From: TZVanaalten Date: Thu, 27 Jul 2017 16:17:08 +0000 (+0100) Subject: JAL-2629 implement hmmbuild X-Git-Url: http://source.jalview.org/gitweb/?a=commitdiff_plain;h=827e8a199b8c490b4d774befb2a0bac6383a9d38;p=jalview.git JAL-2629 implement hmmbuild --- diff --git a/resources/lang/Messages.properties b/resources/lang/Messages.properties index f05f7bc..97f8c8d 100644 --- a/resources/lang/Messages.properties +++ b/resources/lang/Messages.properties @@ -1315,6 +1315,6 @@ label.warning_hidden = Warning: {0} {1} is currently hidden label.change_hmmer_directory = Change HMMER suite location label.auto_align_seqs = Automatically Align New Sequences label.hmmalign = Align Sequences to HMM -label.hmmbuild = Build HMM From Alignment +label.hmmbuild = Build HMM from Alignment label.hmmsearch = Search for Related Sequences diff --git a/src/jalview/datamodel/HiddenMarkovModel.java b/src/jalview/datamodel/HiddenMarkovModel.java index 96a5a6f..727ffc7 100644 --- a/src/jalview/datamodel/HiddenMarkovModel.java +++ b/src/jalview/datamodel/HiddenMarkovModel.java @@ -469,14 +469,33 @@ public class HiddenMarkovModel */ public char getConsensusAtAlignColumn(int columnIndex) { - char value; + char mostLikely = '-'; + if (consensusResidueIsActive()) + { + Integer index = findNodeIndex(columnIndex); if (index == null) { return '-'; } - value = getNodes().get(index).getConsensusResidue(); - return value; + mostLikely = getNodes().get(index).getConsensusResidue(); + return mostLikely; + } + else + { + double highestProb = 0; + for (char character : symbols) + { + Double prob = getMatchEmissionProbability(columnIndex, character); + if (prob > highestProb) + { + highestProb = prob; + mostLikely = character; + } + } + return mostLikely; + } + } /** @@ -933,7 +952,9 @@ public class HiddenMarkovModel } Character cons; + cons = getConsensusAtAlignColumn(alignPos); + cons = Character.toUpperCase(cons); String description = String.format("%.3f", content); @@ -948,6 +969,7 @@ public class HiddenMarkovModel "The information content of each column, measured in bits", annotations, 0f, max, AlignmentAnnotation.BAR_GRAPH); + annotation.setHMM(this); return annotation; } @@ -1008,14 +1030,9 @@ public class HiddenMarkovModel for (int index = 0; index < length; index++) { Character character; - if (consensusResidueIsActive()) - { + character = getConsensusAtAlignColumn(index); - } - else - { - character = findConsensusCharacter(index); - } + if (character == null || character == '-') { sequence[index] = '-'; @@ -1031,29 +1048,6 @@ public class HiddenMarkovModel return seq; } - /** - * Finds the most probable character at a column in an alignment based on the - * HMM. - * - * @param nodeIndex - * The index of the node. - * @return - */ - Character findConsensusCharacter(int column) - { - Character mostLikely = null; - double highestProb = 0; - for (char character : symbols) - { - Double prob = getMatchEmissionProbability(column, character); - if (prob > highestProb) - { - highestProb = prob; - mostLikely = character; - } - } - return mostLikely; - } /** * Maps the nodes of the hidden Markov model to the reference annotation. @@ -1089,5 +1083,17 @@ public class HiddenMarkovModel } } + + public AlignmentI initPlaceholder(AlignmentI alignment) + { + int length = alignment.getWidth(); + Sequence consensus = getConsensusSequence(length); + consensus.setHMM(this); + SequenceI[] consensusArr = new Sequence[] { consensus }; + AlignmentI newAlignment = new Alignment(consensusArr); + newAlignment.append(alignment); + return newAlignment; + } + } diff --git a/src/jalview/gui/AlignFrame.java b/src/jalview/gui/AlignFrame.java index 0c951fa..8ac7c8a 100644 --- a/src/jalview/gui/AlignFrame.java +++ b/src/jalview/gui/AlignFrame.java @@ -63,6 +63,7 @@ import jalview.datamodel.SequenceGroup; import jalview.datamodel.SequenceI; import jalview.gui.ColourMenuHelper.ColourChangeListener; import jalview.gui.ViewSelectionMenu.ViewSetProvider; +import jalview.hmmer.HMMERCommands; import jalview.io.AlignmentProperties; import jalview.io.AnnotationFile; import jalview.io.BioJsHTMLOutput; @@ -125,6 +126,7 @@ import java.awt.print.PrinterJob; import java.beans.PropertyChangeEvent; import java.io.File; import java.io.FileWriter; +import java.io.IOException; import java.io.PrintWriter; import java.net.URL; import java.util.ArrayList; @@ -1033,6 +1035,29 @@ public class AlignFrame extends GAlignFrame implements DropTargetListener, } @Override + public void hmmBuild_actionPerformed(ActionEvent e) + throws IOException, InterruptedException + { + + HMMERCommands.hmmBuild(this); + alignPanel.repaint(); + } + + @Override + public void hmmAlign_actionPerformed(ActionEvent e) + { + + alignPanel.repaint(); + } + + @Override + public void hmmSearch_actionPerformed(ActionEvent e) + { + + alignPanel.repaint(); + } + + @Override public void reload_actionPerformed(ActionEvent e) { if (fileName != null) @@ -4703,13 +4728,8 @@ public class AlignFrame extends GAlignFrame implements DropTargetListener, AlignmentAnnotation annotation = hmm.createAnnotation( getViewport().getAlignment().getWidth()); getViewport().getAlignment().addAnnotation(annotation); - int length = getViewport().getAlignment().getWidth(); - Sequence consensus = hmm.getConsensusSequence(length); - consensus.setHMM(hmm); - annotation.setHMM(hmm); - SequenceI[] consensusArr = new Sequence[] { consensus }; - AlignmentI newAlignment = new Alignment(consensusArr); - newAlignment.append(getViewport().getAlignment()); + AlignmentI newAlignment = hmm + .initPlaceholder(getViewport().getAlignment()); getViewport().setAlignment(newAlignment); isAnnotation = true; alignPanel.repaint(); diff --git a/src/jalview/hmmer/HMMERCommands.java b/src/jalview/hmmer/HMMERCommands.java new file mode 100644 index 0000000..ac96c2a --- /dev/null +++ b/src/jalview/hmmer/HMMERCommands.java @@ -0,0 +1,91 @@ +package jalview.hmmer; + +import jalview.datamodel.AlignmentI; +import jalview.datamodel.HiddenMarkovModel; +import jalview.datamodel.SequenceI; +import jalview.gui.AlignFrame; +import jalview.io.DataSourceType; +import jalview.io.FileFormat; +import jalview.io.StockholmFile; + +import java.io.BufferedReader; +import java.io.IOException; +import java.io.InputStreamReader; +import java.io.PrintWriter; +import java.util.List; + +public class HMMERCommands +{ + // Path of hmmer binaries directory + private static final String HMMERFOLDER = "H:/Documents/"; + + private static final String HMMALIGN = HMMERFOLDER + "hmmalign"; + + private static final String HMMBUILD = HMMERFOLDER + "hmmbuild"; + + private static final String HMMSEARCH = HMMERFOLDER + "hmmsearch"; + + private static final String JALVIEWDIRECTORY = "C:/Users/TZVanaalten/git/jalview/"; + + private static final String HMMBUFFER = "src/jalview/hmmer/hmm_buffer.hmm"; + + private