,give:10,given:[0,4,5,10],globplot:6,globplotw:[0,3],globu:10,glprob:[1,6],glprobsw:0,gnu:5,going:[0,4],good:[0,5],googl:[1,7],googleanalyt:1,got:0,graphic:5,greater:[0,1],greatli:0,grid:10,gridwai:10,gridwar:0,group:[0,4,5,10],guid:[5,7],h_cpu:0,h_vmem:0,hand:4,handi:[0,3,4],handl:[3,4,10],hard:[4,9],hardwar:5,has:[0,1,3,4,5,8,9,10],hash:0,have:[0,1,4,5,7,8,9,10],health:0,heavi:9,heavili:[0,9],help:[0,1,2,4,5,8,9],here:[0,3,4,7,8,10],hierarchi:4,higher:3,hold:4,holder:4,home:[0,4],homepag:7,host:[0,3,4,9,10],host_and_context:3,hotloop:1,hour:8,how:[0,3,4,5],howev:[0,4,9,10],hptglltvalfealqrrqpdlqmhlfatsgddgstlrtrlaqastlhdvtalghlatakhirhhg:4,html:0,http:[0,3,4,5,9,10],httpcoderesponseservicestatu:0,huge:0,i386:0,idea:0,identif:1,identifi:4,idl:[0,4],idllfdlrgwggggrpevfalrpapvqvnwlaypgtsgapwmdyvlgdafalppalepfysehvl:4,ignor:3,imag:[0,1,9],impati:5,implement:[4,6,10],improv:[1,2],includ:[0,1,3,4,5,7],incompat:1,incomplet:8,incorpor:5,increas:0,independ:[0,3,4,10],index:0,indic:[8,9],individu:[0,8],inf:[0,4,5],influenc:0,info:[0,9],inform:[0,1,3,4,5,8,9,10],infrastructur:5,initi:[0,4,8],input:[0,3,4,8],inputfil:3,inputs:8,insert:4,insid:0,instal:[0,1,4,5,7],instanc:[0,3,4,10],instead:[0,4,5],institut:5,instruct:[3,5],integr:1,interest:5,interfac:[4,5],intern:7,internet:[5,9],interoper:[3,5],interruptedexcept:4,intranet:5,introduc:1,involv:4,ioexcept:4,ipv4:9,ipv6:9,iscancel:8,iscollect:8,isfinish:8,isol:4,issu:[4,7],its:[0,3,4,5,10],itself:0,iupr:6,iupredw:[0,3],jaba:[0,3,4,5,8,10],jabaw:[1,2,3,10],jabaws_serv:0,jalview:[1,4,7,9],jame:2,jan:8,januari:8,jar:[0,3,4,5],java:[0,2,3,4,5,6,9,10],java_hom:0,java_opt:0,javadoc:[0,4],javascript:0,javax:4,jax:4,jaxb:4,jaxw:4,jdk1:0,jdk:0,job:[1,3,4,5,7,10],jobid:[4,8],jobsout:[0,4],jobstatu:4,jobsubmissionexcept:4,jobtempl:0,jpred:1,jpredalig:1,jpredw:1,jre:0,jronn:[1,6],jronnw:[0,3],jsp:0,jul:7,junit:4,just:[0,3,5,9,10],jvm:[0,4],jws2:0,jws2client:4,keep:[4,9,10],kei:[3,8],keyboard:9,know:[0,4,10],known:[0,5],lab:[0,5,10],languag:[0,3,4,5],laptop:5,larg:[0,5,9],larger:9,last:8,later:[1,4,8],latest:1,latter:0,launch:5,layer:4,ld_library_path:[0,4],least:[0,5],leav:[0,4],length:0,let:[0,3,4,8,9,10],letter:0,level:[0,4],lfldthpynahttasdalwtgcpvlttpgetfaarvagslnhhlgldemnvaddaafvakavala:4,lib:[0,5],librari:[0,1,3,4,5,10],life:4,lightweight:0,like:[0,3,4,5,9],limit:[1,3,4,7,9,10],limitexceededexcept:4,limitsmanag:4,line:[0,7,9],link:[0,4,8],linux:[0,4,5,9,10],list:[0,1,3,4,5,7],littl:[0,4],llnwrrrlcdwraldvlsaqvraavaqgvgavepfaflsedasaaeqlacartraqaiaasvrpl:4,load:[4,7],local:[4,5,7,8,9,10],localengineexecutionlimit:0,localhost:[0,5,8,10],localhost_access_log:0,locat:[0,4,8,9],log4j:0,log:[7,8],logdir:0,login:[8,9],long_test:4,longer:[1,4],look:[0,4,7],lowercas:4,lrgwggggrpevfalrpapvqvnwlaypgtsgapwmdyvlgdafalppalepfysehvlrlqgaf:4,lsf:10,lx24:0,mac:[1,5,9,10],machin:[0,1,3,4,5,9,10],made:[4,8],mafft:[1,3,4,6,7],mafft_binari:0,mafftlimit:0,mafftparamet:0,mafftpreset:0,mafftw:[0,3],mai:[0,4,8,9,10],main:[0,4,5,8],make:[0,4,5,8,9,10],man_serverwar:0,manag:10,mani:[0,10],manipul:3,manner:5,manoeuvr:4,manual:[9,10],map:4,marker:4,match:4,matric:0,matrix:4,matter:3,maximum:[0,5,8],maxruntim:8,mayb:8,mean:[0,1,3,4,5,8,9],memori:[0,9,10],mention:4,menu:[0,5,9],messag:[0,9],meta:4,metadata:4,method:[0,1,4,5],mgdttagemavqrglalhq:3,mgdttagemavqrglalhqqrhaeaavllqqasdaapehpgialwlhaledagqaeaaaaytrah:4,might:[0,4,5,9,10],min:[3,4],mind:9,minimum:9,minor:1,minut:[4,8],miss:0,mode:4,model:[0,4],modifi:[0,4],monitor:[0,4],month:8,monthli:8,more:[0,1,3,4,5,8,9,10],most:[3,5,8,9],mostli:4,move:9,msa:4,msaprob:[1,6],msaprobsw:0,msaw:4,mtadgprellqlraav:3,mtadgprellqlraavrhrpqdfvawl:3,mtadgprellqlraavrhrpqdfvawlmladaelgmgdttagemavqrglalhpghpeavarlgr:4,mtadgprellqlraavrhrpqdvawlmladaelgmgdttagemavqrglalhpghpeavarlgrv:4,multi:8,multipl:[0,1,2,4,5,7],muscl:[0,6],musclew:[0,3],must:[0,1,10],myhost:[0,3],mylabserv:3,myuni:3,name:[0,3,4,5,8,9,10],namespac:4,nat:9,nativ:[0,3,4],natur:8,navig:[0,8],necessari:[4,10],necessarili:8,need:[0,3,4,5,8,9,10],net:4,network:9,never:[0,1,8],newer:1,next:[3,4],nine:4,node:[0,10],nofft:3,non:0,none:9,normal:0,noscor:3,note:[3,4,8],noth:[4,9],notic:4,now:[1,3,4],nput:3,nucleotid:0,number:[0,1,4,8,10],object:[1,4],obtain:[4,7],obvious:10,oct:7,off:3,offer:[0,1,4,9],offici:10,often:0,older:10,omega:[1,6],onc:[0,4,5,9],one:[0,1,3,4,5,8,9,10],ones:0,onli:[0,3,4,8,9,10],open:[0,3,4,5,7,9],oper:[0,5,9,10],oppos:8,optim:0,option:[0,1,3,4,5,8,9],optionlist:4,oracl:[9,10],order:[0,8],org:[0,4],organ:5,orient:[0,4],other:[0,3,4,5,8,9,10],otherwis:[0,10],our:[0,1,4,7],out:[0,3,4,8,10],output:[0,3,4],outputfil:3,outsid:[0,8,9],outstream:4,over:[3,5,9],overhead:0,overload:10,overview:[0,7],ovf:9,own:[0,3,5],packag:[0,1,3,4,5],page:[0,1,3,4,5,7,8,9],pam300:4,panel:5,parallel:[9,10],paramet:[0,1,3,7],parameterinputfil:3,parser:4,part:[0,3,4,5,8],parti:10,particular:[0,4,8,10],pass:[0,4],password:[8,9],path:[0,1,3,4,5,10],path_to_jar_fil:3,pattern:0,paus:4,pbspro:10,pdf:7,peer:1,per:8,perfectli:10,perform:[0,4,5],period:[1,4,8],pertain:4,peter:[2,8],pipedexecut:4,plai:9,plain:[4,8],platform:[4,9,10],player:[5,9],pleas:[0,3,4,8,9,10],plugin:4,point:[0,3,4,5,8,9,10],port:[0,4],portabl:4,posix:0,possibl:[8,9,10],post:0,power:[0,9],powerpc:10,pqsmarmlavlrevpdsvlwllsgpgeadarlrafahaqgvdaqrlvfmpklphpqylaryrhad:4,pre:[1,4,7,9,10],predict:[0,1,5,7],prefer:[0,5,9],prefix:0,prepar:[7,9],preprocess:8,present:8,preset:[0,3,7],presetalign:4,presetman:4,presetmanag:4,presetnam:[3,4],press:5,prevent:[0,4,10],previou:4,print:3,println:4,privaci:5,privat:[0,4,5,9,10],privileg:[7,10],prm:3,probabl:0,probcon:[0,6],probconsw:[0,3],problem:[0,4],procedur:[4,10],procerror:8,process:[0,1,3,4,8],procoutput:8,procter:2,produc:[0,8],product:[0,9],profil:[0,4],prog_doc:0,program:[0,1,3,5,7,9,10],programmat:3,prohibit:0,project:[1,2,7],prolong:4,proper:1,properti:[0,1,4,8],protein:[0,1,5,7],protocol:0,provid:[0,1,3,4,5,9],proxi:4,publicli:[4,5],publish:0,pullexecstatist:4,purpos:0,put:[0,4,10],pvlttpgetfaarvagslnhhlgldemnvaddaafvakavalasdpaaltalharvdvlrresgv:4,qllpeepyitaqllnavaqgvgavepfaflsedasaaesvrplaptrvrskgplrvgfvsngfga:4,qname:4,qpsdtsrvvaeppsrtqcglpeqgvvlccfnnsyklnpqsmarmlavlrevpdsvlwllsgpgea:4,qualifi:4,qualifiednam:4,qualifiedservicenam:4,queer:0,queri:0,quickstart:5,rais:0,ram:[0,9],rang:5,rather:9,read:[0,4,5,7,10],readfasta:4,readi:5,real:4,reason:0,rebuild:4,rebuilt:4,recent:0,recheck:4,recommend:[0,1,3,4,5,9,10],recompil:[4,7,10],reconfigur:9,record:[1,4,8],redirect:0,reduc:[0,10],refer:[0,4,9],reflect:1,refus:10,regist:4,reject:0,rel:0,relat:[0,4],releas:7,rem465:1,remot:0,remov:[0,10],repeat:0,replac:[0,1,4,8],report:[0,4,7],repositori:[0,4],repres:4,request:[4,7,8,10],requir:[0,1,4,5,9,10],rerun_failed_test:4,reserv:0,reset:4,resid:[0,10],resili:10,resolut:0,resolvehost:0,resourc:[0,4,9],respect:[0,8],respond:0,respons:0,rest:[1,10],restart:[0,8,10],restructuredtext:4,result:[0,4,8],resultnotavailableexcept:4,results:8,retre:3,retriev:[0,4,8],reus:[4,7],review:0,right:10,rlqgafqpsdtsrvvaeppsrtqcglpeqgvvlccfnnsyklnpqsmarmlavlrevpdsvlwl:4,rna:[0,7],rnaalifold:6,rnaalifoldw:[0,1],rnastructscoremanag:1,role:8,rolenam:8,ronn:6,root:[4,9,10],rout:9,row:8,rule:0,run:[0,1,3,4,5,8,9,10],run_cluster_dependent_test:4,runner:4,runnerconfig:[4,8],runtest:4,runtim:[8,10],rwtqqrhaeaavllqqasdaapehpgialwlghaledhqllpeepyitaqldvlsaqvraavaqg:4,sai:9,same:[0,3,4,5,8,9,10],satisfi:4,scientif:1,score:1,scoremanag:1,screen:[0,9],screenshot:8,script:[0,3,4,5,10],search:0,second:[4,8],secondari:[0,1,7],section:[0,4,8],secur:[1,5],see:[0,3,4,5,8,9],