From: pvtroshin Date: Fri, 8 Apr 2011 12:34:01 +0000 (+0000) Subject: Remove old web site to replace with the new web site from JABA_r1 branch X-Git-Url: http://source.jalview.org/gitweb/?a=commitdiff_plain;h=f34e32976c1d2dc61b21cbc2d9f229d0d598a3b9;p=jabaws.git Remove old web site to replace with the new web site from JABA_r1 branch git-svn-id: link to svn.lifesci.dundee.ac.uk/svn/barton/ptroshin/JABA2@3935 e3abac25-378b-4346-85de-24260fe3988d --- diff --git a/website/Example_template.pdf b/website/Example_template.pdf deleted file mode 100644 index 20dc74f..0000000 Binary files a/website/Example_template.pdf and /dev/null differ diff --git a/website/archive/TO1381.fasta b/website/archive/TO1381.fasta new file mode 100644 index 0000000..8a51f01 --- /dev/null +++ b/website/archive/TO1381.fasta @@ -0,0 +1,8 @@ +>Foobar_dundeefriends +MTADGPRELLQLRAAVRHRPQDFVAWLMLADAELGMGDTTAGEMAVQRGLALHPGHPEAVARLGRVRWTQQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDAGQAEAAAAAYTRAHQLLPEEPYITAQLLNWRRRLCDWRALDVLSAQVRAAVAQGVGAVEPFAFLSEDASAAEQLACARTRAQAIAASVRPLAPTRVRSKGPLRVGFVSNGFGAHPTGLLTVALFEALQRRQPDLQMHLFATSGDDGSTLRTRLAQASTLHDVTALGHLATAKHIRHHGIDLLFDLRGWGGGGRPEVFALRPAPVQVNWLAYPGTSGAPWMDYVLGDAFALPPALEPFYSEHVLRLQGAFQPSDTSRVVAEPPSRTQCGLPEQGVVLCCFNNSYKLNPQSMARMLAVLREVPDSVLWLLSGPGEADARLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHADLFLDTHPYNAHTTASDALWTGCPVLTTPGETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALASDPAALTALHARVDVLRRESGVFEMDGFADDFGALLQALARRHGWLGI + +>Foobar +MGDTTAGEMAVQRGLALHQQRHAEAAVLLQQASDAAPEHPGIALWLHALEDAGQAEAAAAYTRAHQLLPEEPYITAQLLNAVAQGVGAVEPFAFLSEDASAAESVRPLAPTRVRSKGPLRVGFVSNGFGAHPTGLLTVALFEALQRRQPDLQMHLFATSGDDGSTLRTRLAQASTLHDVTALGHLATAKHIRHHGIDLLFDLRGWGGGGRPEVFALRPAPVQVNWLAYPGTSGAPWMDYVLGDAFALPPALEPFYSEHVLRLQGAFQPSDTSRVVAEPPSRTQCGLPEQGVVLCCFNNSYKLNPQSMARMLAVLREVPDSVLWLLSGPGEADARLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHADLFLDTHPYNAHTTASDALWTGCPVLTTPGETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALASDPAALTALHARVDVLRRESGVFEMDGFADDFGALLQALARRHGWLGI + +>dundeefriends +MTADGPRELLQLRAAVRHRPQDVAWLMLADAELGMGDTTAGEMAVQRGLALHPGHPEAVARLGRVRWTQQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDHQLLPEEPYITAQLDVLSAQVRAAVAQGVGAVEPFAFLSEDASAAEQLACARTRAQAIAASVRPLAPTRVRSKGPLRVGFVSNGFGAHPTGLLTVALFEALQRRQPDLQMHLFATSGDDGSTLRTRLAQASTLHDVTALGHLATAKHIRHHGIDLLFDLRGWGGGGRPEVFALRPAPVQVNWLAYPGTSGAPWMDYVLGDAFALPPALEPFYSEHVLRLQGAFQPSDTSRVVAEPPSRTQCGLPEQGVVLCCFNNSYKLNPQSMARMLAVLREVPDSVLWLLSGPGEADARLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHADLFLDTHPYNAHTTASDALWTGCPVLTTPGETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALASDPAALTALHARVDVLRRESI \ No newline at end of file diff --git a/website/archive/datamodel-1.0.jar b/website/archive/datamodel-1.0.jar index 439e4b6..c7d7e8b 100644 Binary files a/website/archive/datamodel-1.0.jar and b/website/archive/datamodel-1.0.jar differ diff --git a/website/archive/full-jaba-client.jar b/website/archive/full-jaba-client.jar index f5504ad..79644c4 100644 Binary files a/website/archive/full-jaba-client.jar and b/website/archive/full-jaba-client.jar differ diff --git a/website/archive/jaba-no-jaxws-no-binaries.war b/website/archive/jaba-no-jaxws-no-binaries.war index b8af524..426285d 100644 Binary files a/website/archive/jaba-no-jaxws-no-binaries.war and b/website/archive/jaba-no-jaxws-no-binaries.war differ diff --git a/website/archive/jaba-no-jaxws.war b/website/archive/jaba-no-jaxws.war index f25166c..7b1078e 100644 Binary files a/website/archive/jaba-no-jaxws.war and b/website/archive/jaba-no-jaxws.war differ diff --git a/website/archive/jaba.war b/website/archive/jaba.war index 89348ff..91a3bdc 100644 Binary files a/website/archive/jaba.war and b/website/archive/jaba.war differ diff --git a/website/archive/jaxws-lib.zip b/website/archive/jaxws-lib.zip index 9304cf2..084df15 100644 Binary files a/website/archive/jaxws-lib.zip and b/website/archive/jaxws-lib.zip differ diff --git a/website/archive/min-jaba-client.jar b/website/archive/min-jaba-client.jar index f5acf3e..28403e3 100644 Binary files a/website/archive/min-jaba-client.jar and b/website/archive/min-jaba-client.jar differ diff --git a/website/archive/out.txt b/website/archive/out.txt new file mode 100644 index 0000000..6398644 --- /dev/null +++ b/website/archive/out.txt @@ -0,0 +1,19 @@ +Conecting to JABAWS version 2 service + + +calling analise......... +#RawScore -0.226 -0.217 -0.479 -0.251 0.182 0.735 0.558 0.353 0.015 -0.322 -0.526 -0.755 -0.976 -1.206 -1.426 -1.609 -1.725 -1.826 -1.908 -1.993 -2.116 -2.229 -2.353 -2.472 -2.645 -2.818 -3.048 -3.296 -3.528 -3.753 -3.892 -4.033 -4.09 -4.096 -4.071 -4.013 -3.948 -3.894 -3.885 -3.878 -3.891 -3.888 -3.932 -4.051 -4.239 -4.397 -4.6 -4.737 -4.814 -4.844 -4.841 -4.841 -4.782 -4.755 -4.716 -4.664 -4.641 -4.64 -4.684 -4.71 -4.773 -4.88 -5.057 -5.267 -5.468 -5.648 -5.831 -5.958 -6.082 -6.213 -6.376 -6.567 -6.776 -7.042 -7.294 -7.526 -7.759 -8.028 -8.274 -8.492 -8.72 -8.931 -9.063 -9.123 -9.131 -9.102 -9.043 -9.009 -8.977 -8.937 -8.901 -8.881 -8.912 -8.968 -9.068 -9.147 -9.241 -9.368 -9.464 -9.583 -9.715 -9.814 -9.871 -9.948 -10.055 -10.185 -10.335 -10.535 -10.708 -10.866 -11.033 -11.274 -11.519 -11.733 -11.993 -12.176 -12.307 -12.428 -12.519 -12.594 -12.65 -12.7 -12.784 -12.87 -12.964 -13.053 -13.15 -13.257 -13.379 -13.539 -13.714 -13.922 -14.086 -14.252 -14.46 -14.599 -14.72 -14.878 -15.01 -15.143 -15.262 -15.401 -15.563 -15.705 -15.852 -16.013 -16.195 -16.432 -16.672 -16.945 -17.167 -17.362 -17.544 -17.765 -17.968 -18.11 -18.24 -18.358 -18.46 -18.543 -18.631 -18.705 -18.782 -18.841 -18.893 -18.965 -19.057 -19.166 -19.25 -19.383 -19.482 -19.598 -19.76 -19.943 -20.081 -20.225 -20.379 -20.538 -20.73 -20.921 -21.158 -21.362 -21.58 -21.82 -22.03 -22.225 -22.451 -22.653 -22.832 -22.978 -23.095 -23.219 -23.325 -23.427 -23.528 -23.568 -23.566 -23.525 -23.522 -23.504 -23.477 -23.453 -23.474 -23.536 -23.531 -23.563 -23.585 -23.558 -23.542 -23.507 -23.503 -23.472 -23.406 -23.357 -23.261 -23.112 -22.976 -22.864 -22.809 -22.751 -22.736 -22.803 -22.919 -23.074 -23.24 -23.503 -23.767 -24.034 -24.305 -24.526 -24.737 -24.873 -24.993 -25.102 -25.195 -25.301 -25.424 -25.547 -25.656 -25.758 -25.831 -25.879 -25.879 -25.857 -25.837 -25.814 -25.726 -25.597 -25.479 -25.368 -25.304 -25.257 -25.236 -25.271 -25.383 -25.515 -25.688 -25.854 -26.017 -26.218 -26.385 -26.505 -26.593 -26.693 -26.78 -26.852 -26.926 -26.992 -27.072 -27.179 -27.316 -27.474 -27.593 -27.745 -27.868 -27.948 -28.039 -28.146 -28.246 -28.368 -28.489 -28.571 -28.685 -28.816 -28.93 -29.035 -29.078 -29.1 -29.08 -29.012 -28.91 -28.781 -28.592 -28.424 -28.279 -28.136 -28.062 -27.99 -27.914 -27.874 -27.916 -27.96 -28.055 -28.164 -28.284 -28.443 -28.598 -28.747 -28.834 -28.915 -28.957 -29.011 -29.026 -29.027 -29.045 -28.991 -28.915 -28.77 -28.671 -28.587 -28.507 -28.401 -28.309 -28.251 -28.294 -28.425 -28.521 -28.581 -28.647 -28.755 -28.81 -28.868 -28.888 -28.895 -28.912 -28.882 -28.846 -28.844 -28.878 -28.906 -28.965 -29.034 -29.122 -29.246 -29.463 -29.661 -29.816 -29.958 -30.107 -30.236 -30.276 -30.287 -30.288 -30.262 -30.276 -30.297 -30.313 -30.31 -30.3 -30.294 -30.304 -30.309 -30.298 -30.341 -30.382 -30.374 -30.376 -30.316 -30.219 -30.088 -29.972 -29.895 -29.857 -29.893 -29.999 -30.104 -30.164 -30.209 -30.252 -30.32 -30.441 -30.544 -30.614 -30.679 -30.675 -30.661 -30.643 -30.568 -30.506 -30.466 -30.467 -30.506 -30.583 -30.706 -30.9 -31.114 -31.329 -31.53 -31.725 -31.947 -32.151 -32.304 -32.48 -32.654 -32.838 -33.008 -33.11 -33.154 -33.187 -33.175 -33.148 -33.111 -33.076 -33.051 -33.066 -33.055 -33.044 -33.014 -33.012 -33.082 -33.162 -33.311 -33.504 -33.718 -33.927 -34.095 -34.215 -34.341 -34.48 -34.638 -34.785 -34.904 -35.065 -35.209 -35.374 -35.5 -35.601 -35.658 -35.705 -35.754 -35.755 -35.768 -35.761 -35.748 -35.763 -35.763 -35.784 -35.834 -35.952 -36.121 -36.274 -36.476 -36.688 -36.871 -37.015 -37.091 -37.14 -37.165 -37.164 -37.168 -37.176 -37.158 -37.122 -37.071 -37.049 -37.041 -37.047 -37.102 -37.152 -37.175 -37.215 -37.27 -37.322 -37.392 -37.4 -37.402 -37.371 -37.312 -37.233 -37.171 -37.092 -37 -36.974 -36.999 -37.044 -37.137 -37.219 -37.314 -37.351 -37.446 -37.547 -37.678 -37.804 -37.88 -37.926 -37.939 -37.921 -37.923 -37.941 -37.948 -37.95 -37.979 -38.034 -38.076 -38.13 -38.221 -38.307 -38.411 -38.529 -38.698 -38.88 -39.12 -39.379 -39.615 -39.839 -40.013 -40.206 -40.395 -40.541 -40.656 -40.75 -40.834 -40.897 -40.997 -41.084 -41.158 -41.247 -41.367 -41.513 -41.718 -41.991 -42.237 -42.458 -42.616 -42.76 -42.921 -43.109 -43.244 -43.348 -43.465 -43.562 -43.624 -43.691 -43.731 -43.704 -43.664 -43.634 -43.61 -43.599 -43.619 -43.654 -43.674 -43.745 -43.883 -44.035 -44.21 -44.424 -44.581 -44.977 -45.238 -45.415 -45.591 -45.592 -45.159 -45.403 -45.741 -45.307 -45.729 +#Dydx 0.004 -0.131 0.114 0.217 0.276 -0.088 -0.102 -0.169 -0.169 -0.169 -0.131 -0.135 -0.139 -0.149 -0.158 -0.16 -0.155 -0.15 -0.148 -0.149 -0.146 -0.145 -0.147 -0.151 -0.149 -0.15 -0.147 -0.141 -0.133 -0.125 -0.111 -0.091 -0.069 -0.05 -0.038 -0.032 -0.029 -0.03 -0.027 -0.032 -0.043 -0.053 -0.064 -0.07 -0.074 -0.071 -0.065 -0.055 -0.046 -0.04 -0.036 -0.037 -0.034 -0.025 -0.021 -0.023 -0.031 -0.044 -0.057 -0.065 -0.078 -0.094 -0.114 -0.136 -0.15 -0.159 -0.168 -0.169 -0.172 -0.179 -0.187 -0.196 -0.206 -0.214 -0.208 -0.202 -0.201 -0.19 -0.181 -0.168 -0.146 -0.119 -0.097 -0.076 -0.061 -0.049 -0.041 -0.029 -0.02 -0.018 -0.023 -0.032 -0.04 -0.053 -0.057 -0.06 -0.069 -0.083 -0.092 -0.104 -0.118 -0.124 -0.124 -0.128 -0.132 -0.138 -0.148 -0.159 -0.162 -0.166 -0.174 -0.174 -0.176 -0.175 -0.166 -0.15 -0.139 -0.127 -0.117 -0.11 -0.107 -0.109 -0.107 -0.108 -0.112 -0.115 -0.118 -0.127 -0.132 -0.133 -0.139 -0.149 -0.152 -0.158 -0.16 -0.156 -0.154 -0.152 -0.149 -0.148 -0.15 -0.155 -0.163 -0.168 -0.176 -0.184 -0.193 -0.193 -0.198 -0.193 -0.185 -0.181 -0.176 -0.164 -0.156 -0.144 -0.137 -0.134 -0.124 -0.116 -0.104 -0.098 -0.089 -0.084 -0.083 -0.088 -0.096 -0.109 -0.117 -0.126 -0.13 -0.136 -0.143 -0.152 -0.153 -0.155 -0.16 -0.17 -0.183 -0.193 -0.199 -0.202 -0.205 -0.195 -0.187 -0.182 -0.168 -0.152 -0.14 -0.134 -0.126 -0.116 -0.107 -0.089 -0.064 -0.045 -0.03 -0.021 -0.011 -0.007 -0.011 -0.01 -0.011 -0.008 -0.002 0.006 0.006 0.014 0.028 0.04 0.051 0.052 0.05 0.045 0.041 0.04 0.031 0.018 -0.003 -0.021 -0.044 -0.073 -0.102 -0.127 -0.147 -0.159 -0.16 -0.166 -0.173 -0.171 -0.166 -0.155 -0.147 -0.143 -0.133 -0.123 -0.107 -0.09 -0.071 -0.047 -0.025 -0.007 0.004 0.01 0.014 0.013 0.014 0.017 0.014 0.007 -0.001 -0.007 -0.021 -0.038 -0.055 -0.076 -0.095 -0.111 -0.125 -0.129 -0.124 -0.119 -0.113 -0.109 -0.108 -0.104 -0.099 -0.101 -0.106 -0.111 -0.116 -0.111 -0.109 -0.106 -0.105 -0.103 -0.106 -0.103 -0.105 -0.111 -0.103 -0.095 -0.084 -0.069 -0.046 -0.022 -0.001 0.026 0.044 0.053 0.058 0.06 0.062 0.057 0.062 0.06 0.059 0.049 0.038 0.017 -0.004 -0.023 -0.05 -0.074 -0.094 -0.099 -0.091 -0.084 -0.065 -0.042 -0.027 -0.007 0.005 0.01 0.015 0.024 0.024 0.029 0.034 0.041 0.038 0.035 0.026 0.008 -0.007 -0.018 -0.026 -0.034 -0.043 -0.043 -0.04 -0.042 -0.034 -0.03 -0.028 -0.027 -0.032 -0.042 -0.06 -0.072 -0.074 -0.08 -0.09 -0.103 -0.113 -0.111 -0.098 -0.086 -0.075 -0.068 -0.058 -0.054 -0.054 -0.052 -0.043 -0.025 -0.009 -0 0.006 0.006 0.003 0.011 0.01 0.013 0.01 0.01 0.019 0.024 0.025 0.024 0.022 0.015 -0 -0.015 -0.031 -0.038 -0.04 -0.04 -0.046 -0.048 -0.045 -0.044 -0.035 -0.034 -0.027 -0.024 -0.026 -0.024 -0.029 -0.041 -0.061 -0.081 -0.101 -0.127 -0.14 -0.143 -0.14 -0.143 -0.148 -0.159 -0.168 -0.169 -0.166 -0.152 -0.129 -0.101 -0.077 -0.056 -0.036 -0.021 -0.012 -0.012 -0.015 -0.023 -0.038 -0.048 -0.052 -0.055 -0.063 -0.068 -0.079 -0.091 -0.109 -0.127 -0.14 -0.146 -0.148 -0.152 -0.157 -0.148 -0.139 -0.134 -0.122 -0.11 -0.092 -0.078 -0.069 -0.062 -0.061 -0.063 -0.059 -0.061 -0.056 -0.057 -0.054 -0.055 -0.062 -0.077 -0.09 -0.104 -0.109 -0.106 -0.109 -0.101 -0.094 -0.078 -0.062 -0.046 -0.036 -0.027 -0.016 -0.01 -0.01 -0.013 -0.017 -0.012 -0.011 -0.005 -0.01 -0.017 -0.023 -0.029 -0.019 -0.007 0.005 0.013 0.018 0.02 0.019 0.012 0.002 -0.007 -0.011 -0.018 -0.033 -0.044 -0.049 -0.054 -0.054 -0.052 -0.06 -0.063 -0.068 -0.068 -0.057 -0.051 -0.047 -0.041 -0.033 -0.031 -0.034 -0.044 -0.061 -0.074 -0.084 -0.1 -0.115 -0.13 -0.145 -0.165 -0.173 -0.178 -0.169 -0.164 -0.162 -0.157 -0.154 -0.154 -0.152 -0.142 -0.135 -0.13 -0.128 -0.124 -0.125 -0.127 -0.132 -0.139 -0.15 -0.159 -0.163 -0.168 -0.169 -0.162 -0.156 -0.147 -0.133 -0.119 -0.108 -0.096 -0.079 -0.066 -0.048 -0.038 -0.027 -0.025 -0.027 -0.034 -0.046 -0.062 -0.077 -0.085 -0.095 -0.1 -0.109 -0.124 -0.128 -0.129 -0.131 -0.088 -0.088 -0.001 0.217 -0.122 -0.169 0.217 -0.211 -0.211 +#SmoothedScore -0.226 -0.217 -0.479 -0.251 0.182 0.735 0.558 0.353 0.015 -0.322 -0.51 -0.848 -1.025 -1.286 -1.548 -1.934 -2.111 -2.112 -2.288 -1.736 -1.924 -1.696 -1.922 -2.308 -2.569 -2.813 -3.151 -3.377 -3.715 -3.976 -3.749 -4.01 -4.215 -4.553 -4.119 -4.345 -3.912 -3.684 -3.676 -3.667 -3.928 -3.495 -3.7 -3.926 -4.187 -4.573 -4.761 -4.938 -4.504 -4.842 -5.104 -5.442 -5.443 -4.891 -4.457 -4.459 -3.906 -4.111 -4.373 -4.759 -5.02 -5.197 -5.535 -5.102 -5.278 -5.664 -5.841 -6.084 -6.075 -6.263 -6.451 -6.627 -6.629 -6.89 -7.095 -7.356 -7.618 -8.004 -8.342 -8.68 -8.868 -9.055 -9.317 -9.174 -8.946 -9.208 -9.469 -8.917 -9.122 -9.123 -8.571 -8.137 -8.56 -8.821 -9.159 -9.403 -9.74 -9.307 -9.308 -9.57 -9.908 -10.113 -9.885 -10.146 -9.713 -9.901 -10.163 -10.367 -10.629 -10.89 -11.152 -11.413 -11.675 -11.882 -11.873 -12.05 -12.312 -12.313 -12.5 -12.839 -13.176 -12.624 -12.829 -13.033 -12.481 -12.689 -13.111 -13.102 -13.363 -13.551 -13.889 -14.227 -13.997 -14.241 -14.417 -14.594 -14.77 -15.108 -15.123 -14.896 -15.139 -15.316 -15.577 -15.915 -15.688 -16.074 -16.412 -16.269 -16.53 -16.718 -17.104 -17.281 -17.542 -17.804 -18.19 -18.452 -18.639 -18.206 -18.592 -18.159 -18.42 -18.807 -19.011 -18.459 -18.685 -18.946 -19.172 -19.51 -19.367 -19.572 -19.344 -19.605 -19.462 -19.724 -19.986 -20.19 -20.378 -20.716 -20.977 -20.993 -21.254 -21.431 -21.422 -21.598 -21.86 -22.048 -22.309 -22.731 -22.993 -23.254 -23.112 -23.498 -23.674 -23.122 -23.46 -23.722 -23.169 -23.16 -23.337 -23.723 -23.9 -23.757 -23.857 -23.424 -22.871 -23.209 -23.386 -23.772 -23.339 -23.564 -23.951 -23.808 -23.578 -23.145 -23.37 -22.937 -23.198 -23.2 -22.647 -22.639 -22.205 -22.543 -22.881 -22.872 -23.258 -23.52 -23.858 -24.083 -24.288 -24.55 -24.888 -25.075 -25.252 -25.428 -25.616 -25.064 -24.836 -25.174 -25.362 -25.588 -25.589 -25.927 -26.153 -26.414 -26.405 -26.262 -25.829 -25.601 -25.374 -24.941 -24.798 -24.789 -25.127 -25.303 -25.294 -25.471 -25.809 -26.07 -26.258 -26.52 -26.377 -26.368 -26.706 -26.707 -26.479 -26.866 -26.857 -27.118 -27.456 -27.023 -27.024 -27.362 -27.624 -27.615 -27.876 -27.976 -27.978 -28.4 -28.576 -28.578 -28.579 -28.146 -28.568 -28.34 -28.678 -29.016 -29.242 -29.014 -29.352 -29.529 -29.095 -29.339 -28.906 -28.472 -28.039 -27.606 -27.782 -27.23 -27.435 -27.821 -28.047 -28.308 -28.646 -28.823 -28.27 -28.532 -27.98 -28.366 -28.553 -28.94 -28.71 -28.953 -29.291 -29.553 -29.76 -29.208 -28.774 -28.766 -28.623 -28.19 -28.451 -27.899 -28.142 -28.368 -28.14 -28.348 -28.734 -29.072 -28.639 -28.411 -28.673 -28.898 -29.16 -29.498 -28.945 -28.393 -28.655 -28.993 -29.197 -28.645 -28.871 -29.078 -28.935 -29.14 -29.141 -29.527 -29.865 -30.042 -30.38 -30.567 -30.134 -30.396 -30.621 -30.809 -30.257 -30.114 -29.886 -29.877 -29.734 -29.911 -30.297 -30.683 -30.945 -31.149 -30.597 -30.045 -29.902 -30.079 -30.07 -30.257 -30.272 -29.839 -30.177 -29.625 -29.83 -30.017 -29.584 -29.97 -30.356 -30.694 -30.709 -30.725 -30.95 -30.72 -30.49 -30.348 -30.555 -30.655 -30.993 -30.763 -30.211 -30.399 -30.256 -30.482 -30.743 -30.92 -31.146 -31.484 -31.745 -32.131 -32.469 -32.646 -32.85 -33.237 -32.684 -32.457 -32.314 -32.7 -33.038 -33.281 -33.619 -33.957 -33.814 -33.381 -32.829 -32.396 -32.6 -32.862 -32.634 -32.896 -33.072 -33.41 -33.587 -33.848 -34.074 -34.335 -34.337 -34.598 -34.786 -34.353 -34.739 -34.511 -34.773 -34.96 -35.137 -35.475 -35.861 -36.087 -36.313 -35.76 -35.86 -36.198 -35.646 -35.647 -35.095 -35.283 -35.49 -35.828 -36.09 -36.266 -36.474 -36.65 -36.651 -36.913 -36.685 -37.023 -37.249 -37.587 -37.359 -37.35 -37.352 -36.799 -37.007 -36.777 -37.038 -37.04 -37.031 -37.022 -37.283 -37.14 -36.913 -37.174 -37.512 -37.756 -37.747 -37.314 -37.329 -36.776 -37.163 -37.5 -37.492 -37.483 -36.93 -36.497 -36.702 -36.693 -36.919 -37.18 -37.442 -37.618 -38.004 -38.266 -37.833 -37.69 -38.028 -37.798 -37.799 -37.8 -38.138 -37.705 -38.043 -37.815 -38.02 -38.246 -38.016 -38.402 -38.664 -38.436 -38.208 -38.47 -38.732 -38.957 -39.343 -39.605 -39.705 -39.966 -40.353 -40.614 -40.952 -41.214 -41.071 -40.843 -40.291 -40.552 -40.814 -41.152 -41.143 -41.404 -41.743 -41.744 -42.005 -42.182 -42.568 -42.34 -42.727 -43.064 -43.241 -43.418 -43.622 -43.479 -43.046 -43.432 -43.658 -43.863 -44.089 -43.861 -43.428 -43.653 -43.915 -43.687 -43.46 -43.685 -43.252 -43.513 -43.851 -44.189 -44.377 -44.639 -44.977 -45.238 -45.415 -45.591 -45.592 -45.159 -45.403 -45.741 -45.307 -45.729 +#Disorder +#GlobDoms +#Dydx 0.217 0.114 0.004 0.004 -0.131 0.217 -0.102 -0.113 -0.131 -0.131 -0.115 -0.131 -0.142 -0.149 -0.156 -0.162 -0.173 -0.177 -0.183 -0.19 -0.197 -0.207 -0.212 -0.213 -0.206 -0.202 -0.19 -0.181 -0.168 -0.146 -0.119 -0.097 -0.076 -0.061 -0.049 -0.041 -0.035 -0.034 -0.041 -0.052 -0.06 -0.073 -0.082 -0.09 -0.097 -0.108 -0.123 -0.133 -0.146 -0.159 -0.163 -0.156 -0.153 -0.152 -0.151 -0.151 -0.157 -0.163 -0.16 -0.162 -0.166 -0.155 -0.148 -0.138 -0.126 -0.117 -0.11 -0.107 -0.109 -0.107 -0.109 -0.115 -0.122 -0.129 -0.13 -0.134 -0.131 -0.133 -0.142 -0.144 -0.138 -0.135 -0.124 -0.116 -0.114 -0.107 -0.102 -0.094 -0.091 -0.089 -0.084 -0.083 -0.088 -0.092 -0.102 -0.105 -0.104 -0.099 -0.098 -0.093 -0.089 -0.077 -0.072 -0.07 -0.067 -0.068 -0.06 -0.046 -0.034 -0.026 -0.02 -0.011 -0.007 -0.011 -0.01 -0.011 -0.008 -0.002 0.006 0.006 0.014 0.028 0.04 0.051 0.052 0.05 0.045 0.041 0.04 0.031 0.018 -0.003 -0.021 -0.044 -0.073 -0.102 -0.127 -0.147 -0.159 -0.16 -0.166 -0.173 -0.171 -0.166 -0.155 -0.147 -0.143 -0.133 -0.123 -0.107 -0.09 -0.071 -0.047 -0.025 -0.007 0.004 0.01 0.014 0.013 0.014 0.017 0.014 0.007 -0.001 -0.007 -0.021 -0.038 -0.055 -0.076 -0.095 -0.111 -0.125 -0.129 -0.124 -0.119 -0.113 -0.109 -0.108 -0.104 -0.099 -0.101 -0.106 -0.111 -0.116 -0.111 -0.109 -0.106 -0.105 -0.103 -0.106 -0.103 -0.105 -0.111 -0.103 -0.095 -0.084 -0.069 -0.046 -0.022 -0.001 0.026 0.044 0.053 0.058 0.06 0.062 0.057 0.062 0.06 0.059 0.049 0.038 0.017 -0.004 -0.023 -0.05 -0.074 -0.094 -0.099 -0.091 -0.084 -0.065 -0.042 -0.027 -0.007 0.005 0.01 0.015 0.024 0.024 0.029 0.034 0.041 0.038 0.035 0.026 0.008 -0.007 -0.018 -0.026 -0.034 -0.043 -0.043 -0.04 -0.042 -0.034 -0.03 -0.028 -0.027 -0.032 -0.042 -0.06 -0.072 -0.074 -0.08 -0.09 -0.103 -0.113 -0.111 -0.098 -0.086 -0.075 -0.068 -0.058 -0.054 -0.054 -0.052 -0.043 -0.025 -0.009 -0 0.006 0.006 0.003 0.011 0.01 0.013 0.01 0.01 0.019 0.024 0.025 0.024 0.022 0.015 -0 -0.015 -0.031 -0.038 -0.04 -0.04 -0.046 -0.048 -0.045 -0.044 -0.035 -0.034 -0.027 -0.024 -0.026 -0.024 -0.029 -0.041 -0.061 -0.081 -0.101 -0.127 -0.14 -0.143 -0.14 -0.143 -0.148 -0.159 -0.168 -0.169 -0.166 -0.152 -0.129 -0.101 -0.077 -0.056 -0.036 -0.021 -0.012 -0.012 -0.015 -0.023 -0.038 -0.048 -0.052 -0.055 -0.063 -0.068 -0.079 -0.091 -0.109 -0.127 -0.14 -0.146 -0.148 -0.152 -0.157 -0.148 -0.139 -0.134 -0.122 -0.11 -0.092 -0.078 -0.069 -0.062 -0.061 -0.063 -0.059 -0.061 -0.056 -0.057 -0.054 -0.055 -0.062 -0.077 -0.09 -0.104 -0.109 -0.106 -0.109 -0.101 -0.094 -0.078 -0.062 -0.046 -0.036 -0.027 -0.016 -0.01 -0.01 -0.013 -0.017 -0.012 -0.011 -0.005 -0.01 -0.017 -0.023 -0.029 -0.019 -0.007 0.005 0.013 0.018 0.02 0.019 0.012 0.002 -0.007 -0.011 -0.018 -0.033 -0.044 -0.049 -0.054 -0.054 -0.052 -0.06 -0.063 -0.068 -0.068 -0.057 -0.051 -0.047 -0.041 -0.033 -0.031 -0.034 -0.044 -0.061 -0.074 -0.084 -0.1 -0.115 -0.13 -0.145 -0.165 -0.173 -0.178 -0.169 -0.164 -0.162 -0.157 -0.154 -0.154 -0.152 -0.142 -0.135 -0.13 -0.128 -0.124 -0.125 -0.127 -0.132 -0.139 -0.15 -0.159 -0.163 -0.168 -0.169 -0.162 -0.156 -0.147 -0.133 -0.119 -0.108 -0.096 -0.079 -0.066 -0.048 -0.038 -0.027 -0.025 -0.027 -0.034 -0.046 -0.062 -0.077 -0.085 -0.095 -0.1 -0.109 -0.124 -0.128 -0.129 -0.131 -0.088 -0.088 -0.001 0.217 -0.122 -0.169 0.217 -0.211 -0.211 +#SmoothedScore -0.226 0.207 0.435 0.444 0.453 0.191 0.624 0.42 0.194 -0.068 -0.454 -0.642 -0.818 -0.385 -0.723 -0.984 -1.322 -1.324 -1.511 -1.699 -1.875 -1.877 -2.138 -2.343 -2.605 -2.866 -3.252 -3.59 -3.928 -4.116 -4.303 -4.565 -4.422 -4.194 -4.456 -4.718 -4.165 -4.37 -4.371 -3.819 -3.386 -3.808 -4.069 -4.407 -4.651 -4.989 -4.99 -5.251 -5.589 -5.794 -5.566 -5.828 -5.395 -5.582 -5.844 -6.049 -6.31 -6.572 -6.833 -7.095 -7.302 -7.293 -7.47 -7.732 -7.733 -7.92 -8.258 -8.596 -8.044 -8.249 -8.453 -7.901 -8.108 -8.531 -8.522 -8.783 -8.971 -9.309 -9.647 -9.417 -9.679 -10.065 -10.326 -10.514 -10.081 -10.467 -10.034 -10.295 -10.681 -10.886 -10.334 -10.559 -10.821 -11.046 -11.384 -11.241 -11.446 -11.219 -11.48 -11.337 -11.599 -11.86 -12.065 -11.922 -12.308 -12.485 -11.932 -12.271 -12.532 -11.98 -11.971 -12.147 -12.534 -12.71 -12.567 -12.667 -12.234 -11.682 -12.02 -12.196 -12.583 -12.149 -12.375 -12.761 -12.618 -12.388 -11.955 -12.181 -11.747 -12.009 -12.01 -11.458 -11.449 -11.016 -11.354 -11.692 -11.683 -12.069 -12.33 -12.668 -12.894 -13.099 -13.36 -13.698 -13.886 -14.062 -14.239 -14.427 -13.874 -13.647 -13.985 -14.172 -14.398 -14.399 -14.737 -14.963 -15.224 -15.216 -15.073 -14.639 -14.412 -14.184 -13.751 -13.608 -13.599 -13.937 -14.114 -14.105 -14.281 -14.619 -14.881 -15.069 -15.33 -15.187 -15.178 -15.516 -15.518 -15.29 -15.676 -15.667 -15.929 -16.267 -15.833 -15.835 -16.173 -16.434 -16.425 -16.687 -16.787 -16.788 -17.21 -17.387 -17.388 -17.389 -16.956 -17.378 -17.151 -17.489 -17.827 -18.052 -17.825 -18.163 -18.339 -17.906 -18.149 -17.716 -17.283 -16.85 -16.416 -16.593 -16.041 -16.245 -16.632 -16.857 -17.119 -17.456 -17.633 -17.081 -17.342 -16.79 -17.176 -17.364 -17.75 -17.52 -17.764 -18.101 -18.363 -18.57 -18.018 -17.585 -17.576 -17.433 -17 -17.261 -16.709 -16.953 -17.178 -16.951 -17.158 -17.545 -17.882 -17.449 -17.222 -17.483 -17.709 -17.97 -18.308 -17.756 -17.204 -17.465 -17.803 -18.008 -17.455 -17.681 -17.889 -17.746 -17.95 -17.951 -18.338 -18.676 -18.852 -19.19 -19.378 -18.945 -19.206 -19.432 -19.619 -19.067 -18.924 -18.697 -18.688 -18.545 -18.721 -19.108 -19.494 -19.755 -19.96 -19.408 -18.855 -18.712 -18.889 -18.88 -19.068 -19.083 -18.65 -18.988 -18.435 -18.64 -18.828 -18.395 -18.781 -19.167 -19.505 -19.52 -19.535 -19.761 -19.531 -19.301 -19.158 -19.365 -19.466 -19.804 -19.574 -19.021 -19.209 -19.066 -19.292 -19.554 -19.73 -19.956 -20.294 -20.556 -20.942 -21.28 -21.456 -21.661 -22.047 -21.495 -21.267 -21.124 -21.51 -21.848 -22.092 -22.43 -22.768 -22.625 -22.191 -21.639 -21.206 -21.411 -21.672 -21.445 -21.706 -21.883 -22.221 -22.397 -22.659 -22.884 -23.146 -23.147 -23.409 -23.596 -23.163 -23.549 -23.322 -23.583 -23.771 -23.948 -24.285 -24.672 -24.897 -25.123 -24.571 -24.671 -25.009 -24.456 -24.458 -23.905 -24.093 -24.301 -24.638 -24.9 -25.077 -25.284 -25.461 -25.462 -25.723 -25.496 -25.834 -26.059 -26.397 -26.17 -26.161 -26.162 -25.61 -25.817 -25.587 -25.849 -25.85 -25.841 -25.832 -26.094 -25.951 -25.723 -25.985 -26.323 -26.566 -26.557 -26.124 -26.139 -25.587 -25.973 -26.311 -26.302 -26.293 -25.741 -25.308 -25.512 -25.503 -25.729 -25.991 -26.252 -26.429 -26.815 -27.076 -26.643 -26.5 -26.838 -26.608 -26.61 -26.611 -26.949 -26.515 -26.854 -26.626 -26.83 -27.056 -26.826 -27.213 -27.474 -27.247 -27.019 -27.281 -27.542 -27.768 -28.154 -28.415 -28.515 -28.777 -29.163 -29.425 -29.763 -30.024 -29.881 -29.654 -29.101 -29.363 -29.624 -29.962 -29.954 -30.215 -30.553 -30.554 -30.816 -30.992 -31.378 -31.151 -31.537 -31.875 -32.051 -32.228 -32.433 -32.29 -31.857 -32.243 -32.468 -32.673 -32.899 -32.671 -32.238 -32.464 -32.725 -32.498 -32.27 -32.496 -32.062 -32.324 -32.662 -33 -33.188 -33.449 -33.787 -34.049 -34.225 -34.402 -34.403 -33.97 -34.213 -34.551 -34.118 -34.54 +#Disorder +#RawScore -0.226 0.207 0.435 0.444 0.453 0.191 0.624 0.42 0.194 -0.068 -0.16 -0.35 -0.523 -0.688 -0.852 -1.012 -1.185 -1.321 -1.461 -1.619 -1.798 -2.009 -2.263 -2.555 -2.788 -3.013 -3.276 -3.522 -3.74 -3.968 -4.179 -4.311 -4.371 -4.379 -4.35 -4.291 -4.233 -4.176 -4.126 -4.108 -4.144 -4.202 -4.336 -4.468 -4.584 -4.725 -4.901 -5.05 -5.223 -5.409 -5.562 -5.681 -5.805 -5.923 -6.064 -6.207 -6.359 -6.501 -6.706 -6.919 -7.139 -7.374 -7.591 -7.725 -7.845 -7.938 -8.013 -8.07 -8.12 -8.204 -8.289 -8.371 -8.45 -8.545 -8.701 -8.836 -9.016 -9.2 -9.396 -9.552 -9.756 -9.947 -10.062 -10.152 -10.236 -10.318 -10.39 -10.475 -10.552 -10.656 -10.716 -10.768 -10.839 -10.95 -11.065 -11.151 -11.309 -11.403 -11.489 -11.635 -11.785 -11.863 -11.908 -11.95 -12.013 -12.091 -12.181 -12.298 -12.34 -12.363 -12.331 -12.329 -12.314 -12.287 -12.264 -12.284 -12.347 -12.341 -12.373 -12.395 -12.368 -12.352 -12.317 -12.313 -12.282 -12.216 -12.167 -12.071 -11.923 -11.786 -11.675 -11.619 -11.561 -11.547 -11.613 -11.73 -11.884 -12.051 -12.313 -12.577 -12.845 -13.116 -13.336 -13.548 -13.683 -13.803 -13.913 -14.005 -14.111 -14.235 -14.357 -14.467 -14.568 -14.642 -14.689 -14.689 -14.668 -14.647 -14.625 -14.537 -14.408 -14.289 -14.179 -14.114 -14.067 -14.047 -14.081 -14.193 -14.326 -14.499 -14.665 -14.828 -15.028 -15.196 -15.316 -15.403 -15.503 -15.59 -15.662 -15.737 -15.802 -15.883 -15.989 -16.126 -16.285 -16.403 -16.556 -16.679 -16.758 -16.849 -16.956 -17.056 -17.179 -17.299 -17.382 -17.496 -17.627 -17.741 -17.846 -17.888 -17.91 -17.891 -17.823 -17.72 -17.591 -17.402 -17.235 -17.09 -16.947 -16.873 -16.801 -16.724 -16.684 -16.726 -16.77 -16.865 -16.975 -17.094 -17.254 -17.409 -17.558 -17.645 -17.725 -17.767 -17.822 -17.836 -17.837 -17.855 -17.801 -17.726 -17.58 -17.481 -17.397 -17.317 -17.211 -17.119 -17.062 -17.105 -17.235 -17.331 -17.391 -17.458 -17.565 -17.621 -17.678 -17.698 -17.706 -17.723 -17.692 -17.656 -17.655 -17.689 -17.716 -17.776 -17.844 -17.933 -18.056 -18.273 -18.471 -18.626 -18.769 -18.917 -19.046 -19.086 -19.097 -19.098 -19.072 -19.087 -19.107 -19.123 -19.12 -19.111 -19.104 -19.114 -19.119 -19.109 -19.151 -19.193 -19.185 -19.186 -19.126 -19.03 -18.898 -18.783 -18.706 -18.668 -18.704 -18.81 -18.914 -18.975 -19.02 -19.062 -19.131 -19.251 -19.354 -19.424 -19.489 -19.485 -19.471 -19.453 -19.378 -19.316 -19.277 -19.278 -19.317 -19.393 -19.516 -19.71 -19.924 -20.139 -20.341 -20.535 -20.757 -20.962 -21.115 -21.29 -21.465 -21.648 -21.818 -21.921 -21.964 -21.997 -21.985 -21.959 -21.921 -21.886 -21.861 -21.877 -21.865 -21.854 -21.824 -21.822 -21.892 -21.972 -22.122 -22.314 -22.529 -22.737 -22.906 -23.026 -23.152 -23.291 -23.449 -23.596 -23.714 -23.876 -24.02 -24.184 -24.311 -24.412 -24.469 -24.516 -24.565 -24.565 -24.578 -24.571 -24.559 -24.573 -24.574 -24.594 -24.645 -24.763 -24.931 -25.084 -25.286 -25.499 -25.681 -25.826 -25.902 -25.951 -25.976 -25.974 -25.979 -25.986 -25.968 -25.932 -25.882 -25.86 -25.851 -25.858 -25.912 -25.962 -25.986 -26.025 -26.081 -26.132 -26.202 -26.211 -26.213 -26.182 -26.123 -26.044 -25.982 -25.902 -25.81 -25.785 -25.809 -25.854 -25.948 -26.03 -26.125 -26.161 -26.256 -26.358 -26.488 -26.614 -26.69 -26.737 -26.75 -26.732 -26.733 -26.752 -26.759 -26.761 -26.79 -26.844 -26.886 -26.94 -27.032 -27.117 -27.221 -27.34 -27.508 -27.691 -27.93 -28.189 -28.426 -28.649 -28.823 -29.016 -29.206 -29.352 -29.467 -29.56 -29.645 -29.708 -29.808 -29.894 -29.969 -30.058 -30.177 -30.323 -30.529 -30.802 -31.047 -31.268 -31.426 -31.571 -31.732 -31.919 -32.054 -32.158 -32.275 -32.372 -32.434 -32.501 -32.542 -32.514 -32.474 -32.444 -32.421 -32.409 -32.429 -32.465 -32.485 -32.556 -32.693 -32.846 -33.021 -33.234 -33.392 -33.787 -34.049 -34.225 -34.402 -34.403 -33.97 -34.213 -34.551 -34.118 -34.54 +#GlobDoms +#RawScore -0.226 -0.217 -0.479 -0.251 0.182 0.735 0.558 0.353 0.015 -0.322 -0.526 -0.755 -0.967 -1.2 -1.424 -1.607 -1.732 -1.833 -1.923 -2.043 -2.157 -2.266 -2.377 -2.531 -2.68 -2.868 -3.082 -3.293 -3.484 -3.653 -3.782 -3.865 -3.87 -3.845 -3.788 -3.723 -3.668 -3.659 -3.653 -3.665 -3.662 -3.706 -3.826 -4.013 -4.171 -4.374 -4.511 -4.589 -4.618 -4.616 -4.616 -4.557 -4.53 -4.49 -4.438 -4.415 -4.414 -4.458 -4.485 -4.548 -4.655 -4.832 -5.042 -5.242 -5.422 -5.605 -5.733 -5.857 -5.987 -6.15 -6.341 -6.55 -6.816 -7.069 -7.301 -7.533 -7.802 -8.049 -8.266 -8.494 -8.706 -8.837 -8.897 -8.906 -8.876 -8.817 -8.784 -8.752 -8.712 -8.675 -8.655 -8.686 -8.757 -8.829 -8.883 -8.964 -9.136 -9.272 -9.422 -9.621 -9.753 -9.8 -9.855 -9.895 -9.942 -9.992 -10.097 -10.152 -10.19 -10.265 -10.357 -10.473 -10.567 -10.67 -10.79 -10.945 -11.14 -11.317 -11.526 -11.801 -12.012 -12.254 -12.487 -12.679 -12.866 -13.087 -13.29 -13.432 -13.562 -13.68 -13.781 -13.865 -13.953 -14.026 -14.103 -14.163 -14.215 -14.286 -14.379 -14.488 -14.572 -14.704 -14.803 -14.92 -15.081 -15.265 -15.402 -15.547 -15.701 -15.859 -16.051 -16.243 -16.48 -16.684 -16.902 -17.141 -17.352 -17.547 -17.772 -17.974 -18.153 -18.3 -18.416 -18.54 -18.646 -18.749 -18.85 -18.89 -18.888 -18.847 -18.844 -18.826 -18.798 -18.775 -18.795 -18.858 -18.853 -18.885 -18.906 -18.879 -18.864 -18.829 -18.824 -18.793 -18.728 -18.678 -18.582 -18.434 -18.298 -18.186 -18.13 -18.073 -18.058 -18.125 -18.241 -18.396 -18.562 -18.824 -19.088 -19.356 -19.627 -19.847 -20.059 -20.194 -20.314 -20.424 -20.516 -20.622 -20.746 -20.868 -20.978 -21.08 -21.153 -21.2 -21.2 -21.179 -21.159 -21.136 -21.048 -20.919 -20.801 -20.69 -20.625 -20.578 -20.558 -20.592 -20.705 -20.837 -21.01 -21.176 -21.339 -21.54 -21.707 -21.827 -21.914 -22.014 -22.101 -22.174 -22.248 -22.313 -22.394 -22.5 -22.638 -22.796 -22.914 -23.067 -23.19 -23.269 -23.361 -23.468 -23.568 -23.69 -23.81 -23.893 -24.007 -24.138 -24.252 -24.357 -24.399 -24.421 -24.402 -24.334 -24.232 -24.103 -23.914 -23.746 -23.601 -23.458 -23.384 -23.312 -23.236 -23.195 -23.238 -23.281 -23.376 -23.486 -23.605 -23.765 -23.92 -24.069 -24.156 -24.237 -24.279 -24.333 -24.348 -24.348 -24.367 -24.312 -24.237 -24.091 -23.992 -23.908 -23.828 -23.722 -23.63 -23.573 -23.616 -23.746 -23.842 -23.903 -23.969 -24.076 -24.132 -24.189 -24.209 -24.217 -24.234 -24.203 -24.168 -24.166 -24.2 -24.228 -24.287 -24.355 -24.444 -24.567 -24.785 -24.982 -25.138 -25.28 -25.428 -25.557 -25.597 -25.608 -25.61 -25.583 -25.598 -25.618 -25.635 -25.632 -25.622 -25.615 -25.626 -25.63 -25.62 -25.663 -25.704 -25.696 -25.698 -25.638 -25.541 -25.41 -25.294 -25.217 -25.179 -25.215 -25.321 -25.426 -25.486 -25.531 -25.573 -25.642 -25.763 -25.866 -25.936 -26 -25.996 -25.983 -25.964 -25.89 -25.828 -25.788 -25.789 -25.828 -25.904 -26.027 -26.221 -26.435 -26.65 -26.852 -27.046 -27.268 -27.473 -27.626 -27.801 -27.976 -28.159 -28.33 -28.432 -28.475 -28.508 -28.496 -28.47 -28.432 -28.397 -28.372 -28.388 -28.376 -28.366 -28.335 -28.333 -28.403 -28.483 -28.633 -28.826 -29.04 -29.249 -29.417 -29.537 -29.663 -29.802 -29.96 -30.107 -30.226 -30.387 -30.531 -30.695 -30.822 -30.923 -30.98 -31.027 -31.076 -31.076 -31.089 -31.082 -31.07 -31.084 -31.085 -31.105 -31.156 -31.274 -31.443 -31.595 -31.798 -32.01 -32.192 -32.337 -32.413 -32.462 -32.487 -32.486 -32.49 -32.497 -32.479 -32.443 -32.393 -32.371 -32.362 -32.369 -32.423 -32.473 -32.497 -32.536 -32.592 -32.643 -32.714 -32.722 -32.724 -32.693 -32.634 -32.555 -32.493 -32.414 -32.321 -32.296 -32.321 -32.366 -32.459 -32.541 -32.636 -32.673 -32.767 -32.869 -32.999 -33.125 -33.201 -33.248 -33.261 -33.243 -33.244 -33.263 -33.27 -33.272 -33.301 -33.355 -33.398 -33.451 -33.543 -33.629 -33.733 -33.851 -34.02 -34.202 -34.442 -34.7 -34.937 -35.161 -35.335 -35.528 -35.717 -35.863 -35.978 -36.072 -36.156 -36.219 -36.319 -36.406 -36.48 -36.569 -36.688 -36.834 -37.04 -37.265 -37.504 -37.89 -37.662 -38.048 -38.386 -38.563 -38.739 -38.944 -38.801 -39.223 +#Dydx 0.004 -0.131 0.114 0.217 0.276 -0.088 -0.102 -0.169 -0.169 -0.169 -0.131 -0.135 -0.141 -0.152 -0.16 -0.164 -0.158 -0.155 -0.152 -0.146 -0.144 -0.142 -0.146 -0.141 -0.14 -0.133 -0.125 -0.119 -0.11 -0.105 -0.086 -0.069 -0.05 -0.038 -0.032 -0.029 -0.03 -0.027 -0.032 -0.043 -0.053 -0.064 -0.07 -0.074 -0.071 -0.065 -0.055 -0.046 -0.04 -0.036 -0.037 -0.034 -0.025 -0.021 -0.023 -0.031 -0.044 -0.057 -0.065 -0.078 -0.094 -0.114 -0.136 -0.15 -0.159 -0.168 -0.169 -0.172 -0.179 -0.187 -0.196 -0.206 -0.214 -0.208 -0.202 -0.201 -0.19 -0.181 -0.168 -0.146 -0.119 -0.097 -0.076 -0.061 -0.049 -0.041 -0.029 -0.02 -0.018 -0.023 -0.032 -0.04 -0.049 -0.059 -0.068 -0.084 -0.094 -0.098 -0.106 -0.105 -0.097 -0.086 -0.079 -0.075 -0.076 -0.082 -0.087 -0.09 -0.093 -0.095 -0.103 -0.113 -0.122 -0.129 -0.139 -0.153 -0.173 -0.185 -0.198 -0.202 -0.2 -0.19 -0.184 -0.18 -0.176 -0.164 -0.156 -0.144 -0.137 -0.134 -0.124 -0.116 -0.104 -0.098 -0.089 -0.084 -0.083 -0.088 -0.096 -0.109 -0.117 -0.126 -0.13 -0.136 -0.143 -0.152 -0.153 -0.155 -0.16 -0.17 -0.183 -0.193 -0.199 -0.202 -0.205 -0.195 -0.187 -0.182 -0.168 -0.152 -0.14 -0.134 -0.126 -0.116 -0.107 -0.089 -0.064 -0.045 -0.03 -0.021 -0.011 -0.007 -0.011 -0.01 -0.011 -0.008 -0.002 0.006 0.006 0.014 0.028 0.04 0.051 0.052 0.05 0.045 0.041 0.04 0.031 0.018 -0.003 -0.021 -0.044 -0.073 -0.102 -0.127 -0.147 -0.159 -0.16 -0.166 -0.173 -0.171 -0.166 -0.155 -0.147 -0.143 -0.133 -0.123 -0.107 -0.09 -0.071 -0.047 -0.025 -0.007 0.004 0.01 0.014 0.013 0.014 0.017 0.014 0.007 -0.001 -0.007 -0.021 -0.038 -0.055 -0.076 -0.095 -0.111 -0.125 -0.129 -0.124 -0.119 -0.113 -0.109 -0.108 -0.104 -0.099 -0.101 -0.106 -0.111 -0.116 -0.111 -0.109 -0.106 -0.105 -0.103 -0.106 -0.103 -0.105 -0.111 -0.103 -0.095 -0.084 -0.069 -0.046 -0.022 -0.001 0.026 0.044 0.053 0.058 0.06 0.062 0.057 0.062 0.06 0.059 0.049 0.038 0.017 -0.004 -0.023 -0.05 -0.074 -0.094 -0.099 -0.091 -0.084 -0.065 -0.042 -0.027 -0.007 0.005 0.01 0.015 0.024 0.024 0.029 0.034 0.041 0.038 0.035 0.026 0.008 -0.007 -0.018 -0.026 -0.034 -0.043 -0.043 -0.04 -0.042 -0.034 -0.03 -0.028 -0.027 -0.032 -0.042 -0.06 -0.072 -0.074 -0.08 -0.09 -0.103 -0.113 -0.111 -0.098 -0.086 -0.075 -0.068 -0.058 -0.054 -0.054 -0.052 -0.043 -0.025 -0.009 -0 0.006 0.006 0.003 0.011 0.01 0.013 0.01 0.01 0.019 0.024 0.025 0.024 0.022 0.015 -0 -0.015 -0.031 -0.038 -0.04 -0.04 -0.046 -0.048 -0.045 -0.044 -0.035 -0.034 -0.027 -0.024 -0.026 -0.024 -0.029 -0.041 -0.061 -0.081 -0.101 -0.127 -0.14 -0.143 -0.14 -0.143 -0.148 -0.159 -0.168 -0.169 -0.166 -0.152 -0.129 -0.101 -0.077 -0.056 -0.036 -0.021 -0.012 -0.012 -0.015 -0.023 -0.038 -0.048 -0.052 -0.055 -0.063 -0.068 -0.079 -0.091 -0.109 -0.127 -0.14 -0.146 -0.148 -0.152 -0.157 -0.148 -0.139 -0.134 -0.122 -0.11 -0.092 -0.078 -0.069 -0.062 -0.061 -0.063 -0.059 -0.061 -0.056 -0.057 -0.054 -0.055 -0.062 -0.077 -0.09 -0.104 -0.109 -0.106 -0.109 -0.101 -0.094 -0.078 -0.062 -0.046 -0.036 -0.027 -0.016 -0.01 -0.01 -0.013 -0.017 -0.012 -0.011 -0.005 -0.01 -0.017 -0.023 -0.029 -0.019 -0.007 0.005 0.013 0.018 0.02 0.019 0.012 0.002 -0.007 -0.011 -0.018 -0.033 -0.044 -0.049 -0.054 -0.054 -0.052 -0.06 -0.063 -0.068 -0.068 -0.057 -0.051 -0.047 -0.041 -0.033 -0.031 -0.034 -0.044 -0.061 -0.074 -0.084 -0.1 -0.115 -0.13 -0.145 -0.165 -0.173 -0.178 -0.169 -0.164 -0.162 -0.157 -0.154 -0.154 -0.152 -0.142 -0.135 -0.13 -0.128 -0.124 -0.125 -0.127 -0.132 -0.139 -0.15 -0.159 -0.174 -0.193 0.114 -0.193 -0.169 -0.088 -0.088 -0.102 0.071 -0.211 -0.211 +#Disorder +#GlobDoms +#SmoothedScore -0.226 -0.217 -0.479 -0.251 0.182 0.735 0.558 0.353 0.015 -0.322 -0.51 -0.848 -1.025 -1.286 -1.548 -1.934 -2.111 -2.112 -2.288 -1.736 -1.924 -1.696 -2.082 -2.344 -2.587 -2.925 -3.151 -3.489 -3.75 -3.523 -3.784 -3.989 -4.327 -3.894 -4.12 -3.687 -3.459 -3.45 -3.441 -3.703 -3.269 -3.474 -3.7 -3.962 -4.348 -4.535 -4.712 -4.279 -4.617 -4.878 -5.216 -5.217 -4.665 -4.232 -4.233 -3.681 -3.885 -4.147 -4.533 -4.795 -4.971 -5.309 -4.876 -5.053 -5.439 -5.615 -5.859 -5.85 -6.037 -6.225 -6.402 -6.403 -6.665 -6.869 -7.131 -7.392 -7.779 -8.116 -8.454 -8.642 -8.83 -9.091 -8.948 -8.721 -8.982 -9.244 -8.691 -8.896 -8.897 -8.345 -7.912 -8.334 -8.596 -8.934 -9.177 -9.515 -9.082 -9.083 -9.344 -9.682 -9.887 -9.659 -9.661 -9.848 -10.186 -10.524 -9.972 -10.177 -10.381 -9.829 -10.036 -10.459 -10.45 -10.711 -10.899 -11.237 -11.009 -11.395 -11.733 -11.59 -11.852 -12.04 -12.426 -12.602 -12.864 -13.126 -13.512 -13.773 -13.961 -13.528 -13.914 -13.481 -13.742 -14.128 -14.333 -13.781 -14.006 -14.268 -14.493 -14.831 -14.689 -14.893 -14.665 -14.927 -14.784 -15.046 -15.307 -15.512 -15.7 -16.038 -16.299 -16.314 -16.576 -16.752 -16.743 -16.92 -17.182 -17.369 -17.631 -18.053 -18.315 -18.576 -18.433 -18.819 -18.996 -18.444 -18.782 -19.043 -18.491 -18.482 -18.659 -19.045 -19.221 -19.079 -19.179 -18.745 -18.193 -18.531 -18.708 -19.094 -18.66 -18.886 -19.272 -19.129 -18.899 -18.466 -18.692 -18.259 -18.52 -18.521 -17.969 -17.96 -17.527 -17.865 -18.203 -18.194 -18.58 -18.842 -19.18 -19.405 -19.61 -19.871 -20.209 -20.397 -20.574 -20.75 -20.938 -20.385 -20.158 -20.496 -20.684 -20.909 -20.911 -21.249 -21.474 -21.736 -21.727 -21.584 -21.151 -20.923 -20.695 -20.262 -20.119 -20.111 -20.448 -20.625 -20.616 -20.793 -21.131 -21.392 -21.58 -21.841 -21.698 -21.69 -22.028 -22.029 -21.801 -22.187 -22.178 -22.44 -22.778 -22.345 -22.346 -22.684 -22.945 -22.937 -23.198 -23.298 -23.299 -23.722 -23.898 -23.899 -23.901 -23.467 -23.89 -23.662 -24 -24.338 -24.563 -24.336 -24.674 -24.85 -24.417 -24.66 -24.227 -23.794 -23.361 -22.928 -23.104 -22.552 -22.757 -23.143 -23.368 -23.63 -23.968 -24.144 -23.592 -23.854 -23.301 -23.687 -23.875 -24.261 -24.031 -24.275 -24.613 -24.874 -25.082 -24.529 -24.096 -24.087 -23.944 -23.511 -23.773 -23.22 -23.464 -23.69 -23.462 -23.67 -24.056 -24.394 -23.961 -23.733 -23.994 -24.22 -24.482 -24.819 -24.267 -23.715 -23.976 -24.314 -24.519 -23.967 -24.192 -24.4 -24.257 -24.462 -24.463 -24.849 -25.187 -25.363 -25.701 -25.889 -25.456 -25.717 -25.943 -26.131 -25.578 -25.435 -25.208 -25.199 -25.056 -25.233 -25.619 -26.005 -26.267 -26.471 -25.919 -25.367 -25.224 -25.4 -25.391 -25.579 -25.594 -25.161 -25.499 -24.947 -25.151 -25.339 -24.906 -25.292 -25.678 -26.016 -26.031 -26.046 -26.272 -26.042 -25.812 -25.669 -25.877 -25.977 -26.315 -26.085 -25.533 -25.72 -25.577 -25.803 -26.065 -26.241 -26.467 -26.805 -27.067 -27.453 -27.791 -27.968 -28.172 -28.558 -28.006 -27.778 -27.635 -28.022 -28.36 -28.603 -28.941 -29.279 -29.136 -28.703 -28.15 -27.717 -27.922 -28.183 -27.956 -28.217 -28.394 -28.732 -28.909 -29.17 -29.396 -29.657 -29.658 -29.92 -30.108 -29.674 -30.06 -29.833 -30.094 -30.282 -30.459 -30.797 -31.183 -31.408 -31.634 -31.082 -31.182 -31.52 -30.968 -30.969 -30.417 -30.604 -30.812 -31.15 -31.411 -31.588 -31.795 -31.972 -31.973 -32.235 -32.007 -32.345 -32.57 -32.908 -32.681 -32.672 -32.673 -32.121 -32.328 -32.098 -32.36 -32.361 -32.352 -32.343 -32.605 -32.462 -32.235 -32.496 -32.834 -33.077 -33.069 -32.635 -32.65 -32.098 -32.484 -32.822 -32.813 -32.804 -32.252 -31.819 -32.024 -32.015 -32.24 -32.502 -32.763 -32.94 -33.326 -33.588 -33.154 -33.012 -33.349 -33.12 -33.121 -33.122 -33.46 -33.027 -33.365 -33.137 -33.342 -33.568 -33.338 -33.724 -33.985 -33.758 -33.53 -33.792 -34.053 -34.279 -34.665 -34.926 -35.027 -35.288 -35.674 -35.936 -36.274 -36.535 -36.393 -36.165 -35.612 -35.874 -36.136 -36.473 -36.465 -36.726 -37.064 -37.065 -37.327 -37.504 -37.89 -37.662 -38.048 -38.386 -38.563 -38.739 -38.944 -38.801 -39.223 diff --git a/website/develhome.html b/website/develhome.html deleted file mode 100644 index 0d5fbdf..0000000 --- a/website/develhome.html +++ /dev/null @@ -1,127 +0,0 @@ - - - - -Java Bioinformatics Analyses Web Services (JABAWS) developers documentation - - - - - - - -
- - -
- - -
- -