static final String ALIGNMENTBUFFER = "src/jalview/hmmer/alignment_buffer.sto"; + + private static final String OUTPUTALIGNMENT = "-o " + ALIGNMENTBUFFER; + + private static final String SPACE = " "; + + public static void hmmBuild(AlignFrame af) + throws IOException, InterruptedException + { + HiddenMarkovModel hmm = null; + AlignmentI alignment = af.getViewport().getAlignment(); + List list = alignment.getSequences(); + SequenceI[] array = new SequenceI[list.size()]; + list.toArray(array); + StockholmFile file = new StockholmFile(alignment); + file.setSeqs(array); + String output = file.print(); + PrintWriter writer = new PrintWriter(ALIGNMENTBUFFER); + writer.println(output); + writer.close(); + final String command = HMMBUILD + SPACE + JALVIEWDIRECTORY + HMMBUFFER + + SPACE + + JALVIEWDIRECTORY + ALIGNMENTBUFFER; + + runCommand(command); + + af.loadJalviewDataFile(HMMBUFFER, DataSourceType.FILE, + FileFormat.HMMER3, null); + } + + private static void runCommand(String command) + throws IOException, InterruptedException + { + final Process p = Runtime.getRuntime().exec(command); + + new Thread(new Runnable() + { + @Override + public void run() + { + BufferedReader input = new BufferedReader( + new InputStreamReader(p.getInputStream())); + String line = null; + + try + { + while ((line = input.readLine()) != null) + { + System.out.println(line); + } + } catch (IOException e) + { + e.printStackTrace(); + } + } + }).start(); + + p.waitFor(); + } +} diff --git a/src/jalview/hmmer/alignment_buffer.sto b/src/jalview/hmmer/alignment_buffer.sto new file mode 100644 index 0000000..d0ad541 --- /dev/null +++ b/src/jalview/hmmer/alignment_buffer.sto @@ -0,0 +1,19 @@ +# STOCKHOLM 1.0 +FER_CAPAA -----------------------------------------------------------ASYKVKLITPDGPIEFDCPDDVYILDQAEEAGHDLPYSCRAGSCSSCAGKIAGGAVDQTDGNFLDDDQLEEGWVLTCVAYPQSDVTIETHKEAELVG- +FER_CAPAN MA------SVSATMISTSFMPRKPAVTSL-KPIPNVGE--ALFGLKS-A--NGGKVTCMASYKVKLITPDGPIEFDCPDNVYILDQAEEAGHDLPYSCRAGSCSSCAGKIAGGAVDQTDGNFLDDDQLEEGWVLTCVAYPQSDVTIETHKEAELVG- +FER1_SOLLC MA------SISGTMISTSFLPRKPAVTSL-KAISNVGE--ALFGLKS-G--RNGRITCMASYKVKLITPEGPIEFECPDDVYILDQAEEEGHDLPYSCRAGSCSSCAGKVTAGSVDQSDGNFLDEDQEAAGFVLTCVAYPKGDVTIETHKEEELTA- +Q93XJ9_SOLTU MA------SISGTMISTSFLPRKPVVTSL-KAISNVGE--ALFGLKS-G--RNGRITCMASYKVKLITPDGPIEFECPDDVYILDQAEEEGHDLPYSCRAGSCSSCAGKVTAGTVDQSDGKFLDDDQEAAGFVLTCVAYPKCDVTIETHKEEELTA- +FER1_PEA MATT---PALYGTAVSTSFLRTQPMPMSV-TTTKAFSN--GFLGLKT-SLKRGDLAVAMASYKVKLVTPDGTQEFECPSDVYILDHAEEVGIDLPYSCRAGSCSSCAGKVVGGEVDQSDGSFLDDEQIEAGFVLTCVAYPTSDVVIETHKEEDLTA- +Q7XA98_TRIPR MATT---PALYGTAVSTSFMRRQPVPMSV-ATTTTTKAFPSGFGLKSVSTKRGDLAVAMATYKVKLITPEGPQEFDCPDDVYILDHAEEVGIELPYSCRAGSCSSCAGKVVNGNVNQEDGSFLDDEQIEGGWVLTCVAFPTSDVTIETHKEEELTA- +FER1_MESCR MAAT--TAALSGATMSTAFAPK--TPPMTAALPTNVGR--ALFGLKS-SASR-GRVTAMAAYKVTLVTPEGKQELECPDDVYILDAAEEAGIDLPYSCRAGSCSSCAGKVTSGSVNQDDGSFLDDDQIKEGWVLTCVAYPTGDVTIETHKEEELTA- +FER1_SPIOL MAAT--TTTMMG--MATTFVPKPQAPPMMAALPSNTGR--SLFGLKT-GSR--GGRMTMAAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKEEELTA- +FER3_RAPSA -----------------------------------------------------------ATYKVKFITPEGEQEVECDDDVYVLDAAEEAGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSFLDDDQIAEGFVLTCAAYPTSDVTIETHREEDMV-- +FER2_ARATH MAST----ALSSAIVGTSFIRRSPAPISLRSLPSANTQ--SLFGLKS-GTARGGRVTAMATYKVKFITPEGELEVECDDDVYVLDAAEEAGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSFLDDEQIGEGFVLTCAAYPTSDVTIETHKEEDIV-- +FER_BRANA -----------------------------------------------------------ATYKVKFITPEGEQEVECDDDVYVLDAAEEAGIDLPYSCRAGSCSSCAGKVVSGFVDQSDESFLDDDQIAEGFVLTCAAYPTSDVTIETHKEEELV-- +FER1_ARATH MAST----ALSSAIVSTSFLRRQQTPISLRSLPFANTQ--SLFGLKS-STARGGRVTAMATYKVKFITPEGEQEVECEEDVYVLDAAEEAGLDLPYSCRAGSCSSCAGKVVSGSIDQSDQSFLDDEQMSEGYVLTCVAYPTSDVVIETHKEEAIM-- +Q93Z60_ARATH MAST----ALSSAIVSTSFLRRQQTPISLRSLPFANTQ--SLFGLKS-STARGGRVTAMATYKVKFITPEGEQEVECEEDVYVLDAAEEAGLDLPYSCRAGSCSSCAGKVVSGSIDQSDQSFLDD-------------------------------- +FER1_MAIZE MATVLGSPRAPAFFFSSSSLRAAPAPTAV--ALPAAKV--GIMGRSA-SSRR--RLRAQATYNVKLITPEGEVELQVPDDVYILDQAEEDGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSYLDDGQIADGWVLTCHAYPTSDVVIETHKEEELTGA +O80429_MAIZE MAAT---------ALSMSILR---APPPCFSSPLRLRV--AVAKPLA-APMRRQLLRAQATYNVKLITPEGEVELQVPDDVYILDFAEEEGIDLPFSCRAGSCSSCAGKVVSGSVDQSDQSFLNDNQVADGWVLTCAAYPTSDVVIETHKEDDLL-- +// + + diff --git a/src/jalview/hmmer/hmm_buffer.hmm b/src/jalview/hmmer/hmm_buffer.hmm new file mode 100644 index 0000000..9e3cb11 --- /dev/null +++ b/src/jalview/hmmer/hmm_buffer.hmm @@ -0,0 +1,464 @@ +HMMER3/b [3.0 | March 2010] +NAME alignment_buffer +LENG 148 +ALPH amino +RF no +CS no +MAP yes +DATE Thu Jul 27 17:11:32 2017 +NSEQ 15 +EFFN 0.648193 +CKSUM 2563184735 +STATS LOCAL MSV -10.0682 0.70956 +STATS LOCAL VITERBI -10.7870 0.70956 +STATS LOCAL FORWARD -4.6837 0.70956 +HMM A C D E F G H I K L M N P Q R S T V W Y + m->m m->i m->d i->m i->i d->m d->d + COMPO 2.40816 3.71583 2.80837 2.63551 3.47092 2.77036 3.85028 2.88279 2.80267 2.53589 3.68425 3.22102 3.34428 3.14560 3.11474 2.53177 2.75990 2.58070 5.00144 3.51101 + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.10433 3.97705 2.52157 0.61958 0.77255 0.00000 * + 1 2.99317 4.53706 4.08224 3.67789 3.22093 3.85692 4.40592 2.39958 3.44433 1.81088 1.32037 3.95163 4.31759 3.82413 3.64608 3.34553 3.29902 2.40928 5.06591 3.83044 1 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.03044 3.90315 4.62550 0.61958 0.77255 0.55549 0.85282 + 2 0.97044 4.20710 3.49350 3.28598 4.08269 3.03087 4.30444 3.21278 3.30302 3.09300 4.12129 3.42792 3.77296 3.64134 3.55157 2.55705 2.83652 2.86187 5.50678 4.31039 2 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.11955 3.90315 2.38048 0.61958 0.77255 0.55549 0.85282 + 3 1.74035 4.09199 3.34495 3.00819 4.05288 2.91638 4.05509 3.33461 3.01251 3.11462 3.97728 3.20348 3.62940 3.32849 3.32799 1.99191 1.99086 2.89563 5.42641 4.20726 3 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.03323 3.81683 4.53917 0.61958 0.77255 0.62561 0.76558 + 4 2.37663 4.18625 3.55838 3.17855 3.75132 3.18264 4.13666 2.64341 3.07328 2.62344 3.69712 3.39774 3.83139 3.44405 3.35689 2.61052 1.64486 2.15973 5.30034 4.05468 4 - - + 2.68617 4.42230 2.77525 2.73129 3.46359 2.40511 3.72500 3.29359 2.67746 2.69350 4.24695 2.90352 2.73719 3.18152 2.89806 2.37885 2.77501 2.98524 4.58482 3.61508 + 0.33937 1.47682 2.82312 0.71438 0.67236 0.50642 0.92294 + 5 1.78828 4.31568 3.18846 2.75366 3.97645 3.11838 3.84000 3.34055 2.67250 3.02453 3.87541 3.10729 3.71676 3.06391 2.67828 2.15246 2.50645 2.96422 5.30410 4.05011 9 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.03188 3.85742 4.57976 0.61958 0.77255 0.59400 0.80322 + 6 2.60146 4.34120 4.20318 3.64233 3.23200 4.03946 4.38229 1.91078 3.53317 1.46276 2.80385 3.95250 4.35454 3.78680 3.77614 3.34686 3.12310 1.90138 5.05979 