select:5,self:4,semicolon:0,send:[5,10],sensit:5,sent:0,separ:[0,3,10],sequenc:[0,1,2,3,5,7],sequenceannot:4,sequencelist:4,sequenceutil:4,sequenti:4,serial:4,serv:[0,4,10],server:[3,4,7,9,10],server_url:0,servic:[0,1,2,3,5,7,8,9,10],servicenam:[0,3],servicestatu:0,servlet:[1,10],set:[0,3,4,8,9,10],setenv:0,setexecflag:[0,4],setexecutableflag:4,setnativespecif:0,setup:5,setvalu:4,seven:4,sever:[0,1,4,5],sftp:9,sge:0,sge_root:0,sgpgeadarlrafahaqgvdaqrlvfmpklphpqylaryrhadlfldthpynahttasdalwtgc:4,share:10,shell:9,ship:5,shot:9,should:[0,1,4,5,8,9,10],show:[3,8],shown:[3,5],side:4,sign:[1,3],signific:0,silent:4,similar:[4,9],similarli:9,simpl:[0,4,5],simplest:8,simpli:[0,4,5,9,10],simplifi:[0,1],sinc:[0,4,10],singl:[5,9,10],site:[3,10],six:4,size:[5,7,8],skeletalexecut:4,sleep:4,slightli:5,small:[0,10],smaller:0,soap:[0,3,4,5],softwar:[3,4,5],some:[0,1,4],someth:4,sometim:[4,8,10],soon:[5,8,9],sourc:[0,3,5,7,10],space:[4,10],special:4,specif:[0,3,4,10],specifi:[0,3,8],speed:[0,4],sphinx:1,split:4,squeez:9,src:[0,4,5],ssh:9,stabil:4,stage:4,stand:5,standalon:9,standard:[0,1,4,8],standlon:9,start:[0,7,8,9],startup:0,stat:8,statist:[0,1,4,7],statpag:[0,4],statu:[0,1,5,7],step:0,still:10,stlhdvtalghlatakhirhhgidllfdlrgwggggrpevfalrpapvqvnwlaypgtsgapwmd:4,stop:1,storag:0,store:[0,4],stori:8,straight:0,straightforward:5,stream:8,string:[1,4],structur:[0,1,7],stub:4,subfold:4,submiss:0,submit:[0,4,5,8],substitut:0,successfulli:0,suffici:[4,9,10],suffix:0,suggest:[0,4,5],suit:[0,4,5,9],suitabl:0,summari:8,sun:[0,4,10],suppli:[0,1,4,10],support:[0,1,3,4,5,9,10],sure:[0,4,8,10],swap:1,symbol:[0,1,8],system:[4,5,7,8,9,10],tabl:[0,8],take:[0,4,9],task:[0,4,5,9,10],tcoffeew:[0,3],tell:0,temp:4,templat:7,temporari:[0,4,8],ten:4,tend:4,termin:0,test:[3,5,7,9,10],testcas:4,testng:4,testoutput:0,testsrc:4,text:[4,8],than:[0,1,4,9,10],thei:[0,4,5,9],them:[0,3,4,5,9,10],thi:[0,1,3,4,5,7,8,9,10],thin:4,third:[4,10],though:4,thread:[0,1,4,10],three:[0,4],through:[4,5],thu:[0,4],thw:0,time:[0,4,8,9],timestamp:8,tip:0,titl:8,tmp:0,togeth:[3,4],tomcat:[0,1,5,7,9,10],tomcat_dir:0,tomcat_root:[0,8],tomcatroot:10,too:[0,5,10],tool:[0,4,5,7,9],top:4,tostr:4,total:8,trace:0,tracker:[4,7],treat:0,trim:3,troshin:2,troubleshoot:7,tune:9,turnkei:[5,9],tvalfealqrrqpdlqmhlfatsgddgstlrtrlaqastlhdvtalghlatakhirhhgidllfd:4,two:[0,1,4,10],txt:[0,4,8],type:[0,4,5],uncom:0,undeploi:10,undeploy:10,under:[0,4,5],underneath:4,uniqu:8,unit:7,univers:[0,4,5],unix:[5,8],unless:9,unlik:[5,9],unpack:[5,9,10],unsupportedruntimeexcept:4,until:[0,4],updat:[0,1,4],upon:[0,4],upper:4,url:[0,3,4,5,9,10],us_intl:9,usag:7,use:[0,1,2,3,4,5,8,9,10],used:[0,1,3,4,9,10],useful:[0,3,4],user:[0,1,5,8,9,10],usernam:8,uses:[0,4,5,9,10],using:[0,3,4,5,8,10],utf:[8,10],util:[0,4],valid:7,valu:[0,3,4],valv:0,variabl:[4,7],variou:0,veri:[0,1,4,5],version:[0,3,5,6,7,8,9,10],vgavepfaflsedasaaeqlacartraqaiaasvrplaptrvrskgplrvgfvsngfgahptgl:4,via:[3,5,9],viennarna:6,view:[4,7],violat:4,virtial:9,virtual:[0,7,8],virtualbox:[1,9],visial:0,visit:5,visual:[1,8],visualis:8,vm_ip:9,vmware:[1,5,9],vmx:9,vrwtqqrhaeaavllqqasdaapehpgialwlghaledagqaeaaaaaytrahqllpeepyitaq:4,vwmare:9,wai:[0,3,4,5,8,9],wait:[0,4],want:[0,3,4,5,7,9],war:[1,4,7,8,9],warn:0,wast:0,watch:4,web:[0,1,2,3,7,9],webal:0,webapp:[0,5,10],webapplicationpath:0,webmean:9,webservic:[0,4,5],websit:[1,4],weight:4,welcom:3,well:[0,4,5,10],were:[1,4,8,10],what:[0,5,9],whatev:[0,4],when:[0,2,8,9],whenev:4,where:[0,3,4,5,8,9],wherea:0,whether:[4,8,9],which:[0,1,3,4,5,8,9,10],who:[0,4,5,9],whole:[0,8],whose:8,why:0,wide:5,window:[0,4,5,9,10],wish:0,within:[0,1,4,8],without:[0,4,9,10],work:[2,4,5,7,9,10],would:[0,3,4,5,9],wrap:4,wrapper:4,write:[3,5,7],writeclustalalign:4,written:0,wrongparameterexcept:4,wsbuild:4,wsdl:[4,7],wsimport:[0,4],www:[0,4,10],x86:[0,10],xincgc:0,xml:[0,4,8,10],xms512m:0,xmx1024m:0,xxx:0,xxxlimit:0,xxxparamet:[0,4],xxxpreset:0,yesterdai:3,you:[0,2,3,4,5,7,8,9,10],your:[3,5,7,8,9,10],your_jaba_context_nam:0,your_jabaws_server_url:0,yourself:[0,5],yvlgdafalppalepfysehvlrlqgafqpsdtsrvvaeppsrtqcglpeqgvvlccfnnsykln:4,zip:10},titles:["Advanced Usage","Changelog","Citations","Command Line Client (CLI)","For Developers","Getting Started","Included Tools","Welcome to JABAWS’s documentation!","Usage Statistics","Virtual Appliance (VA)","Web Application Archive (WAR)"],titleterms:{"16th":1,"1st":1,"2nd":1,"function":4,"new":4,"public":5,Adding:4,For:4,The:4,accept:0,access:[4,8],acid:6,advanc:0,align:[4,6],amino:6,analyt:0,api:4,applianc:[5,9],applic:[5,8,10],april:1,archiv:[5,10],artifact:4,balanc:0,benefit:5,binari:0,brief:4,build:4,calcul:4,changelog:1,check:4,citat:2,cli:[3,5],client:[3,4,5],cluster:0,code:4,command:[3,4,5],compil:0,complet:4,configur:[0,8,9],connect:4,conserv:6,content:[0,8],custom:4,dec:1,defin:0,detail:8,develop:4,directori:8,disord:6,distribut:[4,5],document:7,engin:0,environ:0,exampl:[3,4],execut:[0,8],file:[0,4],from:4,get:5,googl:0,guid:4,includ:6,instal:[3,9,10],intern:0,jabaw:[0,4,5,7,8,9],jalview:5,job:[0,8],jul:1,limit:0,line:[3,4,5],list:8,load:0,local:0,log:0,mafft:0,multipl:6,obtain:0,oct:1,overview:4,paramet:4,pre:0,predict:6,prepar:4,preset:4,privileg:8,program:4,project:4,protein:6,recompil:0,releas:1,request:0,reus:0,rna:6,secondari:6,sequenc:[4,6],server:[0,5,8],servic:4,size:0,sourc:4,start:5,statist:8,statu:4,structur:[4,6],system:0,templat:4,test:[0,4],tomcat:8,tool:6,troubleshoot:10,unit:4,usag:[0,3,8,9,10],valid:0,variabl:0,version:1,view:8,virtual:[5,9],war:[0,5,10],web:[4,5,8,10],welcom:7,work:0,write:4,wsdl:0,your:[0,4]}}) \ No newline at end of file diff --git a/website/docs/stats.html b/website/docs/stats.html new file mode 100644 index 0000000..96abbb2 --- /dev/null +++ b/website/docs/stats.html @@ -0,0 +1,352 @@ + + +<!DOCTYPE html> +<!--[if IE 8]><html class="no-js lt-ie9" lang="en" > <![endif]--> +<!--[if gt IE 8]><!--> <html class="no-js" lang="en" > <!--<![endif]--> +<head> + <meta charset="utf-8"> + + <meta name="viewport" content="width=device-width, initial-scale=1.0"> + + <title>Usage Statistics — JABAWS 2.2 documentation</title> + + + + + + + + + + + + + + + + + + <link rel="stylesheet" href="_static/css/theme.css" type="text/css" /> + + + + + + <link rel="index" title="Index" + href="genindex.html"/> + <link rel="search" title="Search" href="search.html"/> + <link rel="top" title="JABAWS 2.2 documentation" href="index.html"/> + <link rel="next" title="Citations" href="citations.html"/> + <link rel="prev" title="For Developers" href="develop.html"/> + + + <script src="_static/js/modernizr.min.js"></script> + +</head> + +<body class="wy-body-for-nav" role="document"> + + + <div class="wy-grid-for-nav"> + + + <nav data-toggle="wy-nav-shift" class="wy-nav-side"> + <div class="wy-side-scroll"> + <div class="wy-side-nav-search"> + + + + <a href="index.html" class="icon icon-home"> JABAWS + + + + </a> + + + + + <div class="version"> + 2.2 + </div> + + + + +<div role="search"> + <form id="rtd-search-form" class="wy-form" action="search.html" method="get"> + <input type="text" name="q" placeholder="Search docs" /> + <input type="hidden" name="check_keywords" value="yes" /> + <input type="hidden" name="area" value="default" /> + </form> +</div> + + + </div> + + <div class="wy-menu wy-menu-vertical" data-spy="affix" role="navigation" aria-label="main navigation"> + + + + + + + <p class="caption"><span class="caption-text">Contents:</span></p> +<ul class="current"> +<li class="toctree-l1"><a class="reference internal" href="getting_started.html">Getting Started</a></li> +<li class="toctree-l1"><a