JABAWS Javadoc

-

Data model javadoc- read this if your are coding against JABA Web Services

-

Complete javadoc - for developers who want to use JABAWS framework and use Engines and Executables directly

-

Starting up from the source code

-

SVN source repository:https://svn.lifesci.dundee.ac.uk/svn/barton/ptroshin/JABA_r1
-The repository contains a complete JABAWS Eclipse project. To use Eclipse with this repository you need to install Eclipse SVN plugin which could be found here: http://subclipse.tigris.org/servlets/ProjectProcess?pageID=p4wYuA. Eclipse update web site address is http://subclipse.tigris.org/update_1.4.x Take care to install 1.4.x version of the plugin, as SVN repository will not work with more recent clients. it would help to install TestNG plugin as well which could be downloaded from http://testng.org/doc/download.html. Please note however that no generated code is stored in the repository. That is to say that if you like to obtain client or server packages it is better to download them from the download section of this web site. Of cause If you want to make a modification to the source code you would need to generate distributives yourself. To do that first generate JAX-WS artifacts using build-server task from wsbuild.xml ant script, than you could use build.xml tasks to generate any of the distributives you need.

-

Structure of the project

-JABAWS layers -

Layers in the source code are defined in a different source folders which are: -
/webservices
- /runner
- /engine
- /datamodel

-

JABAWS project is split into 4 layers. From bottom-up the first layer consists from the value classes used by all other layers of the hierarchy, in particular web services. So, to be able to use JABAWS one needs to have these classes. At the same time classes on this layer does not have any dependencies on the layers above.

-

The second layer contains code for execution of the wrappers, which are the abstraction describing native executables. The code on this level code engine. JABAWS can execute tasks locally that is on the same machine as JVM and on the cluster. Thus currently code on this layer contain two engines. This layer depends on the layer underneath, the data model layer, but is completely independent from the code above.

-

The third layer consists of the wrappers for the native executables and classes to handle their configuration. It depends on the engines and the data model, but know nothing about the web services.

-

Finally, the upper layer contains the web services, that depend on all the layers below.

-

The layer isolation is archived though specially designed compilation task which is executed sequentially in several stages so that the first layer compiles before any other layers, second layer compiles after that and process continies before all the code is compiled. Any violation of the layer boundaries results in the compilation failure. Use Ant "Compile" or "Complile_with_debug" tasks to perform the staged compilation.

-

A client package contains only classes from data model layer and a simple web services client. Framework package is for anyone who want to use JABAWS framework for controlling native executables in local or cluster environments. Framework exclude the web services layer. Server package contains all the code.

- -

Running tests

-

The test results for the JABAWS package offered for download can be found here: Test Results
-JABAWS uses TestNG for testing. There is a TestNG plugin available for Eclipse which has functionality similar to JUnit. However, no plugins are necessary to run the test cases, as testng jar is supplied with JABAWS together with an ant tasks to run the test cases.

-

The best way to ensure that JABAWS framework is completely functional on your system is to run all test cases. -Test cases tests all aspects of JABAWS functionality. Consequently, one need to have non windows operation system and support of the cluster to be able to run all tests. If your system does not support cluster, then you could run all test excluding those that depends on the cluster. -Several testing groups are supported: -

    -
  • All tests (Test)
  • -
  • Cluster tests (Run_cluster_dependent_test)
  • -
  • Cluster independent tests ()
  • -
  • Windows only tests (All_cluster_independent_windows_only_tests)
  • -
  • Performance and stability tests (Long_tests)
  • -
  • Re-run failed tests (Rerun_failed_tests)
  • -
  • Run custom test (CustomTest)
  • -
-

To run the tests you need to download all sources from repository. Once you have done that, enter into the command line mode, change directory to the project directory and type: - ant -f build.xml <test group name>

-

. Make sure you have Apache Ant - installed and path to ant executable is defined in your path environmental variable. - Replace test group name with the one of the names given in the list above to run required group of tests e.g for running cluster only tests - use the following - command: ant -f build.xml Run_cluster_dependent_test - If you work under Linux you could use a simple script from the root folder of repository called runtests.sh This script simply contains a collection of the test commands described above and paths to java home directory and an ant executable, which you can define once for your system and then reuse. -

-

-

A handy feature of TestNG is its ability to re-run failed tests. Failed test ant file is stored in test-output/testng-failed.xml. and is used in the ant task called Rerun_failed_tests. So re-running failed tests requires no more work than running any other test group and could be accomplished with the command: ant -f build.xml Rerun_failed_tests CustomTest runs the test defined in the project root directory file called temp-testng-customsuite.xml. This file is generated by TestNG plugin every time you run the test from Eclipse. Thus an easy way to run a test in a different environment is to run it from Eclipse first and then from ant using a custom test procedure.

-

For cluster execution make sure that the property LD_LIBRARY_PATH defined in build.xml points to cluster engine LD libraries directory in your local system.

- -

Preparing distributive's

-

There are a number of ant tasks aimed for preparing distributives for download. - Currently a few types of JABAWS packages are offered -

    -
  1. Client only (contains classes required to access JABA Web Services)
  2. -
  3. Platform specific JABAWS (windows and other)
  4. -
  5. JABA Web Services without JAXWS libraries ( a the runtime dependency)
  6. -
  7. JABAWS without binaries
  8. -
  9. JABAWS without binaries and jax-ws
  10. -
  11. JABAWS framework
  12. -
-

- Corresponding build task names are: -
    -
  1. min-jaba-client
  2. -
  3. jaba-windows, jaba-complete
  4. -
  5. jaba-without-jaxws
  6. -
  7. jaba-no-binaries
  8. -
  9. jaba-no-jaxws-no-binaries
  10. -
  11. full-jaba-client
  12. -
- -

The easiest way to build all distributives is to call build-all ant task. There are more tasks defined in build.xml than described here. They are mostly self explanatory.