3.90282 10 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.03188 3.85742 4.57976 0.61958 0.77255 0.59400 0.80322 + 7 2.51618 4.38929 3.20785 2.68482 3.53842 3.39630 3.71025 2.97988 2.63127 2.66315 3.23915 3.11866 3.35060 2.98059 3.01133 2.11689 2.77574 2.72369 4.95633 3.10650 11 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.03188 3.85742 4.57976 0.61958 0.77255 0.59400 0.80322 + 8 1.83112 4.12334 3.20156 2.95461 4.23963 1.79514 4.09699 3.64646 3.07597 3.33878 4.16582 3.16397 3.61350 3.35846 3.40724 1.96001 2.64648 3.10558 5.57497 4.34818 12 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.07518 3.85742 2.97012 0.61958 0.77255 0.59400 0.80322 + 9 2.02467 4.19921 3.47207 3.00878 3.03795 3.27081 3.95597 2.70270 2.96218 2.55248 3.54468 3.31239 3.83177 3.27950 3.28895 2.63385 2.09090 2.46488 5.06606 3.80489 13 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.03327 3.81551 4.53786 0.61958 0.77255 0.56041 0.84624 + 10 2.25155 4.19461 3.85704 3.29295 2.92371 3.72128 4.04839 2.07964 3.20853 2.08962 2.71310 3.60847 4.09120 3.47607 3.47945 3.00735 2.74040 2.14097 4.86082 3.65928 14 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.03170 3.86316 4.58551 0.61958 0.77255 0.53107 0.88667 + 11 2.97746 4.34766 4.53309 3.96552 2.78843 4.21079 4.53997 1.80103 3.85948 1.59494 2.57669 4.20401 4.48099 4.02954 4.02513 3.53069 3.20806 1.63119 5.03312 3.89134 15 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.03044 3.90315 4.62550 0.61958 0.77255 0.55549 0.85282 + 12 2.01604 4.15364 3.23013 2.99255 4.26101 2.66741 4.12859 3.66796 3.09383 3.37186 4.20680 3.19709 3.64453 3.39377 3.41395 1.27425 2.68165 3.13093 5.59931 4.36607 16 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.03044 3.90315 4.62550 0.61958 0.77255 0.55549 0.85282 + 13 2.41396 4.26265 3.40226 2.93569 3.72492 3.24366 3.92462 2.93397 2.83929 2.73560 3.16052 3.25846 3.81309 3.20648 3.16819 2.37913 1.73294 2.65776 5.16309 3.91530 17 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.03044 3.90315 4.62550 0.61958 0.77255 0.55549 0.85282 + 14 2.06589 4.14828 3.30608 3.02868 4.20053 2.92394 4.12227 3.52677 3.06750 3.27902 4.13704 3.22373 3.65849 3.38850 3.37961 1.31011 2.40891 3.04032 5.55736 4.32788 18 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.03044 3.90315 4.62550 0.61958 0.77255 0.55549 0.85282 + 15 2.74009 4.29274 3.92243 3.42912 1.74599 3.72053 3.90473 2.32427 3.32349 2.18956 3.31553 3.65797 4.14118 3.57919 3.55745 2.71376 3.01017 2.38146 4.46330 2.97696 19 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.03044 3.90315 4.62550 0.61958 0.77255 0.55549 0.85282 + 16 2.76094 4.39380 4.31945 3.75589 3.18422 4.12530 4.45889 2.01307 3.63847 1.30728 2.59228 4.05575 4.41925 3.86957 3.85970 3.43754 3.19324 1.94550 5.06650 3.93230 20 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.03044 3.90315 4.62550 0.61958 0.77255 0.55549 0.85282 + 17 2.70295 4.73637 3.16526 2.68917 4.18427 3.37581 3.71759 3.61851 2.27125 3.18722 4.06871 3.11427 2.39752 2.89725 1.66361 2.77186 2.98335 3.28411 5.34221 4.10051 21 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.07762 3.90315 2.90945 0.61958 0.77255 0.55549 0.85282 + 18 2.49055 4.81399 3.14505 2.59164 4.19520 3.44406 3.60132 3.55142 1.92611 3.12799 3.98038 3.04037 3.86298 2.75679 1.83484 2.76119 2.76042 3.23493 5.31169 4.06564 22 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.06501 3.85742 3.17445 0.61958 0.77255 0.59400 0.80322 + 19 2.43450 4.81939 2.81703 2.39298 4.15804 3.33308 3.59871 3.56807 2.06609 3.14527 3.97247 2.89702 3.36070 2.29211 2.66793 2.54254 2.87166 3.22778 5.35034 4.03520 23 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.03294 3.82535 4.54770 0.61958 0.77255 0.61916 0.77305 + 20 2.61608 4.67386 2.79167 2.51004 4.07010 3.23635 3.73836 3.55025 2.48903 3.13320 4.04098 2.97430 2.02723 2.34075 2.83811 2.68076 2.93097 3.21608 5.34739 4.03735 24 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.03294 3.82535 4.54770 0.61958 0.77255 0.51069 0.91649 + 21 1.83080 4.22890 3.60014 3.08598 3.61014 3.38577 4.01761 2.55536 3.00939 2.52819 3.20189 3.39791 3.91288 3.33215 3.33591 2.72706 2.41446 2.12040 5.12303 3.89826 25 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.03044 3.90315 4.62550 0.61958 0.77255 0.55549 0.85282 + 22 2.43845 4.29437 3.39983 3.04145 3.80350 3.19872 4.06195 2.96220 2.98493 2.76612 3.80233 3.32666 1.71751 3.35496 3.29387 2.63325 2.83846 2.21304 5.28839 4.02321 26 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.03044 3.90315 4.62550 0.61958 0.77255 0.55549 0.85282 + 23 2.55648 4.28453 3.47615 2.92649 3.45346 3.51308 3.86072 2.37030 2.85167 2.40896 2.93550 3.31525 2.97437 3.17776 3.19434 2.79032 2.33896 2.42929 4.94762 3.71651 27 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.03044 3.90315 4.62550 0.61958 0.77255 0.55549 0.85282 + 24 2.23005 4.31546 3.25841 2.77512 3.78441 3.22479 3.82985 3.12652 2.73582 2.83244 3.03171 3.14960 3.26067 3.07830 3.10838 1.85715 2.73859 2.81468 5.16957 3.91289 28 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.03044 3.90315 4.62550 0.61958 0.77255 0.55549 0.85282 + 25 2.72216 3.51794 4.14734 3.58168 3.26953 3.85722 4.23682 2.10046 3.47012 1.71220 2.91412 3.83361 4.22096 3.71804 3.68973 3.16541 2.79579 1.71693 4.93656 3.75086 29 - - + 2.68606 4.42227 2.77522 2.73126 3.46337 2.40515 3.72497 3.29356 2.67743 2.69357 4.24692 2.90349 2.73742 3.18149 2.89784 2.37889 2.77522 2.98521 4.58479 3.61506 + 0.31572 1.55442 2.82310 0.27619 1.42159 0.55549 0.85282 + 26 2.06718 4.47388 3.00085 2.59301 4.03403 3.18938 3.75234 3.40130 2.21691 3.06406 3.90876 3.01767 3.74194 2.94856 2.91976 2.09488 2.60568 3.04014 5.32541 4.04568 31 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.03205 3.85226 4.57460 0.61958 0.77255 0.52495 0.89548 + 27 2.09937 4.25808 3.35967 2.86682 3.65405 3.28224 3.85971 2.93650 2.81278 2.15397 3.59474 3.22143 3.43624 3.14697 3.16235 2.43009 2.43628 2.66078 5.07593 3.83686 32 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.03044 3.90315 4.62550 0.61958 0.77255 0.55549 0.85282 + 28 2.56380 4.32380 3.45039 2.92280 3.52453 3.48960 3.88793 2.33272 2.83649 2.29194 3.45598 3.31192 2.56007 3.18425 3.18050 2.78603 2.52825 2.43071 5.02605 3.78340 33 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.03044 3.90315 4.62550 0.61958 0.77255 0.55549 0.85282 + 29 2.52137 4.41862 3.18708 2.64701 3.24265 3.41116 3.70401 2.99879 2.50849 2.54033 3.56040 3.09794 3.19241 2.94883 3.00442 2.32271 2.53579 2.73855 5.01724 3.74765 34 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.03044 3.90315 4.62550 0.61958 0.77255 0.55549 0.85282 + 30 2.00013 4.58033 2.94855 2.53646 4.07584 3.24271 3.72285 3.46598 2.50253 3.10366 3.94143 2.28591 3.76727 2.90505 2.65085 2.58556 2.61842 3.10852 5.34830 4.05040 35 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.03044 