class="reference internal" href="included_tools.html">Included Tools</a></li> +<li class="toctree-l1"><a class="reference internal" href="client.html">Command Line Client (CLI)</a></li> +<li class="toctree-l1"><a class="reference internal" href="war.html">Web Application Archive (WAR)</a></li> +<li class="toctree-l1"><a class="reference internal" href="va.html">Virtual Appliance (VA)</a></li> +<li class="toctree-l1"><a class="reference internal" href="advanced.html">Advanced Usage</a></li> +<li class="toctree-l1"><a class="reference internal" href="develop.html">For Developers</a></li> +<li class="toctree-l1 current"><a class="current reference internal" href="#">Usage Statistics</a><ul> +<li class="toctree-l2"><a class="reference internal" href="#detailed-view">Detailed View</a></li> +<li class="toctree-l2"><a class="reference internal" href="#job-list">Job List</a></li> +<li class="toctree-l2"><a class="reference internal" href="#job-directory-contents">Job Directory Contents</a></li> +<li class="toctree-l2"><a class="reference internal" href="#configuring-jabaws-execution-statistics">Configuring JABAWS execution statistics</a></li> +<li class="toctree-l2"><a class="reference internal" href="#configuring-a-privileged-access-for-tomcat-web-application-server">Configuring a privileged access for Tomcat web application server</a></li> +</ul> +</li> +<li class="toctree-l1"><a class="reference internal" href="citations.html">Citations</a></li> +<li class="toctree-l1"><a class="reference internal" href="changelog.html">Changelog</a></li> +</ul> + + + + </div> + </div> + </nav> + + <section data-toggle="wy-nav-shift" class="wy-nav-content-wrap"> + + + <nav class="wy-nav-top" role="navigation" aria-label="top navigation"> + + <i data-toggle="wy-nav-top" class="fa fa-bars"></i> + <a href="index.html">JABAWS</a> + + </nav> + + + + <div class="wy-nav-content"> + <div class="rst-content"> + + + + + + + + + + + + + + + + +<div role="navigation" aria-label="breadcrumbs navigation"> + + <ul class="wy-breadcrumbs"> + + <li><a href="index.html">Docs</a> »</li> + + <li>Usage Statistics</li> + + + <li class="wy-breadcrumbs-aside"> + + + <a href="_sources/stats.rst.txt" rel="nofollow"> View page source</a> + + + </li> + + </ul> + + + <hr/> +</div> + <div role="main" class="document" itemscope="itemscope" itemtype="http://schema.org/Article"> + <div itemprop="articleBody"> + + <div class="section" id="usage-statistics"> +<h1>Usage Statistics<a class="headerlink" href="#usage-statistics" title="Permalink to this headline">¶</a></h1> +<p>JABAWS comes with a web application for visualizing usage statistics. The screenshot below shows the main page of this application. The individual month is linked to detailed usage statistics (described later). Please note, that the links to the detailed monthly statistics are only available for authenticated users in the role admin. There is a link at the bottom of the page that lets you login, if you have not done so.</p> +<p>If you are using JABAWS VA (Virtual Appliance) then the username is <em>jabaws</em> and password is not defined, i.e. empty.</p> +<p>If you have deployed a JABAWS WAR file, then please see the <a class="reference external" href="stats.htmll#configuring-a-privileged-access-for-tomcat-web-application-server">configuring privileged access</a> for Tomcat web application server section for further details.</p> +<a class="reference internal image-reference" href="_images/usage_statistics_main.gif"><img alt="_images/usage_statistics_main.gif" class="align-left" src="_images/usage_statistics_main.gif" style="width: 608.0px; height: 318.0px;" /></a> +<p>The table contains the number of jobs processed by JABAWS per month, for the whole period when the statistics was collected.</p> +<p>For each month the table contains the following information.</p> +<ul class="simple"> +<li>Month - the period of time for which statistics is displayed. For example Jan 2011 means period of time from the first of January to the first of February</li> +<li>Total - the total number of jobs accepted by JABAWS</li> +<li>Incomplete - the number of jobs for which the result file was not found or was empty excluding cancelled</li> +<li>Cancelled - the number of jobs cancelled by the user</li> +<li>Abandoned - the number of jobs which result(s) were not collected</li> +</ul> +<p>The summary for each column is displayed in the last row of the table.</p> +<hr class="docutils" /> +<div class="section" id="detailed-view"> +<span id="stat-details"></span><h2>Detailed View<a class="headerlink" href="#detailed-view" title="Permalink to this headline">¶</a></h2> +<p>Detailed execution statistics for each month is available for authenticated users only.</p> +<a class="reference internal image-reference" href="_images/usage_statistics_month.gif"><img alt="_images/usage_statistics_month.gif" class="align-left" src="_images/usage_statistics_month.gif" style="width: 670.0px; height: 902.0px;" /></a> +<p>Each table contains the number of jobs processed by JABAWS during the period of time specified in the title:</p> +<ul class="simple"> +<li>The “All Jobs” table contains the summary of all jobs</li> +<li>“Local Jobs” table - contains the summary of the jobs calculated by the local engine</li> +<li>“Cluster Jobs” table - contains the summary of the jobs calculated by the cluster</li> +</ul> +<p>Each table contains the following information for each web service:</p> +<ul class="simple"> +<li>Total - the total number of jobs accepted by a particular JABA service</li> +<li>Incomplete - the number of jobs for which the result file was not found or was empty excluding cancelled</li> +<li>Cancelled - the number of jobs cancelled by the user</li> +<li>Abandoned - the number of jobs which result(s) were not collected</li> +</ul> +<hr class="docutils" /> +</div> +<div class="section" id="job-list"> +<span id="stat-jobs"></span><h2>Job List<a class="headerlink" href="#job-list" title="Permalink to this headline">¶</a></h2> +<p>Please note that if you deployed JABAWS WAR, in order to be able to navigate to the job directory from this view, the application server may need to be configured. Please see the <a class="reference external" href="stats.html#configuring-jabaws-execution-statistics">Configuring JABAWS execution statistics</a> section for further details.</p> +<a class="reference internal image-reference" href="_images/usage_statistics_details.gif"><img alt="_images/usage_statistics_details.gif" class="align-left" src="_images/usage_statistics_details.gif" style="width: 917.0px; height: 198.0px;" /></a> +<p>Columns:</p> +<ul class="simple"> +<li>JobID - the JABAWS job id, unique for every job</li> +<li>Cluster JobID - cluster job id</li> +<li>InputSize - input size in bytes</li> +<li>ResultSize - result size in bytes</li> +<li>Runtime (s) - job’s runtime in seconds</li> +<li>Start time (s)- job’s start time and date</li> +<li>Finish time (s)- job’s finish time and date</li> +<li>isCancelled - whether the job was cancelled</li> +<li>isCollected - whether the job was collected. False for the jobs that has been initiated but which results has never been retrieved</li> +<li>isFinished - whether the job has finished. This does not necessarily mean that the job has produced the result. The job can sometime finish in failure</li> +</ul> +<hr class="docutils" /> +</div> +<div class="section" id="job-directory-contents"> +<span id="stat-dir-contents"></span><h2>Job Directory Contents<a class="headerlink" href="#job-directory-contents" title="Permalink to this headline">¶</a></h2> +<a class="reference internal image-reference" href="_images/usage_statistics_job_details.gif"><img alt="_images/usage_statistics_job_details.gif" class="align-left" src="_images/usage_statistics_job_details.gif" style="width: 644.4px; height: 378.0px;" /></a> +<p>STARTED and FINISHED files contain Unix timestamp - when the job was started and completed respectively. STARTED is replaced by SUBMITTED if the job has been submitted to the cluster, as opposed to executed locally, on the server.</p> +<p>COLLECTED file is empty and indicates that the job results were collected by the user. Due to asynchronous nature of the job it is possible that the job was started and finished, but the results has never been requested.</p> +<p>RunnerConfig.xml file contains a complete description of the job and JABAWS can restart the job based on this description.</p> +<p>procError.txt and procOutput.txt files contains the content of the standard out and standard error streams of the process.</p> +<p>result.txt file contains the results.</p> +<p>input.txt file contains input into the process.</p> +<p>There are maybe other files depending on the nature of the job, but the one described above will be present in most cases. In this example, stat.log file stories the execution statistics generated by (clustal executable in this example) process.</p> +<p>If you have deployed JABAWS WAR file or made changes to JABAWS configuration you may need to make a few changes to the Tomcat configuration to be able to see the content of the job directory. Please see the <a class="reference external" href="stats.html#configuring-jabaws-execution-statistics">Configuring JABAWS execution statistics</a> section for further details.</p> +</div> +<div class="section" id="configuring-jabaws-execution-statistics"> +<span id="stat-config"></span><h2>Configuring JABAWS execution statistics<a class="headerlink" href="#configuring-jabaws-execution-statistics" title="Permalink to this headline">¶</a></h2> +<p>JABAWS execution statistics is a multi-component system. First is a crawler whose job is to collect and preprocess the statistics from the job temporary directories and record the collected statistics into the database. The second part of the system is a web application whose job is to visualise the statistics from the database.</p> +<p>It is possible to enable/disable the statistics collector by changing the following properties in the <code class="docutils literal"><span class="pre">conf/Cluster.engine.properties</span></code> and <code class="docutils literal"><span class="pre">conf/Local.engine.properties</span></code> files.</p> +<div class="highlight-bash"><div class="highlight"><pre><span></span><span class="c1"># Enable/disable cluster statistics collector true = enable, false = disable</span> +cluster.stat.collector.enable<span class="o">=</span><span class="nb">false</span> +<span class="c1"># Maximum amount of time the job is considered be running in hours. Optional defaults to 7 days (168h)</span> +cluster.stat.maxruntime<span class="o">=</span><span class="m">24</span> +</pre></div> +</div> +<div class="highlight-bash"><div class="highlight"><pre><span></span><span class="c1"># Enable/disable cluster statistics collector true = enable, false = disable</span> +local.stat.collector.enable<span class="o">=</span><span class="nb">true</span> +<span class="c1"># Maximum amount of time the job is considered to be running in hours. Optional defaults to 24 hours</span> +local.stat.maxruntime<span class="o">=</span><span class="m">6</span> +</pre></div> +</div> +<p>If the statistics collector is enabled then the crawler starts automatically soon after (10 minutes for local engine, and 60 minutes for cluster engine) the JABAWS web application and will be collecting the execution statistics every 24 hours after the start.</p> +<p>The details of the job are only available if the job temporary directory is located within a JABAWS web application. If not, the system administrator can create a symbolic link pointing to the temporary job directories outside of a web application and configure the application server to allow navigation to the links. For the Tomcat application server the context configuration file should be created and copied to the <code class="docutils literal"><span class="pre"><TOMCAT_ROOT>/conf/Catalina/localhost</span></code> directory. The name of the file should be the same as the web application context name, for example <em>jabaws.xml</em> for jabaws. Where the <code class="docutils literal"><span class="pre">TOMCAT_ROOT</span></code> is the location of the Tomcat web application server. Here is an example of such a file:</p> +<div class="highlight-xml"><div class="highlight"><pre><span></span><span class="cp"><?xml version="1.0" encoding="UTF-8"?></span> +<span class="nt"><Context</span> <span class="na">antiResourceLocking=</span><span class="s">"false"</span> <span class="na">privileged=</span><span class="s">"true"</span> <span class="na">allowLinking=</span><span class="s">"true"</span><span class="nt">/></span> +</pre></div> +</div> +<p>The key option here is this: <code class="docutils literal"><span class="pre">allowLinking="true"</span></code>. Please also make sure that you have defined the user in role <em>admin</em> as described <a class="reference external" href="stats.htmll#configuring-a-privileged-access-for-tomcat-web-application-server">below</a>.</p> +</div> +<div class="section" id="configuring-a-privileged-access-for-tomcat-web-application-server"> +<span id="stat-tomcat-users"></span><h2>Configuring a privileged access for Tomcat web application server<a class="headerlink" href="#configuring-a-privileged-access-for-tomcat-web-application-server" title="Permalink to this headline">¶</a></h2> +<p>Access to configuration files, detailed job execution statistics and job directories are allowed only for authenticated users in role <em>admin</em>.</p> +<p>If you use Tomcat, then the simplest way to set up privileged access is to use a plain text configuration file <code class="docutils literal"><span class="pre">conf/tomcat-user.xml</span></code>. Here is an example of such configuration file defining user “peter” in role <em>admin</em>.</p> +<div class="highlight-xml"><div class="highlight"><pre><span></span><span class="nt"><tomcat-users></span> +<span class="nt"><role</span> <span class="na">rolename=</span><span class="s">"admin"</span><span class="nt">/></span> +<span class="nt"><user</span> <span class="na">username=</span><span class="s">"peter"</span> <span class="na">password=</span><span class="s">"your password here "</span> <span class="na">roles=</span><span class="s">"admin"</span><span class="nt">/></span> +<span class="nt"></tomcat-users></span> +</pre></div> +</div> +<p>For more information on users and roles please consult Apache-Tomcat help pages.