3.90315 4.62550 0.61958 0.77255 0.55549 0.85282 + 31 2.38233 4.27978 3.41241 2.86526 3.23400 3.48475 3.81694 2.67786 2.81404 2.37039 3.42629 2.84230 3.90072 3.13098 3.17039 2.75440 2.50322 2.16090 4.92926 3.68461 36 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.03044 3.90315 4.62550 0.61958 0.77255 0.55549 0.85282 + 32 2.57741 4.71210 2.95136 2.48036 4.10354 2.51445 3.64563 3.50876 2.11219 3.10615 3.93363 2.96219 3.79067 2.80786 2.54902 2.50592 2.51289 3.16566 5.32824 4.02677 37 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.03044 3.90315 4.62550 0.61958 0.77255 0.55549 0.85282 + 33 2.48649 4.79372 2.91636 2.20828 4.05411 3.38774 3.59403 3.46081 2.32653 3.05709 3.87988 2.78811 3.79502 2.48988 2.50461 2.63652 2.83744 2.71303 5.28703 3.96685 38 - - + 2.68619 4.42226 2.77520 2.73124 3.46338 2.40514 3.72495 3.29355 2.67742 2.69356 4.24691 2.90348 2.73732 3.18147 2.89802 2.37888 2.77520 2.98519 4.58478 3.61504 + 0.07101 2.83445 4.62550 0.63888 0.75053 0.55549 0.85282 + 34 1.61247 4.12982 3.30077 3.01153 4.23531 2.30721 4.11812 3.64225 3.09602 3.33089 4.15414 3.20546 3.63382 3.37908 3.42786 1.71494 2.65404 3.10635 5.57312 4.35188 41 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.03044 3.90315 4.62550 0.61958 0.77255 0.55549 0.85282 + 35 2.72153 4.23229 3.98871 3.42694 2.97156 3.37228 4.12428 2.11066 3.32720 1.56866 3.14804 3.72158 4.17041 3.58506 3.57523 3.10753 2.96236 2.01957 4.85619 3.63474 42 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.03044 3.90315 4.62550 0.61958 0.77255 0.55549 0.85282 + 36 2.59948 4.33296 4.13320 3.58598 1.90470 3.92561 4.14661 2.31847 3.46961 1.74381 2.73954 3.84829 4.26638 3.69996 3.68809 3.23462 3.08833 2.27549 4.71854 3.39100 43 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.03044 3.90315 4.62550 0.61958 0.77255 0.55549 0.85282 + 37 2.58931 4.58161 2.85848 2.66250 4.27569 1.35942 3.92193 3.72667 2.37699 3.36968 4.25453 3.08080 3.80217 3.15095 3.05968 2.68693 2.97358 3.32002 5.50315 4.25822 44 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.03044 3.90315 4.62550 0.61958 0.77255 0.55549 0.85282 + 38 2.65443 4.41996 3.43781 2.92526 3.49579 3.52457 3.83449 2.83057 2.64507 1.65492 3.47551 3.30970 3.36731 3.12885 2.65176 2.85231 2.91346 2.65496 4.98654 3.73087 45 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.03044 3.90315 4.62550 0.61958 0.77255 0.55549 0.85282 + 39 2.72350 4.79628 3.09209 2.60253 4.10688 3.43694 3.64699 3.48037 1.53491 2.80300 3.97997 3.05455 3.87955 2.81812 2.48623 2.53142 2.96661 3.17965 5.30004 4.01932 46 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.03044 3.90315 4.62550 0.61958 0.77255 0.55549 0.85282 + 40 1.82674 4.13179 3.37396 3.04098 4.15468 2.93287 4.10316 3.48191 3.05943 3.22685 4.07364 3.23234 3.65478 3.36800 3.38156 1.54612 2.23418 3.00585 5.51189 4.29184 47 - - + 2.68618 4.42225 2.77520 2.73124 3.46354 2.40513 3.72495 3.29354 2.67741 2.69355 4.24690 2.90347 2.73740 3.18147 2.89801 2.37887 2.77520 2.98508 4.58477 3.61503 + 0.07101 2.83445 4.62550 0.49418 0.94179 0.55549 0.85282 + 41 1.87334 4.14690 3.25058 2.97809 4.26468 2.12605 4.11046 3.68104 3.08263 3.36184 4.18261 3.18779 3.63442 3.36584 3.42015 1.58161 2.66271 3.13490 5.59481 4.36766 49 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.11955 3.90315 2.38048 0.61958 0.77255 0.55549 0.85282 + 42 2.21070 4.25592 3.22113 2.77420 3.85340 3.11965 3.84389 3.18555 2.74438 2.69874 3.77079 3.12117 3.16635 3.08826 3.10948 2.13243 2.17697 2.83916 5.22265 3.97074 50 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.03323 3.81683 4.53917 0.61958 0.77255 0.62561 0.76558 + 43 2.34367 4.62113 3.10732 2.54725 3.88271 3.41056 3.61301 3.25335 2.12788 2.89080 3.32993 3.01581 3.81452 2.79680 2.35592 2.55841 2.82420 2.96607 5.15612 3.88260 51 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.07842 3.81683 2.92953 0.61958 0.77255 0.50642 0.92294 + 44 2.82371 4.84862 3.20218 2.72371 4.21308 3.44211 3.65714 3.71157 2.07944 3.25434 4.14899 2.84303 3.91564 2.83614 1.36807 2.87376 3.07618 3.38687 5.31229 4.06004 52 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.12129 3.86316 2.37274 0.61958 0.77255 0.58934 0.80899 + 45 2.50307 4.57358 2.77436 2.48515 4.13002 2.10145 3.72113 3.58708 2.48196 3.19739 4.04544 2.56817 3.72971 2.91621 2.54565 2.57756 2.84032 3.19983 5.38083 4.07634 53 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.03462 3.77648 4.49883 0.61958 0.77255 0.55399 0.85485 + 46 2.68547 4.96255 2.09111 2.21584 4.36925 1.97687 3.70446 3.84410 2.62382 3.41713 4.25934 2.75900 3.76266 2.58919 3.12019 2.66938 2.98839 3.45462 5.60805 4.21173 54 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.03205 3.85226 4.57460 0.61958 0.77255 0.52495 0.89548 + 47 2.70472 4.70735 3.22145 2.64799 3.96742 3.15410 3.63371 3.33902 2.12091 2.43520 3.82970 3.09240 3.88741 2.81708 1.91192 2.78290 2.92703 3.06076 5.19463 3.94224 55 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.03044 3.90315 4.62550 0.61958 0.77255 0.55549 0.85282 + 48 2.39251 4.23853 3.75245 3.18839 3.35715 3.69117 4.01036 2.17738 3.07061 2.00722 3.28706 3.53429 4.07078 3.39072 3.07752 2.97399 2.89120 1.85844 4.92824 3.71532 56 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.03044 3.90315 4.62550 0.61958 0.77255 0.55549 0.85282 + 49 2.56050 4.39105 3.34411 2.78319 3.60155 3.46480 3.77128 2.83822 2.62742 2.58594 3.21262 3.20237 3.88486 3.03059 2.56448 2.73642 2.19035 2.37832 5.02624 3.77891 57 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.03044 3.90315 4.62550 0.61958 0.77255 0.55549 0.85282 + 50 1.37812 2.80072 3.83498 3.42070 3.87397 2.99921 4.24161 2.96530 3.32256 2.89459 3.81917 3.44880 3.71764 3.60422 3.56604 2.43360 2.40411 2.61888 5.33835 4.15246 58 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.03044 3.90315 4.62550 0.61958 0.77255 0.55549 0.85282 + 51 2.74532 4.50724 3.42983 2.95244 3.42568 3.60626 3.88910 2.77026 2.70375 2.22807 1.95486 3.35569 4.02547 2.58121 2.99178 2.94186 2.99694 2.66631 5.01046 3.74777 59 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.03044 3.90315 4.62550 0.61958 0.77255 0.44450 1.02483 + 52 0.87297 4.24657 3.57075 3.36786 4.15839 3.06811 4.37727 3.29971 3.38685 3.17640 4.19749 3.49040 3.81731 3.71861 3.62959 2.59634 2.88098 2.93600 5.57511 4.38724 60 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 53 1.96298 4.17134 3.43460 3.07855 4.14627 2.98936 4.12481 3.46945 3.08161 3.21642 4.06614 3.27556 3.70074 3.39215 3.40515 1.84467 1.63498 3.01250 5.50977 4.28998 61 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 54 3.40066 4.84720 3.99369 3.74344 2.30278 3.95279 3.67128 3.39553 3.59798 2.82228 4.05988 3.85394 4.42456 3.87882 3.75994 3.52665 3.68805 3.27113 3.95029 0.80817 62 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 55 2.86663 5.06853 2.87640 2.51952 