</p> +</div> +</div> + + + </div> + <div class="articleComments"> + + </div> + </div> + <footer> + + <div class="rst-footer-buttons" role="navigation" aria-label="footer navigation"> + + <a href="citations.html" class="btn btn-neutral float-right" title="Citations" accesskey="n" rel="next">Next <span class="fa fa-arrow-circle-right"></span></a> + + + <a href="develop.html" class="btn btn-neutral" title="For Developers" accesskey="p" rel="prev"><span class="fa fa-arrow-circle-left"></span> Previous</a> + + </div> + + + <hr/> + + <div role="contentinfo"> + <p><a href="../">JABAWS 2.2</a> + © Copyright 2017, Peter Troshin, Alexander Sherstnev, Jim Procter, Alexey Drozdetskiy, Daniel Barton, Suzanne Duce, Fábio Madeira and Geoff Barton. + + </p> + </div> + Built with <a href="http://sphinx-doc.org/">Sphinx</a> using a <a href="https://github.com/snide/sphinx_rtd_theme">theme</a> provided by <a href="https://readthedocs.org">Read the Docs</a>. + +</footer> + </div> + </div> + + </section> + + </div> + + + + + + <script type="text/javascript"> + var DOCUMENTATION_OPTIONS = { + URL_ROOT:'./', + VERSION:'2.2', + LANGUAGE:'None', + COLLAPSE_INDEX:false, + FILE_SUFFIX:'.html', + HAS_SOURCE: true, + SOURCELINK_SUFFIX: '.txt' + }; + </script> + <script type="text/javascript" src="_static/jquery.js"></script> + <script type="text/javascript" src="_static/underscore.js"></script> + <script type="text/javascript" src="_static/doctools.js"></script> + + + + + + <script type="text/javascript" src="_static/js/theme.js"></script> + + + + + <script type="text/javascript"> + jQuery(function () { + SphinxRtdTheme.StickyNav.enable(); + }); + </script> + + +</body> +</html> \ No newline at end of file diff --git a/website/docs/va.html b/website/docs/va.html new file mode 100644 index 0000000..74e3316 --- /dev/null +++ b/website/docs/va.html @@ -0,0 +1,330 @@ + + +<!DOCTYPE html> +<!--[if IE 8]><html class="no-js lt-ie9" lang="en" > <![endif]--> +<!--[if gt IE 8]><!--> <html class="no-js" lang="en" > <!--<![endif]--> +<head> + <meta charset="utf-8"> + + <meta name="viewport" content="width=device-width, initial-scale=1.0"> + + <title>Virtual Appliance (VA) — JABAWS 2.2 documentation</title> + + + + + + + + + + + + + + + + + + <link rel="stylesheet" href="_static/css/theme.css" type="text/css" /> + + + + + + <link rel="index" title="Index" + href="genindex.html"/> + <link rel="search" title="Search" href="search.html"/> + <link rel="top" title="JABAWS 2.2 documentation" href="index.html"/> + <link rel="next" title="Advanced Usage" href="advanced.html"/> + <link rel="prev" title="Web Application Archive (WAR)" href="war.html"/> + + + <script src="_static/js/modernizr.min.js"></script> + +</head> + +<body class="wy-body-for-nav" role="document"> + + + <div class="wy-grid-for-nav"> + + + <nav data-toggle="wy-nav-shift" class="wy-nav-side"> + <div class="wy-side-scroll"> + <div class="wy-side-nav-search"> + + + + <a href="index.html" class="icon icon-home"> JABAWS + + + + </a> + + + + + <div class="version"> + 2.2 + </div> + + + + +<div role="search"> + <form id="rtd-search-form" class="wy-form" action="search.html" method="get"> + <input type="text" name="q" placeholder="Search docs" /> + <input type="hidden" name="check_keywords" value="yes" /> + <input type="hidden" name="area" value="default" /> + </form> +</div> + + + </div> + + <div class="wy-menu wy-menu-vertical" data-spy="affix" role="navigation" aria-label="main navigation"> + + + + + + + <p class="caption"><span class="caption-text">Contents:</span></p> +<ul class="current"> +<li class="toctree-l1"><a class="reference internal" href="getting_started.html">Getting Started</a></li> +<li class="toctree-l1"><a class="reference internal" href="included_tools.html">Included Tools</a></li> +<li class="toctree-l1"><a class="reference internal" href="client.html">Command Line Client (CLI)</a></li> +<li class="toctree-l1"><a class="reference internal" href="war.html">Web Application Archive (WAR)</a></li> +<li class="toctree-l1 current"><a class="current reference internal" href="#">Virtual Appliance (VA)</a><ul> +<li class="toctree-l2"><a class="reference internal" href="#installing">Installing</a></li> +<li class="toctree-l2"><a class="reference internal" href="#usage">Usage</a></li> +<li class="toctree-l2"><a class="reference internal" href="#configuration">Configuration</a><ul> +<li class="toctree-l3"><a class="reference internal" href="#vm-configuration">VM configuration</a></li> +<li class="toctree-l3"><a class="reference internal" href="#jabaws-configuration">JABAWS configuration</a></li> +</ul> +</li> +</ul> +</li> +<li class="toctree-l1"><a class="reference internal" href="advanced.html">Advanced Usage</a></li> +<li class="toctree-l1"><a class="reference internal" href="develop.html">For Developers</a></li> +<li class="toctree-l1"><a class="reference internal" href="stats.html">Usage Statistics</a></li> +<li class="toctree-l1"><a class="reference internal" href="citations.html">Citations</a></li> +<li class="toctree-l1"><a class="reference internal" href="changelog.html">Changelog</a></li> +</ul> + + + + </div> + </div> + </nav> + + <section data-toggle="wy-nav-shift" class="wy-nav-content-wrap"> + + + <nav class="wy-nav-top" role="navigation" aria-label="top navigation"> + + <i data-toggle="wy-nav-top" class="fa fa-bars"></i> + <a href="index.html">JABAWS</a> + + </nav> + + + + <div class="wy-nav-content"> + <div class="rst-content"> + + + + + + + + + + + + + + + + +<div role="navigation" aria-label="breadcrumbs navigation"> + + <ul class="wy-breadcrumbs"> + + <li><a href="index.html">Docs</a> »</li> + + <li>Virtual Appliance (VA)</li> + + + <li class="wy-breadcrumbs-aside"> + + + <a href="_sources/va.rst.txt" rel="nofollow"> View page source</a> + + + </li> + + </ul> + + + <hr/> +</div> + <div role="main" class="document" itemscope="itemscope" itemtype="http://schema.org/Article"> + <div itemprop="articleBody"> + + <div class="section" id="virtual-appliance-va"> +<h1>Virtual Appliance (VA)<a class="headerlink" href="#virtual-appliance-va" title="Permalink to this headline">¶</a></h1> +<div class="admonition warning"> +<p class="first admonition-title">Warning</p> +<p class="last">The Virtual Appliance (VA) for JABAWS v2.2 will be provided soon.</p> +</div> +<p>The JABAWS Virtual Appliance is a way to run a JABAWS server locally, without the need to connect to the internet or configure JABAWS. What the appliance provides is a ‘virtual server machine’ (or more simply - <em>virtual machine</em> or <em>VM</em>), running an installation of the JABAWS Web Application Archive (WAR) on <a class="reference external" href="https://www.turnkeylinux.org/tomcat">TurnKey Linux</a> 12.1 (Standlone Tomcat). Once this has started up, it displays a message indicating the IP address of the JABAWS server, allowing any JABAWS client (such as Jalview or the JABAWS command line client) to connect to it.</p> +<p>You can run the appliance with freely available program such as <a class="reference external" href="http://www.vmware.com/products/player">VMware Player</a>, but you will need to install it first. We have tested the JABAWS appliance with VMware Player v 3.1.2 on Windows and Linux, and VMware Fusion on Mac. However, you are not limited to these virtualization systems and can use the JABAWS Appliance with any other virtualization platform. You can use <a class="reference external" href="https://code.vmware.com/web/dp/tool/ovf/4.1.0">VMware OVF</a> tool to prepare JABAWS image for a different virtualization platform e.g. <a class="reference external" href="https://www.virtualbox.org/">VirtualBox</a>.</p> +<div class="admonition note"> +<p class="first admonition-title">Note</p> +<p class="last">The appliance best suits users who would like to use the JABAWS web-services locally. This might be because they do not want to access systems over an internet, or just want to keep their data private. It is also the recommended option for users who want to install JABAWS on Windows, which does not support all the bioinformatics programs that JABAWS can run.</p> +</div> +<p>For servers that will be used heavily, we recommend that a JABAWS Server WAR distribution is deployed, rather than the Virtual Appliance version of JABAWS. This is because the JABAWS appliance is pre-configured to use only 1 CPU and 512M of memory (where the minimum amount of memory required for a JABAWS server is about 378M), which is unlikely to be sufficient for heavy computation. It is possible to reconfigure the virtual appliance so it uses more computation resources, but for most production environments, the JABAWS WAR distribution will be easier to deploy and fine tune to take advantage of the available resources.</p> +<hr class="docutils" /> +<div class="section" id="installing"> +<span id="va-installing"></span><h2>Installing<a class="headerlink" href="#installing" title="Permalink to this headline">¶</a></h2> +<div class="admonition tip"> +<p class="first admonition-title">Tip</p> +<p class="last">Check if you are running the recommended version of VWMare.</p> +</div> +<p>The free <a class="reference external" href="http://www.vmware.com/products/player">VMware Player</a> can be used to run the JABAWS services from the Windows and Linux host operating systems. <a class="reference external" href="http://www.vmware.com/products/fusion/overview.html">VMware Fusion</a>, a commercial VMware product, offers virtual machine support for Mac.</p> +<p>To run the JABAWS server on VMware player, unpack the JABAWS VM into one of the folders on your local hard drive. Open VMware Player, click “Open Virtual Machine” and point the Player to the location of the JABAWS, then choose the JABAWS.vmx file to open an appliance.</p> +<p>When you play the machine for the first time the Player might ask you whether “This virtual machine may have been moved or copied.”, say that you have copied it. That is all.</p> +<hr class="docutils" /> +</div> +<div class="section" id="usage"> +<span id="va-usage"></span><h2>Usage<a class="headerlink" href="#usage" title="Permalink to this headline">¶</a></h2> +<p>By default, the JABAWS virtual appliance is configured with 512M of memory and 1 CPU, but you are free to change these settings. If you have more than one CPU or CPU core on your computer you can make them available for the JABAWS virtual machine by editing virtual machine settings. Please bear in mind that more CPU power will not make a single calculation go faster, but it will enable the VM to do calculations in parallel. Similarly, you can add more memory to the virtual machine. More memory lets your VM deal with larger tasks, e.g. work with large alignments.</p> +<a class="reference internal image-reference" href="_images/VMware_cpu.png"><img alt="_images/VMware_cpu.png" class="align-left" src="_images/VMware_cpu.png" style="width: 672.6px; height: 253.64999999999998px;" /></a> +<p>The VMware Player screen shot above displays JABAWS VM CPU settings.</p> +<hr class="docutils" /> +</div> +<div class="section" id="configuration"> +<span id="va-config"></span><h2>Configuration<a class="headerlink" href="#configuration" title="Permalink to this headline">¶</a></h2> +<div class="section" id="vm-configuration"> +<span id="va-vm-config"></span><h3>VM configuration<a class="headerlink" href="#vm-configuration" title="Permalink to this headline">¶</a></h3> +<p><strong>VMware info</strong></p> +<ul class="simple"> +<li>CPUs : 1</li> +<li>RAM : 512 MB</li> +<li>Networking : Host only (the VM has no access to the outside network, nothing from the outside network can access the VM)</li> +<li>Hard disk : 20 GB (expanding)</li> +<li>VMware tools : Installed</li> +</ul> +<p><strong>OS information</strong></p> +<ul class="simple"> +<li>OS : TurnKey Linux (v. 12.1, Standalone Tomcat) based on Debian 6.0.7 (Squeeze)</li> +<li>Installation : Oracle Java 6, Tomcat 7, JABAWS v. 2.1</li> +<li>IPv4 address : dhcp</li> +<li>IPv6 address : auto</li> +<li>DNS name : none</li> +<li>Name server : dhcp</li> +<li>Route : dhcp</li> +<li>Keyboard : US_intl</li> +</ul> +<p><strong>Login credentials</strong></p> +<ul class="simple"> +<li>Root password: jabaws</li> +<li>Tomcat admin password: adminjabaws</li> +</ul> +<p><strong>Services available at the virtial machine IP (e.g. VM_IP = 172.16.232.149)</strong></p> +<ul class="simple"> +<li>Tomcat Web Server: <a class="reference external" href="http://VM_IP">http://VM_IP</a> (e.g. <a class="reference external" href="http://172.16.232.149">http://172.16.232.149</a>)</li> +<li>Jabaws URL: <a class="reference external" href="http://VM_IP/jabaws">http://VM_IP/jabaws</a> (e.g. <a class="reference external" href="http://172.16.232.149/jabaws">http://172.16.232.149/jabaws</a>)</li> +<li>Web Shell: <a class="reference external" href="https://VM_IP:12320/">https://VM_IP:12320/</a> (e.g. <a class="reference external" href="https://172.16.232.149:12320">https://172.16.232.149:12320</a>)</li> +<li>Webmean: <a class="reference external" href="https://VM_IP:12321/">https://VM_IP:12321/</a> (e.g. <a class="reference external" href="https://172.16.232.149:12321">https://172.16.232.149:12321</a>)</li> +<li>SSH/SFTP: <a class="reference external" href="mailto:root%40VM_IP">root<span>@</span>VM_IP</a> (e.g. ssh <a class="reference external" href="mailto:root%40172.16.232.149">root<span>@</span>172<span>.</span>16<span>.</span>232<span>.</span>149</a>)</li> +</ul> +<hr class="docutils" /> +</div> +<div class="section" id="jabaws-configuration"> +<span id="va-jabaws-config"></span><h3>JABAWS configuration<a class="headerlink" href="#jabaws-configuration" title="Permalink to this headline">¶</a></h3> +<p>After booting the JABAWS VM, you should see similar screen, however, the IP address of your VM may be different. To enable Jalview to work with your JABAWS appliance you need to go to Jalview->Tools->Preferences->Web Services -> New Service URL, and add JABAWS URL into the box provided. For more information please refer to <a class="reference external" href="http://www.jalview.org/help/html/webServices/JABAWS.html">Jalview help pages</a>.</p> +<a class="reference internal image-reference" href="_images/vm_welcome_screen.png"><img alt="_images/vm_welcome_screen.png" class="align-left" src="_images/vm_welcome_screen.png" style="width: 697.3px; height: 437.95px;" /></a> +<p>If you click on Advanced Menu, you will see the configuration console, similar to the one below.</p> +<a class="reference internal image-reference" href="_images/VMware_booted.png"><img alt="_images/VMware_booted.png" class="align-left" src="_images/VMware_booted.png" style="width: 698.25px; height: 437.95px;" /></a> +<p>By default the JABAWS VM is configured to use host-only networking. This means that the host can communicate with the VM via a network, but no other machines can. Similarly, the VM cannot communicate with any other computers apart from the host. If you want to connect to the Internet from the VM, configure your VM to use NAT network. However, you will not be able to connect to the VM from the host in such case. If you want to be able to connect to your VM and let VM connect to the internet at the same time you would have to use a Bridged network. In such a case you would have to configure the VM IP address manually (unless of course your network has a DHCP server to do that).