4.45748 3.43879 3.66568 3.89866 1.33937 3.41664 4.27179 2.44223 3.91577 2.81805 2.46217 2.85914 3.10555 3.54515 5.50478 4.21799 63 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 56 2.89101 4.40561 4.26922 3.93641 3.62800 3.83108 4.72052 2.04974 3.80577 2.29743 3.57810 4.10920 4.38636 4.15841 4.00806 3.34183 3.25039 0.90272 5.42983 4.16757 64 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 57 2.78989 4.87427 3.10728 2.66228 4.33471 3.44160 3.70636 3.64306 1.30828 3.25641 4.14609 3.10047 3.92071 2.86764 2.46119 2.83588 2.59339 3.32217 5.44317 4.19498 65 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 58 3.28295 4.64373 4.65267 4.15432 2.12281 4.39226 4.40565 2.30868 4.01063 0.99404 2.96208 4.34589 4.63887 4.13687 4.14117 3.75853 3.51440 2.42033 4.68321 3.26182 66 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 59 3.08248 4.42168 4.72065 4.23378 3.50231 4.37831 4.95293 1.13074 4.10572 1.99571 3.31982 4.46032 4.70821 4.37869 4.30619 3.77127 3.35421 1.44848 5.47660 4.27063 67 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 60 2.47137 4.31634 3.52340 3.28135 4.06362 3.15188 4.29038 3.20358 3.22639 3.06334 4.10788 3.47324 3.86421 3.61618 3.47946 2.67390 1.00625 2.88730 5.49222 4.28053 68 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 61 2.89484 4.63395 3.51346 3.36817 4.35306 3.31558 4.43642 3.92611 3.43456 3.54133 4.59617 3.66397 0.65427 3.82016 3.66760 3.06578 3.34480 3.55944 5.51022 4.47541 69 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 62 2.83547 5.32344 1.90710 1.42799 4.63051 3.24198 3.71244 4.09996 2.65068 3.63347 4.46321 2.71732 3.81726 2.86723 3.20067 2.75440 2.81778 3.69487 5.81218 4.35094 70 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 63 2.79923 4.56350 3.49435 3.40744 4.54632 0.58454 4.52062 4.17205 3.60289 3.81287 4.79002 3.65874 3.95796 3.91884 3.82676 2.97427 3.28861 3.68020 5.61312 4.65200 71 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 64 2.69344 5.03834 2.59685 1.78499 4.35492 3.31996 3.63904 3.79867 2.33359 3.34661 4.15382 2.64678 2.71516 2.78054 2.89199 2.67010 2.77928 3.42501 5.53498 4.15652 72 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 65 2.70271 4.40317 3.56325 3.00957 3.45446 3.68235 3.94694 2.18180 2.88182 2.21283 3.37093 3.41883 4.05792 2.33611 3.21378 2.95204 2.94041 2.01647 5.02429 3.78732 73 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 66 3.04481 5.17464 2.53544 0.88540 4.53437 3.34332 3.94029 4.00914 2.83416 3.60986 4.58016 2.99593 3.95313 3.15433 3.25317 3.01711 3.35013 3.68253 5.68627 4.40959 74 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 67 3.05681 4.44153 4.54138 3.99838 1.97987 4.22221 4.40129 2.17878 3.87522 1.45215 3.02589 4.20160 4.50632 4.03401 4.02978 3.55251 3.29207 1.80812 4.80289 3.46847 75 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 68 2.82984 5.35567 1.99168 1.57663 4.64578 3.25717 3.68509 4.14274 2.58330 3.63869 4.45307 2.71724 3.81329 2.22362 3.11653 2.74299 3.09347 3.72626 5.79564 4.33600 76 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 69 2.50977 1.62448 4.23724 3.80750 3.60189 3.40590 4.45756 2.35254 3.63764 2.45765 3.57920 3.82230 4.04603 3.92585 3.81907 2.84633 2.91668 1.82275 5.24689 4.01880 77 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 70 2.77571 5.11398 2.10801 2.05696 4.45701 3.25620 3.72899 3.91339 2.64389 3.48166 4.32027 2.78446 1.86353 2.89484 3.15510 2.73789 3.05806 3.53410 5.67671 4.27030 78 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 71 2.91274 5.42662 1.24765 1.93231 4.73792 3.20738 3.76458 4.24169 2.78531 3.76893 4.62568 2.68636 3.83308 2.93581 3.37349 2.60161 3.20907 3.82383 5.94007 4.44265 79 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 72 2.93000 5.34144 1.08347 2.15883 4.66482 3.19912 3.82811 4.25255 2.88821 3.80850 4.69751 2.51974 3.85217 3.02158 3.46889 2.84580 3.25390 3.83179 5.90365 4.41772 80 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 73 2.89101 4.40561 4.26922 3.93641 3.62800 3.83108 4.72052 2.04974 3.80577 2.29743 3.57810 4.10920 4.38636 4.15841 4.00806 3.34183 3.25039 0.90272 5.42983 4.16757 81 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 74 3.40066 4.84720 3.99369 3.74344 2.30278 3.95279 3.67128 3.39553 3.59798 2.82228 4.05988 3.85394 4.42456 3.87882 3.75994 3.52665 3.68805 3.27113 3.95029 0.80817 82 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 75 3.08173 4.41570 4.73343 4.24332 3.51344 4.38931 4.96241 1.16063 4.11994 2.00857 3.32756 4.46929 4.71466 4.39012 4.32070 3.78014 3.35186 1.39369 5.48545 4.28088 83 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 76 3.27378 4.70553 4.35708 3.99825 3.17780 4.11433 4.62122 2.38848 3.76496 0.75643 3.16963 4.26355 4.53226 4.10824 3.92358 3.69863 3.56359 2.45281 5.09417 3.84135 84 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 77 3.10426 5.24570 0.77891 2.40498 4.63731 3.29196 4.02650 4.24977 3.13093 3.83985 4.82107 2.96628 3.95224 3.26642 3.66070 3.05541 3.44536 3.87811 5.78539 4.49402 85 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 78 2.10165 4.63153 3.04360 2.53313 3.37849 3.42468 3.14974 3.24484 2.48640 2.87927 3.73924 3.02051 3.83549 2.34761 2.89722 2.67591 2.83487 2.96227 5.11406 3.77860 86 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 79 0.87297 4.24657 3.57075 3.36786 4.15839 3.06811 4.37727 3.29971 3.38685 3.17640 4.19749 3.49040 3.81731 3.71861 3.62959 2.59634 2.88098 2.93600 5.57511 4.38724 87 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 80 3.04481 5.17464 2.53544 0.88540 4.53437 3.34332 3.94029 4.00914 2.83416 3.60986 4.58016 2.99593 3.95313 3.15433 3.25317 3.01711 3.35013 3.68253 5.68627 4.40959 88 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 81 3.04481 5.17464 2.53544 0.88540 4.53437 3.34332 3.94029 4.00914 2.83416 3.60986 4.58016 2.99593 3.95313 3.15433 3.25317 3.01711 3.35013 3.68253 5.68627 4.40959 89 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 82 2.02804 4.79412 2.56696 2.04470 4.09359 3.33689 3.67081 3.44631 2.51465 3.10781 3.94410 2.90500 3.80252 2.83547 2.98166 2.64658 2.87169 2.76307 5.37415 4.03168 90 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 83 2.79923 4.56350 3.49435 3.40744 4.54632 0.58454 4.52062 4.17205 3.60289 3.81287 4.79002 3.65874 3.95796 3.91884 3.82676 2.97427 3.28861 3.68020 5.61312 4.65200 91 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 84 2.73428 4.33692 3.73213 3.19478 3.16177 3.72868 2.92126 1.73180 3.00305 2.10225 3.32627 3.53324 4.10443 3.37488 3.27326 3.02489 2.97120 2.37844 4.75364 3.40581 92 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 85 2.98626 5.46880 1.08491 1.97249 4.77077 3.21550 3.81546 4.28421 2.87189 3.82944 4.72170 2.71026 3.86087 3.00007 3.46540 2.87647 3.29141 3.87860 5.96770 4.48798 93 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 86 3.27378 