</p> +</div> +</div> +</div> + + + </div> + <div class="articleComments"> + + </div> + </div> + <footer> + + <div class="rst-footer-buttons" role="navigation" aria-label="footer navigation"> + + <a href="advanced.html" class="btn btn-neutral float-right" title="Advanced Usage" accesskey="n" rel="next">Next <span class="fa fa-arrow-circle-right"></span></a> + + + <a href="war.html" class="btn btn-neutral" title="Web Application Archive (WAR)" accesskey="p" rel="prev"><span class="fa fa-arrow-circle-left"></span> Previous</a> + + </div> + + + <hr/> + + <div role="contentinfo"> + <p><a href="../">JABAWS 2.2</a> + © Copyright 2017, Peter Troshin, Alexander Sherstnev, Jim Procter, Alexey Drozdetskiy, Daniel Barton, Suzanne Duce, Fábio Madeira and Geoff Barton. + + </p> + </div> + Built with <a href="http://sphinx-doc.org/">Sphinx</a> using a <a href="https://github.com/snide/sphinx_rtd_theme">theme</a> provided by <a href="https://readthedocs.org">Read the Docs</a>. + +</footer> + </div> + </div> + + </section> + + </div> + + + + + + <script type="text/javascript"> + var DOCUMENTATION_OPTIONS = { + URL_ROOT:'./', + VERSION:'2.2', + LANGUAGE:'None', + COLLAPSE_INDEX:false, + FILE_SUFFIX:'.html', + HAS_SOURCE: true, + SOURCELINK_SUFFIX: '.txt' + }; + </script> + <script type="text/javascript" src="_static/jquery.js"></script> + <script type="text/javascript" src="_static/underscore.js"></script> + <script type="text/javascript" src="_static/doctools.js"></script> + + + + + + <script type="text/javascript" src="_static/js/theme.js"></script> + + + + + <script type="text/javascript"> + jQuery(function () { + SphinxRtdTheme.StickyNav.enable(); + }); + </script> + + +</body> +</html> \ No newline at end of file diff --git a/website/docs/war.html b/website/docs/war.html new file mode 100644 index 0000000..4f8d45e --- /dev/null +++ b/website/docs/war.html @@ -0,0 +1,293 @@ + + +<!DOCTYPE html> +<!--[if IE 8]><html class="no-js lt-ie9" lang="en" > <![endif]--> +<!--[if gt IE 8]><!--> <html class="no-js" lang="en" > <!--<![endif]--> +<head> + <meta charset="utf-8"> + + <meta name="viewport" content="width=device-width, initial-scale=1.0"> + + <title>Web Application Archive (WAR) — JABAWS 2.2 documentation</title> + + + + + + + + + + + + + + + + + + <link rel="stylesheet" href="_static/css/theme.css" type="text/css" /> + + + + + + <link rel="index" title="Index" + href="genindex.html"/> + <link rel="search" title="Search" href="search.html"/> + <link rel="top" title="JABAWS 2.2 documentation" href="index.html"/> + <link rel="next" title="Virtual Appliance (VA)" href="va.html"/> + <link rel="prev" title="Command Line Client (CLI)" href="client.html"/> + + + <script src="_static/js/modernizr.min.js"></script> + +</head> + +<body class="wy-body-for-nav" role="document"> + + + <div class="wy-grid-for-nav"> + + + <nav data-toggle="wy-nav-shift" class="wy-nav-side"> + <div class="wy-side-scroll"> + <div class="wy-side-nav-search"> + + + + <a href="index.html" class="icon icon-home"> JABAWS + + + + </a> + + + + + <div class="version"> + 2.2 + </div> + + + + +<div role="search"> + <form id="rtd-search-form" class="wy-form" action="search.html" method="get"> + <input type="text" name="q" placeholder="Search docs" /> + <input type="hidden" name="check_keywords" value="yes" /> + <input type="hidden" name="area" value="default" /> + </form> +</div> + + + </div> + + <div class="wy-menu wy-menu-vertical" data-spy="affix" role="navigation" aria-label="main navigation"> + + + + + + + <p class="caption"><span class="caption-text">Contents:</span></p> +<ul class="current"> +<li class="toctree-l1"><a class="reference internal" href="getting_started.html">Getting Started</a></li> +<li class="toctree-l1"><a class="reference internal" href="included_tools.html">Included Tools</a></li> +<li class="toctree-l1"><a class="reference internal" href="client.html">Command Line Client (CLI)</a></li> +<li class="toctree-l1 current"><a class="current reference internal" href="#">Web Application Archive (WAR)</a><ul> +<li class="toctree-l2"><a class="reference internal" href="#installing">Installing</a></li> +<li class="toctree-l2"><a class="reference internal" href="#usage">Usage</a></li> +<li class="toctree-l2"><a class="reference internal" href="#troubleshooting">Troubleshooting</a></li> +</ul> +</li> +<li class="toctree-l1"><a class="reference internal" href="va.html">Virtual Appliance (VA)</a></li> +<li class="toctree-l1"><a class="reference internal" href="advanced.html">Advanced Usage</a></li> +<li class="toctree-l1"><a class="reference internal" href="develop.html">For Developers</a></li> +<li class="toctree-l1"><a class="reference internal" href="stats.html">Usage Statistics</a></li> +<li class="toctree-l1"><a class="reference internal" href="citations.html">Citations</a></li> +<li class="toctree-l1"><a class="reference internal" href="changelog.html">Changelog</a></li> +</ul> + + + + </div> + </div> + </nav> + + <section data-toggle="wy-nav-shift" class="wy-nav-content-wrap"> + + + <nav class="wy-nav-top" role="navigation" aria-label="top navigation"> + + <i data-toggle="wy-nav-top" class="fa fa-bars"></i> + <a href="index.html">JABAWS</a> + + </nav> + + + + <div class="wy-nav-content"> + <div class="rst-content"> + + + + + + + + + + + + + + + + +<div role="navigation" aria-label="breadcrumbs navigation"> + + <ul class="wy-breadcrumbs"> + + <li><a href="index.html">Docs</a> »</li> + + <li>Web Application Archive (WAR)</li> + + + <li class="wy-breadcrumbs-aside"> + + + <a href="_sources/war.rst.txt" rel="nofollow"> View page source</a> + + + </li> + + </ul> + + + <hr/> +</div> + <div role="main" class="document" itemscope="itemscope" itemtype="http://schema.org/Article"> + <div itemprop="articleBody"> + + <div class="section" id="web-application-archive-war"> +<h1>Web Application Archive (WAR)<a class="headerlink" href="#web-application-archive-war" title="Permalink to this headline">¶</a></h1> +<p>JABAWS Web Application aRchive can run on any host operating system that supports <a class="reference external" href="http://www.oracle.com/technetwork/java/javase/downloads/jre7-downloads-1880261.html">Java</a> and <a class="reference external" href="http://tomcat.apache.org/download-80.cgi">Apache-Tomcat</a>. JABAWS requires a Java web application server compliant with version 2.4 of the Java Servlet specification, and a <a class="reference external" href="http://www.oracle.com/technetwork/java/javase/downloads/jre7-downloads-1880261.html">Java</a> 7 runtime environment. We recommend using an official Oracle Java 7 runtime environment, and <a class="reference external" href="http://tomcat.apache.org/download-80.cgi">Apache-Tomcat</a> web application server version 8.5, but older Tomcat versions above 5.5 will work too.</p> +<div class="admonition danger"> +<p class="first admonition-title">Danger</p> +<p class="last">The JABAWS WAR is not generally compatible with older Mac systems based on the PowerPC architecture, since Java 1.7 is not available to run JABAWS.</p> +</div> +<p>However JABAWS depends on a number of third party programs which are not available for all operating systems. In particular, not all web services are currently available for MS Windows platform. JABAWS comes with pre-compiled MS Windows and Linux x86 binaries, as well as the source code and build scripts necessary to recompile them.</p> +<p>To run JABAWS on the cluster you must have shared disk space accessible from all cluster nodes.</p> +<hr class="docutils" /> +<div class="section" id="installing"> +<span id="war-installing"></span><h2>Installing<a class="headerlink" href="#installing" title="Permalink to this headline">¶</a></h2> +<div class="admonition tip"> +<p class="first admonition-title">Tip</p> +<p class="last">Check if you are running the recommended versions of Java and Apache-Tomcat.</p> +</div> +<p>JABAWS is distributed as a web application archive (WAR). To deploy JABAWS in <a class="reference external" href="http://tomcat.apache.org/download-80.cgi">Apache-Tomcat</a> - simply drop the war file into the webapps directory of a running Tomcat, and it will do the rest. If you used this deployment procedure, do not remove the Jabaws WAR file, otherwise Tomcat will undeploy your application! The context path for your deployed application will be the same as the name of the war file. For example, assuming the Tomcat server is running on the <code class="docutils literal"><span class="pre">localhost:8080</span></code> and <em>jaba.war</em> file is put into the <code class="docutils literal"><span class="pre"><tomcat</span> <span class="pre">server</span> <span class="pre">root>/webapps</span></code> directory, the deployed application from the jabaws.war file then can be accessed by this URL <code class="docutils literal"><span class="pre">http://localhost:8080/jabaws</span></code>.</p> +<p>For any other web application server, please follow your server’s specific deployment procedure for ‘WAR’ files. If you install JABAWS on a MS Windows machine, then at this point your JABAWS installation will already be up and running, and you can try its services out as described here in the <a class="reference external" href="advanced.html#testing-the-jabaws-server">documentation</a>. If you install JABAWS on Linux you will need to compile the binaries for your system and set an executable flag for binaries (<a class="reference external" href="advanced.html#pre-compiled-binaries">more details here</a> and <a class="reference external" href="advanced.html#recompiling-binaries-for-your-system">here</a>).</p> +<hr class="docutils" /> +</div> +<div class="section" id="usage"> +<span id="war-usage"></span><h2>Usage<a class="headerlink" href="#usage" title="Permalink to this headline">¶</a></h2> +<p><strong>Running many JABAWS instances on the same server</strong></p> +<p>JABAWS is supplied as a Web Application aRchive which can be dealt with as any other web applications. So it is perfectly possible to run two JABAWS instances from the same server. Just make two different contexts on your application server and unpack JABAWS in both of them. For example if your server name is <a class="reference external" href="http://www.align.ac.uk">http://www.align.ac.uk</a>, and the context names are public and private. Than one group of users could be given a URL <a class="reference external" href="http://www.align.ac.uk/public">http://www.align.ac.uk/public</a> and another <a class="reference external" href="http://www.align.ac.uk/private">http://www.align.ac.uk/private</a>. These contexts will be served by two independent JABAWS instances, and could be configured differently. If you keep local engine enabled, make sure you reduce the number of threads local engine is allowed to use to avoid overloading the server. Alternatively two completely separate web application server instances (e.g. Apache-Tomcat) could be used. This will give you a better resilience and more flexibility in memory settings.</p> +<p><strong>JABAWS on a single server</strong></p> +<p>You can run JABAWS on a single server. Obviously the capacity will be limited, but it may be sufficient for a small lab. Installed on a single server, JABAWS executes tasks in parallel, so the more cores the server has the more requests it will be able to handle.</p> +<p><strong>JABAWS supported cluster batch management systems</strong></p> +<p>JABAWS uses <a class="reference external" href="http://www.drmaa.org/">DRMAA</a> v1.0 library to send and manage jobs on the cluster. DRMAA supports many different cluster job management systems. Namely Sun Grid Engine, Condor, PBS, GridWay, Globus 2/4, PBSPro, LSF. For up to date information please consult DRMAA web site. We found that DRMAA implementation differ from platform to platform and were trying to use only the basic functions. We have only tested JABAWS on Sun Grid Engine v 6.2. Please let use know if you have any experience of running JABAWS on other platforms.</p> +<hr class="docutils" /> +</div> +<div class="section" id="troubleshooting"> +<span id="war-troubleshooting"></span><h2>Troubleshooting<a class="headerlink" href="#troubleshooting" title="Permalink to this headline">¶</a></h2> +<p><strong>If Apache-Tomcat fails to deploy jabaws.war file:</strong></p> +<ul class="simple"> +<li>Make sure Tomcat has sufficient access rights to read your war file.</li> +<li>Restart the Tomcat, sometimes it will not restart after the new war file is added without restart</li> +<li>If Tomcat still refuses to unpack the war file, unpack it manually into web application folder (the war file is just a zip archive). Restart the Tomcat.</li> +</ul> +<p><strong>If Tomcat undeployes your application:</strong></p> +<p>If the war file is automatically removed by Tomcat use an explicit application descriptor. Add a context descriptor file into <code class="docutils literal"><span class="pre"><tomcatRoot>conf/Catalina/localhost</span></code> directory. Name your context file the same as your application folder e.g. if your JABAWS resides in <code class="docutils literal"><span class="pre">webapps/jabaws</span></code> folder, then call the context file jabaws.xml. Below is an example of content this file might have.</p> +<div class="highlight-xml"><div class="highlight"><pre><span></span><span class="cp"><?xml version="1.0" encoding="UTF-8"?></span> +<span class="nt"><Context</span> <span class="na">antiResourceLocking=</span><span class="s">"false"</span> <span class="na">privileged=</span><span class="s">"true"</span> <span class="nt">/></span> +</pre></div> +</div> +<p>This should be sufficient to prevent Tomcat from removing your JABAWS from WEBAPPS. For more information about the Tomcat deployer read this documentation on the Apache-Tomcat web site.</p> +</div> +</div> + + + </div> + <div class="articleComments"> + + </div> + </div> + <footer> + + <div class="rst-footer-buttons" role="navigation" aria-label="footer navigation"> + + <a href="va.html" class="btn btn-neutral float-right" title="Virtual Appliance (VA)" accesskey="n" rel="next">Next <span class="fa fa-arrow-circle-right"></span></a> + + + <a href="client.html" class="btn btn-neutral" title="Command Line Client (CLI)" accesskey="p" rel="prev"><span class="fa fa-arrow-circle-left"></span> Previous</a> + + </div> + + + <hr/> + + <div role="contentinfo"> + <p><a href="../">JABAWS 2.2</a> + © Copyright 2017, Peter Troshin, Alexander Sherstnev, Jim Procter, Alexey Drozdetskiy, Daniel Barton, Suzanne Duce, Fábio Madeira and Geoff Barton. + + </p> + </div> + Built with <a href="http://sphinx-doc.org/">Sphinx</a> using a <a href="https://github.com/snide/sphinx_rtd_theme">theme</a> provided by <a href="https://readthedocs.org">Read the Docs</a>. + +</footer> + </div> + </div> + + </section> + + </div> + + + + + + <script type="text/javascript"> + var DOCUMENTATION_OPTIONS = { + URL_ROOT:'./', + VERSION:'2.2', + LANGUAGE:'None', + COLLAPSE_INDEX:false, + FILE_SUFFIX:'.html', + HAS_SOURCE: true, + SOURCELINK_SUFFIX: '.txt' + }; + </script> + <script type="text/javascript" src="_static/jquery.js"></script> + <script type="text/javascript" src="_static/underscore.js"></script> + <script type="text/javascript" src="_static/doctools.js"></script> + + + + + + <script type="text/javascript" src="_static/js/theme.js"></script> + + + + + <script type="text/javascript"> + jQuery(function () { + SphinxRtdTheme.StickyNav.enable(); + }); + </script> + + +</body> +</html> \ No newline at end of file