4.70553 4.35708 3.99825 3.17780 4.11433 4.62122 2.38848 3.76496 0.75643 3.16963 4.26355 4.53226 4.10824 3.92358 3.69863 3.56359 2.45281 5.09417 3.84135 94 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 87 2.89484 4.63395 3.51346 3.36817 4.35306 3.31558 4.43642 3.92611 3.43456 3.54133 4.59617 3.66397 0.65427 3.82016 3.66760 3.06578 3.34480 3.55944 5.51022 4.47541 95 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 88 3.48726 4.82741 4.35628 4.01269 1.82549 4.23514 3.48811 3.25093 3.87322 2.62544 3.87831 3.93991 4.57991 3.96204 3.99151 3.61127 3.72377 3.16284 3.67256 0.95290 96 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 89 2.36871 4.29005 3.29968 3.12112 4.18153 3.01810 4.22768 3.71868 3.20194 3.43114 4.34903 3.32859 3.76571 3.54324 3.48419 0.94365 2.85682 3.23083 5.54583 4.26583 97 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 90 2.70964 0.75093 4.25205 4.01610 3.98428 3.30982 4.64026 3.14621 3.84384 3.05665 4.18165 3.97525 4.02496 4.18572 3.94943 2.98138 3.18527 2.88356 5.37752 4.27103 98 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 91 3.12574 4.95602 3.62729 3.11760 4.33719 3.59265 3.90370 3.88680 2.28467 3.38377 4.38192 3.46899 4.09078 3.11945 0.82993 3.20529 3.38498 3.60641 5.37824 4.24257 99 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 92 0.87297 4.24657 3.57075 3.36786 4.15839 3.06811 4.37727 3.29971 3.38685 3.17640 4.19749 3.49040 3.81731 3.71861 3.62959 2.59634 2.88098 2.93600 5.57511 4.38724 100 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 93 2.79923 4.56350 3.49435 3.40744 4.54632 0.58454 4.52062 4.17205 3.60289 3.81287 4.79002 3.65874 3.95796 3.91884 3.82676 2.97427 3.28861 3.68020 5.61312 4.65200 101 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 94 2.36871 4.29005 3.29968 3.12112 4.18153 3.01810 4.22768 3.71868 3.20194 3.43114 4.34903 3.32859 3.76571 3.54324 3.48419 0.94365 2.85682 3.23083 5.54583 4.26583 102 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 95 2.70964 0.75093 4.25205 4.01610 3.98428 3.30982 4.64026 3.14621 3.84384 3.05665 4.18165 3.97525 4.02496 4.18572 3.94943 2.98138 3.18527 2.88356 5.37752 4.27103 103 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 96 2.36871 4.29005 3.29968 3.12112 4.18153 3.01810 4.22768 3.71868 3.20194 3.43114 4.34903 3.32859 3.76571 3.54324 3.48419 0.94365 2.85682 3.23083 5.54583 4.26583 104 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 97 2.36871 4.29005 3.29968 3.12112 4.18153 3.01810 4.22768 3.71868 3.20194 3.43114 4.34903 3.32859 3.76571 3.54324 3.48419 0.94365 2.85682 3.23083 5.54583 4.26583 105 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 98 2.70964 0.75093 4.25205 4.01610 3.98428 3.30982 4.64026 3.14621 3.84384 3.05665 4.18165 3.97525 4.02496 4.18572 3.94943 2.98138 3.18527 2.88356 5.37752 4.27103 106 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 99 0.87297 4.24657 3.57075 3.36786 4.15839 3.06811 4.37727 3.29971 3.38685 3.17640 4.19749 3.49040 3.81731 3.71861 3.62959 2.59634 2.88098 2.93600 5.57511 4.38724 107 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 100 2.79923 4.56350 3.49435 3.40744 4.54632 0.58454 4.52062 4.17205 3.60289 3.81287 4.79002 3.65874 3.95796 3.91884 3.82676 2.97427 3.28861 3.68020 5.61312 4.65200 108 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 101 3.06946 5.03551 3.25229 2.85531 4.44585 3.54670 3.82012 3.88188 0.90373 3.42461 4.38128 3.27486 4.04036 3.00629 2.45564 3.10509 3.31538 3.58407 5.45821 4.28639 109 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 102 3.06247 4.41039 4.65086 4.13598 3.48324 4.35915 4.85935 1.65561 4.00771 1.89605 3.31161 4.38665 4.67296 4.28428 4.22305 3.72759 3.32396 1.08186 5.42132 4.21018 110 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 103 2.33323 4.28075 3.53672 3.04537 3.62455 3.45748 3.98551 2.58410 2.72399 2.59228 3.55231 3.38781 3.95328 3.30102 3.25844 2.79290 2.46624 1.66085 5.10597 3.87716 111 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 104 2.09904 4.31904 3.13967 2.79512 4.23584 2.43802 3.97520 3.66080 2.88605 3.30435 4.12032 2.79615 3.70254 3.18983 3.27753 1.61859 2.49732 3.17574 5.54095 4.27688 112 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 105 2.79923 4.56350 3.49435 3.40744 4.54632 0.58454 4.52062 4.17205 3.60289 3.81287 4.79002 3.65874 3.95796 3.91884 3.82676 2.97427 3.28861 3.68020 5.61312 4.65200 113 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 106 2.34210 4.57052 2.98887 2.43186 3.63497 3.31233 3.71920 3.32573 2.57569 2.97882 3.82112 2.81207 3.79423 2.91349 3.00476 1.86229 2.69145 3.00524 5.25570 3.95436 114 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 107 3.05964 4.41092 4.64145 4.12759 3.48238 4.35054 4.85240 1.66963 3.99735 1.89738 3.31309 4.37857 4.66775 4.27653 4.21363 3.71953 3.32208 1.07763 5.41853 4.20516 115 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 108 2.91005 5.38045 1.25818 2.12941 4.69830 3.20228 3.78776 4.26304 2.81947 3.79137 4.65619 2.14323 3.83796 2.96707 3.40279 2.81725 3.21882 3.83565 5.91563 4.42054 116 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 109 2.96665 4.95377 2.97494 2.73211 4.13599 3.43683 3.89106 3.78353 2.54586 3.27542 4.30113 3.19246 3.99230 1.05904 2.82765 3.01035 3.26391 3.50694 5.38986 4.09082 117 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 110 2.64618 4.90499 2.31134 2.18942 4.30332 3.26131 3.70172 3.73572 2.57300 3.32434 4.14511 2.84177 3.78986 2.86174 3.06104 1.76618 2.63178 3.35922 5.54260 4.16860 118 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 111 3.10426 5.24570 0.77891 2.40498 4.63731 3.29196 4.02650 4.24977 3.13093 3.83985 4.82107 2.96628 3.95224 3.26642 3.66070 3.05541 3.44536 3.87811 5.78539 4.49402 119 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 112 2.73269 4.96873 2.61141 2.26957 4.35491 2.17303 3.70728 3.80016 2.46897 3.36392 4.20366 2.88233 3.83451 1.94009 2.87446 2.73151 3.00866 3.43365 5.54626 4.19876 120 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 113 2.56630 4.67539 2.76483 2.50324 4.25470 3.20379 3.80042 3.71196 2.47872 3.32135 4.15966 2.47516 3.79205 2.98884 3.00841 1.53662 2.90903 3.30833 5.51362 4.18451 121 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 114 3.45422 4.77029 4.46140 4.11213 1.01250 4.26302 3.55945 3.07075 3.96969 2.40922 3.69615 4.01237 4.59409 4.02617 4.05737 3.63979 3.68916 3.02613 3.73517 1.83750 122 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 115 3.27378 4.70553 4.35708 3.99825 3.17780 4.11433 4.62122 2.38848 3.76496 0.75643 3.16963 4.26355 4.53226 4.10824 3.92358 3.69863 3.56359 2.45281 5.09417 3.84135 123 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 116 2.92493 5.35887 1.12201 2.14550 4.68054 3.19834 3.81470 4.26138 2.86788 3.80711 4.68829 2.43062 3.84716 3.00361 3.45124 2.83676 3.24430 3.83759 5.91360 4.42201 124 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02824 3.97705 4.69940 0.61958 0.77255 0.48576 0.95510 + 117 2.99103 5.43832 1.04731 2.03422 4.75036 3.21916 3.83186 4.26509 2.89245 3.82288 4.72422 2.72815 3.86743 3.02108 3.48036 2.88767 3.30065 3.86474 5.95049 4.48470 125 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.05161 3.97705 3.45590 0.61958 0.77255 0.48576 0.95510 + 118 2.86997 5.43069 1.57180 1.74614 4.72729 2.80306 3.71453 4.23943 2.69618 3.73332 4.56237 2.43722 3.80910 2.87126 3.27991 2.76596 3.14983 3.81040 5.89719 4.40314 126 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02889 3.95434 4.67668 0.61958 0.77255 0.50828 0.92013 + 119 2.94701 4.93449 2.95833 2.71460 4.11381 3.42085 3.87354 3.75736 2.52981 3.25157 4.27740 3.17495 3.97565 1.09531 2.81227 2.99143 3.24405 3.48203 5.37148 4.07074 127 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02889 3.95434 4.67668 0.61958 0.77255 0.50828 0.92013 + 120 2.77849 4.28259 3.99549 3.02221 3.34513 3.89873 4.21017 1.60238 3.32583 1.96055 3.04166 3.76188 4.24121 3.61775 3.59603 3.18793 3.01465 1.89778 5.01613 3.81900 128 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02889 3.95434 4.67668 0.61958 0.77255 0.50828 0.92013 + 121 2.05663 4.99383 2.42035 1.95337 4.30142 3.11016 3.64379 3.74448 2.38547 3.30891 4.11909 2.80952 3.78509 2.79112 2.97996 2.54099 2.92358 3.37653 5.51637 4.13250 129 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02889 3.95434 4.67668 0.61958 0.77255 0.50828 0.92013 + 122 2.37074 5.20065 2.03752 1.62561 4.52764 2.94012 3.68254 3.99698 2.59389 3.53203 4.34713 2.73405 3.79399 2.83254 3.13133 2.70217 3.03318 3.59496 5.71621 4.27884 130 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02889 3.95434 4.67668 0.61958 0.77255 0.50828 0.92013 + 123 2.76891 4.53595 3.45942 3.36936 4.50963 0.61326 4.48439 4.12940 3.56175 3.77320 4.74981 3.62373 3.92970 3.87945 3.78857 2.94321 3.25651 3.64192 5.58291 4.61439 131 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02889 3.95434 4.67668 0.61958 0.77255 0.50828 0.92013 + 124 3.45280 4.72560 4.55948 4.18538 1.45983 4.27876 3.45556 3.19175 4.01502 2.56322 3.77632 3.99268 4.58568 4.02082 4.06587 3.62371 3.67122 3.09770 1.76510 1.80304 132 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02889 3.95434 4.67668 0.61958 0.77255 0.50828 0.92013 + 125 2.87283 4.39315 4.23821 3.90420 3.61058 3.80809 4.69198 2.04849 3.77322 2.28363 3.56364 4.08078 4.36427 4.12727 3.97777 3.31702 3.23254 0.92773 5.40873 4.14528 133 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02889 3.95434 4.67668 0.61958 0.77255 0.50828 0.92013 + 126 3.24760 4.68579 4.32075 3.96132 3.16793 4.08580 4.59138 2.37683 3.72825 0.78064 3.16594 4.22883 4.50730 4.07699 3.89079 3.66669 3.53825 2.43535 5.07658 3.81868 134 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02889 3.95434 4.67668 0.61958 0.77255 0.50828 0.92013 + 127 2.45786 4.30296 3.50186 3.25812 4.04222 3.13941 4.26905 3.17937 3.20271 3.03994 4.08552 3.45408 3.84975 3.59352 3.45722 2.66008 1.04037 2.86556 5.47283 4.25897 135 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02889 3.95434 4.67668 0.61958 0.77255 0.50828 0.92013 + 128 2.68154 0.78852 4.21932 3.97783 3.95068 3.28696 4.60693 3.10838 3.80528 3.02007 4.14415 3.94300 4.00035 4.14805 3.91507 2.95331 3.15521 2.84739 5.34926 4.23772 136 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02889 3.95434 4.67668 0.61958 0.77255 0.50828 0.92013 + 129 2.02617 4.29048 3.42265 2.94627 3.54036 3.40652 3.31257 2.77872 2.86355 2.59741 3.53948 3.30371 3.90044 3.21666 3.18816 2.73904 2.82169 1.86270 5.00831 3.74432 137 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02889 3.95434 4.67668 0.61958 0.77255 0.50828 0.92013 + 130 0.90195 4.23400 3.54659 3.34205 4.13472 3.05626 4.35430 3.27256 3.36043 3.15035 4.17350 3.47069 3.80326 3.69417 3.60509 2.58374 2.86679 2.91280 5.55371 4.36315 138 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02889 3.95434 4.67668 0.61958 0.77255 0.50828 0.92013 + 131 3.44381 4.80306 4.30117 3.95207 1.85364 4.19548 3.48537 3.22033 3.81418 2.60484 3.85318 3.90681 4.54641 3.92239 3.94488 3.57229 3.68268 3.12961 3.68006 0.97942 139 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02889 3.95434 4.67668 0.61958 0.77255 0.50828 0.92013 + 132 2.86235 4.60578 3.47842 3.32948 4.31715 3.28867 4.39999 3.88386 3.39382 3.50174 4.55528 3.62780 0.68858 3.78012 3.62986 3.03247 3.31042 3.51987 5.48103 4.43903 140 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02889 3.95434 4.67668 0.61958 0.77255 0.50828 0.92013 + 133 2.60256 4.60991 3.08123 2.59418 3.90705 3.39886 3.69738 3.25085 2.27951 2.91739 3.78849 3.05676 3.84470 2.63540 2.79735 2.69573 1.94572 2.76699 5.21418 3.93668 141 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02889 3.95434 4.67668 0.61958 0.77255 0.50828 0.92013 + 134 2.16968 3.47307 3.59233 3.22260 4.15866 2.47411 4.19438 3.56363 3.18625 3.27458 4.10858 3.32406 3.66022 3.48496 3.48055 1.23700 2.65371 3.05043 5.52336 4.31592 142 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02889 3.95434 4.67668 0.61958 0.77255 0.50828 0.92013 + 135 3.07859 5.21813 0.80740 2.38838 4.60638 3.27362 4.00471 4.21341 3.10456 3.80732 4.78755 2.94873 3.93224 3.24424 3.63163 3.03196 3.41903 3.84400 5.75900 4.46621 143 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02889 3.95434 4.67668 0.61958 0.77255 0.50828 0.92013 + 136 2.87283 4.39315 4.23821 3.90420 3.61058 3.80809 4.69198 2.04849 3.77322 2.28363 3.56364 4.08078 4.36427 4.12727 3.97777 3.31702 3.23254 0.92773 5.40873 4.14528 144 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02889 3.95434 4.67668 0.61958 0.77255 0.50828 0.92013 + 137 2.50102 4.23694 3.76525 3.33965 3.72246 3.37067 4.24809 2.46042 3.23911 2.55924 3.64161 3.56053 3.97799 3.58142 3.52035 2.77764 1.69802 1.75863 5.30971 4.08018 145 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02889 3.95434 4.67668 0.61958 0.77255 0.50828 0.92013 + 138 3.09498 4.49149 4.45102 4.07022 3.43002 4.15408 4.78347 0.98199 3.89992 1.99977 3.35310 4.30411 4.57779 4.24002 4.08717 3.65761 3.39284 1.85079 5.33749 4.08258 146 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02889 3.95434 4.67668 0.61958 0.77255 0.50828 0.92013 + 139 3.02382 5.15051 2.52384 0.91441 4.50717 3.32764 3.92196 3.97736 2.81286 3.58149 4.55225 2.98104 3.93620 3.13613 3.22992 2.99812 3.32879 3.65289 5.66334 4.38601 147 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02889 3.95434 4.67668 0.61958 0.77255 0.50828 0.92013 + 140 2.45786 4.30296 3.50186 3.25812 4.04222 3.13941 4.26905 3.17937 3.20271 3.03994 4.08552 3.45408 3.84975 3.59352 3.45722 2.66008 1.04037 2.86556 5.47283 4.25897 148 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02889 3.95434 4.67668 0.61958 0.77255 0.50828 0.92013 + 141 3.08695 4.88934 3.20791 2.97643 3.34377 3.51816 0.98092 3.80251 2.81733 3.28606 4.33566 3.38232 4.07539 3.34383 3.07797 3.15699 3.39324 3.53609 4.80769 3.29239 149 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02889 3.95434 4.67668 0.61958 0.77255 0.50828 0.92013 + 142 2.99214 5.06805 3.26268 2.74531 4.47846 3.57206 3.65342 3.86981 1.12103 3.36156 4.25702 3.16311 3.99796 2.80635 2.11223 3.00404 3.19554 3.55761 5.42835 4.23089 150 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02889 3.95434 4.67668 0.61958 0.77255 0.50828 0.92013 + 143 3.02382 5.15051 2.52384 0.91441 4.50717 3.32764 3.92196 3.97736 2.81286 3.58149 4.55225 2.98104 3.93620 3.13613 3.22992 2.99812 3.32879 3.65289 5.66334 4.38601 151 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02889 3.95434 4.67668 0.61958 0.77255 0.50828 0.92013 + 144 2.49167 5.21869 2.13891 1.38935 4.54510 3.23855 3.71342 3.98470 2.64038 3.55288 4.39217 2.73628 3.81159 2.87379 3.17028 2.74234 3.08340 3.59770 5.74876 4.31122 152 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02889 3.95434 4.67668 0.61958 0.77255 0.50828 0.92013 + 145 2.67924 5.36825 1.81597 1.42545 4.67130 3.22067 3.71949 4.14895 2.68617 3.67868 4.51726 2.69278 3.81366 2.87890 3.25116 2.76699 3.13943 3.73938 5.85528 4.37934 153 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02889 3.95434 4.67668 0.61958 0.77255 0.50828 0.92013 + 146 3.24708 4.60677 4.69416 4.13988 3.08947 4.47063 4.76500 1.92492 3.96672 0.95356 2.71915 4.43331 4.67883 4.15873 4.13317 3.81764 3.47493 2.15974 5.15578 4.04247 154 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.02889 3.95434 4.67668 0.61958 0.77255 0.50828 0.92013 + 147 2.69781 4.29649 3.84369 3.29786 3.44437 3.73086 4.15124 2.24231 3.19336 2.10104 3.11890 3.63278 4.14347 3.51043 3.49251 3.03876 2.03846 1.78833 5.07714 3.86271 155 - - + 2.68618 4.42225 2.77519 2.73123 3.46354 2.40513 3.72494 3.29354 2.67741 2.69355 4.24690 2.90347 2.73739 3.18146 2.89801 2.37887 2.77519 2.98518 4.58477 3.61503 + 0.18495 3.95434 1.89921 0.61958 0.77255 0.50828 0.92013 + 148 1.44115 4.10304 3.22225 2.99375 4.15355 2.08176 4.10711 3.47540 3.09081 3.24183 4.11431 3.18864 3.61518 3.39097 3.39593 2.35434 2.65737 2.99565 5.50492 4.29375 156 - - + 2.68608 4.42226 2.77520 2.73124 3.46354 2.40513 3.72495 3.29355 2.67741 2.69355 4.24690 2.90347 2.73740 3.18147 2.89801 2.37887 2.77520 2.98519 4.58477 3.61504 + 0.08120 2.55114 * 0.46726 0.98542 0.00000 * +// diff --git a/src/jalview/io/HMMFile.java b/src/jalview/io/HMMFile.java index 95e2017..18d9e78 100644 --- a/src/jalview/io/HMMFile.java +++ b/src/jalview/io/HMMFile.java @@ -188,23 +188,23 @@ public class HMMFile extends AlignFile */ void parseModel(BufferedReader input) throws IOException { - for (int i = 0; i < hmm.getLength() + 1; i++) + String line = input.readLine(); + int node = 0; + while (!"//".equals(line)) { hmm.getNodes().add(new HMMNode()); String next; - String line; - line = input.readLine(); Scanner matchReader = new Scanner(line); next = matchReader.next(); - if (next.equals(COMPO) || i > 0) + if (next.equals(COMPO) || node > 0) { // stores match emission line in list List matches = new ArrayList<>(); matches = fillList(matchReader, numberOfSymbols); - hmm.getNodes().get(i).setMatchEmissions(matches); - if (i > 0) + hmm.getNodes().get(node).setMatchEmissions(matches); + if (node > 0) { - parseAnnotations(matchReader, i); + parseAnnotations(matchReader, node); } } matchReader.close(); @@ -213,7 +213,7 @@ public class HMMFile extends AlignFile Scanner insertReader = new Scanner(line); List inserts = new ArrayList<>(); inserts = fillList(insertReader, numberOfSymbols); - hmm.getNodes().get(i).setInsertEmissions(inserts); + hmm.getNodes().get(node).setInsertEmissions(inserts); insertReader.close(); // stores state transition line in list @@ -221,8 +221,10 @@ public class HMMFile extends AlignFile Scanner transitionReader = new Scanner(line); List transitions = new ArrayList<>(); transitions = fillList(transitionReader, NUMBER_OF_TRANSITIONS); - hmm.getNodes().get(i).setStateTransitions(transitions); + hmm.getNodes().get(node).setStateTransitions(transitions); transitionReader.close(); + line = input.readLine(); + node++; } } diff --git a/src/jalview/io/StockholmFile.java b/src/jalview/io/StockholmFile.java index c2f3683..dbb33f3 100644 --- a/src/jalview/io/StockholmFile.java +++ b/src/jalview/io/StockholmFile.java @@ -195,7 +195,7 @@ public class StockholmFile extends AlignFile String version; // String id; Hashtable seqAnn = new Hashtable(); // Sequence related annotations - LinkedHashMap seqs = new LinkedHashMap(); + LinkedHashMap seqs = new LinkedHashMap<>(); Regex p, r, rend, s, x; // Temporary line for processing RNA annotation // String RNAannot = ""; @@ -657,7 +657,7 @@ public class StockholmFile extends AlignFile strucAnn = new Hashtable(); } - Vector newStruc = new Vector(); + Vector newStruc = new Vector<>(); parseAnnotationRow(newStruc, type, ns); for (AlignmentAnnotation alan : newStruc) { @@ -709,7 +709,7 @@ public class StockholmFile extends AlignFile private void guessDatabaseFor(Sequence seqO, String dbr, String dbsource) { DBRefEntry dbrf = null; - List dbrs = new ArrayList(); + List dbrs = new ArrayList<>(); String seqdb = "Unknown", sdbac = "" + dbr; int st = -1, en = -1, p; if ((st = sdbac.indexOf("/")) > -1) @@ -1151,7 +1151,6 @@ public class StockholmFile extends AlignFile out.append(newline); print(getSeqsAsArray(), false); - out.append("//"); out.append(newline); return out.toString(); } diff --git a/src/jalview/jbgui/GAlignFrame.java b/src/jalview/jbgui/GAlignFrame.java index ea56bbb..3f55752 100755 --- a/src/jalview/jbgui/GAlignFrame.java +++ b/src/jalview/jbgui/GAlignFrame.java @@ -40,6 +40,7 @@ import java.awt.event.FocusEvent; import java.awt.event.KeyEvent; import java.awt.event.MouseAdapter; import java.awt.event.MouseEvent; +import java.io.IOException; import java.util.HashMap; import java.util.Map; @@ -1690,6 +1691,28 @@ public class GAlignFrame extends JInternalFrame selectHighlightedColumns_actionPerformed(actionEvent); } }; + hmmBuild.setText(MessageManager.getString("label.hmmbuild")); + hmmBuild.addActionListener(new ActionListener() + { + + @Override + public void actionPerformed(ActionEvent e) + { + try + { + hmmBuild_actionPerformed(e); + } catch (IOException e1) + { + // TODO Auto-generated catch block + e1.printStackTrace(); + } catch (InterruptedException e1) + { + // TODO Auto-generated catch block + e1.printStackTrace(); + } + } + + }); selectHighlighted.addActionListener(al); JMenu tooltipSettingsMenu = new JMenu( MessageManager.getString("label.sequence_id_tooltip")); @@ -2381,6 +2404,7 @@ public class GAlignFrame extends JInternalFrame } protected void hmmBuild_actionPerformed(ActionEvent e) + throws IOException, InterruptedException { }