-

If you made any changes to the data model and would like to generate a complete JABAWS distro make sure you have rebuilt jaxws artifact as described below.

-

Building web services artifacts

-

Server side artifacts should be rebuild whenever the data model, meta model or MSA interface were changed. To do that run build-server task from wsbuild.xml ant build file. WSDL files will be generated in webservices/compbio/ws/server/resource directory. It is not necessary to edit them if any of the JABAWS clients are used. However, if you would like to generate portable artifacts using wsimport based on the generated WSDL files then, <soap:address location="REPLACE_WITH_ACTUAL_URL"/>

- -

must be replaced with an actual server URL including the web services context path. For example:

-

http://www.compbio.ac.uk:8080/ws

-

JABAWS are the standard JAX-WS web services, which are WS-I basic profile compatible.

-
- - -
-
- - - - - - diff --git a/website/download.html b/website/download.html deleted file mode 100644 index 1abf835..0000000 --- a/website/download.html +++ /dev/null @@ -1,123 +0,0 @@ - - - - - - -Java Bioinformatics Analysis Web Services (JABAWS) download -page - - - - -
- - - -
- - - -
-

For Users

-

JABAWS Server Virtual Machine

-

JABAWS virtual machine is a way of running fully functional JABA Web Services on your own computer. To use virtual machine (VM) you have to install a software for running it. We would recommend VMWare Player v 3.1 for Windows and Linux users. There is also an Oracle VirtualBox v. 3.2 for Mac users. Both are free and installation is simple. Jalview can use your local JABAWS VM.

-
    -
  • JABAWS Virtual Appliance: download (520M)
  • -
-

Please check out our manual for the detailed instructions.

-

For System Administrators

-

JABAWS Server Web Application

-

The JABAWS Server Web Application aRchive (WAR) version is for you if you want to deploy JABAWS for many users e.g. your laboratory or if you are an expert user and want to have more control on JABAWS. Typically, you will have a cluster or at least a powerful server machine which all users are willing to use. If you only have a single server then, you may use JABAWS Server Virtual Appliance instead. The server is provided as a self-contained Web Application -aRchive (WAR) containing all necessary binaries. WAR file can be deployed on any - web application server -supporting Servlet 2.4 specification i.e. Tomcat 6.0.

- -
    -
  • A Complete Server for all platforms: download -(45M)
  • -
- - -

Please bear in mind that if you deploy JABAWS WAR on Windows only Muscle and Clustal web services will work! If you want to run other web services on Windows use JABAWS Server VM package instead. - -

-

For Bioinformaticians/Developers

-

JABAWS Command Line Client

-

The command line client is an executable Java program for scripting against JABA web services. If you intend to use JABAWS in your own program and need a template - download a command line client source package. You can even generate a Graphical User Interface (GUI) for JABA web services for your own program! You can consult Jalview source code for a help with that.

-
    -
  • Command line client - -
  • -
-

Help with a command line client is available from the manual pages.

- -
- - - - - -
- - - -
- - -
- - - -
- - - diff --git a/website/images/VMware_booted.png b/website/images/VMware_booted.png deleted file mode 100644 index 4740198..0000000 Binary files a/website/images/VMware_booted.png and /dev/null differ diff --git a/website/images/VMware_copy_q.png b/website/images/VMware_copy_q.png deleted file mode 100644 index 3da8b81..0000000 Binary files a/website/images/VMware_copy_q.png and /dev/null differ diff --git a/website/images/VMware_cpu.png b/website/images/VMware_cpu.png deleted file mode 100644 index e1a7901..0000000 Binary files a/website/images/VMware_cpu.png and /dev/null differ diff --git a/website/images/banner_bg.gif b/website/images/banner_bg.gif deleted file mode 100644 index 3848fc4..0000000 Binary files a/website/images/banner_bg.gif and /dev/null differ diff --git a/website/images/col_bg.gif b/website/images/col_bg.gif deleted file mode 100644 index 374c176..0000000 Binary files a/website/images/col_bg.gif and /dev/null differ diff --git a/website/images/dir.gif b/website/images/dir.gif deleted file mode 100644 index ceafb2f..0000000 Binary files a/website/images/dir.gif and /dev/null differ diff --git a/website/images/minus.png b/website/images/minus.png deleted file mode 100644 index ae4f575..0000000 Binary files a/website/images/minus.png and /dev/null differ diff --git a/website/images/mm_spacer.gif b/website/images/mm_spacer.gif deleted file mode 100644 index 35d42e8..0000000 Binary files a/website/images/mm_spacer.gif and /dev/null differ diff --git a/website/images/panel_bg.gif b/website/images/panel_bg.gif deleted file mode 100644 index 1b3030d..0000000 Binary files a/website/images/panel_bg.gif and /dev/null differ diff --git a/website/images/panel_bg.jpg b/website/images/panel_bg.jpg deleted file mode 100644 index 521b3d4..0000000 Binary files a/website/images/panel_bg.jpg and /dev/null differ diff --git a/website/images/panel_bg_long.gif b/website/images/panel_bg_long.gif deleted file mode 100644 index 1ceb786..0000000 Binary files a/website/images/panel_bg_long.gif and /dev/null differ diff --git a/website/images/plus.png b/website/images/plus.png deleted file mode 100644 index 865e538..0000000 Binary files a/website/images/plus.png and /dev/null differ diff --git a/website/images/uod.gif b/website/images/uod.gif deleted file mode 100644 index 4d58773..0000000 Binary files a/website/images/uod.gif and /dev/null differ diff --git a/website/images/uod_h.gif b/website/images/uod_h.gif deleted file mode 100644 index ee3705e..0000000 Binary files a/website/images/uod_h.gif and /dev/null differ diff --git a/website/images/uod_lt.gif b/website/images/uod_lt.gif deleted file mode 100644 index fe12457..0000000 Binary files a/website/images/uod_lt.gif and /dev/null differ diff --git a/website/images/vm_welcome_screen.png b/website/images/vm_welcome_screen.png deleted file mode 100644 index 274f109..0000000 Binary files a/website/images/vm_welcome_screen.png and /dev/null differ diff --git a/website/images/vmb_virtual.png b/website/images/vmb_virtual.png deleted file mode 100644 index f64725f..0000000 Binary files a/website/images/vmb_virtual.png and /dev/null differ diff --git a/website/images/ws-structure.png b/website/images/ws-structure.png deleted file mode 100644 index 791ad9a..0000000 Binary files a/website/images/ws-structure.png and /dev/null differ diff --git a/website/index.html b/website/index.html deleted file mode 100644 index 781efa3..0000000 --- a/website/index.html +++ /dev/null @@ -1,86 +0,0 @@ - - - - -Java Bioinformatics Analyses Web Services (JABAWS) main -page - - - - -
- - - -
- - - -
-

-JAva Bioinformatics Analysis Web Services (JABAWS) is a collection of SOAP web services for Bioinformatics.
-Currently JABAWS provides five web -services for multiple sequence alignment Clustal W, MAFFT, MUSCLE, TCOFFEE and PROBCONS. Unlike other web services you can run JABAWS services from your own computer. This puts you in control of the web services - they will be where and when you need them, have no restrictions and your data privacy is guaranteed. JABAWS scales well from the single user single computer to the cluster with hundreds of users. Finally, you do not have to be an expert to use JABAWS - the installation is simple and you can use the services from the comfort of your desktop via Jalview.

-

Public JABAWS Server

-

You can access our public JABA Web Services with our command line client, the Jalview, or write your own program. To guarantee a level service for everyone our public services impose some restrictions on the size and the number of the jobs you can submit. Currently we do not process tasks that exceed 1000 sequences per 1000 letters on average. Should you find this to be insufficient for your needs you can download and run JABAWS Server on your own hardware. This also applies if the privacy is a concern or an Internet connection is a problem.

-
    -
  • The JABAWS public web services address is http://www.combio.dundee.ac.uk/jabaws
  • -
  • Detailed web services description is available from here: WSDL List
  • -
-

Contact Us

-

Please feel free to post your questions/issues to the jabaws-discuss mailing list.

-

Authors

-

Peter Troshin and Geoff Barton are the authors of the JABA Web -Services. Jim Procter helped with the JABAWS design process and web -pages, and developed the interface and management components in -Jalview to access JABAWS servers.

-
- - - -
- - -
- - - - - - - diff --git a/website/man_about.html b/website/man_about.html deleted file mode 100644 index 7196fc5..0000000 --- a/website/man_about.html +++ /dev/null @@ -1,96 +0,0 @@ - - - - -Java Bioinformatics Analyses Web Services (JABAWS) manual - About - - - - - - -
- -
- - -
- -

JABAWS MANUAL

-

About

- - - - -

What is JABAWS?

-

JABAWS stands for JAva Bioinformatics Analysis Web Services. It is a collection of web services for multiple sequence alignment. For simplicity we referrer to them as JABAWS. Right now, JABAWS makes it easy to access well-known multiple sequence alignment programs from JalView. However, the scope of JABAWS is not limited to multiple sequence alignment programs. Future versions of JABAWS will incorporate protein disorder prediction, BLAST, PSIBLAST and HMMER database searches and many other tools. For the list of currently supported programs see here. JABAWS consists of the two parts - the server and the client. Unlike other web services you can download and use both on your own computer! If you want a server just for yourself, then download and install JABAWS Virtual Appliance. It requires no configuration and simple to install. If you want to install JABAWS for your own lab then download JABAWS Web Application aRchive. It is slightly more complicated to configure but is very straightforward too. Finally, if you want to script against any version of JABAWS or interested in writing your own client, the JABAWS command line client is what you need.

-

JABAWS Benefits

-

JABAWS can be deployed on many operating system and operate as a stand alone server or submit the jobs to the cluster. Thanks to DRMAA it integrates well with a large variety of cluster job management systems. Jalview from version 2.6 integrates with JABAWS and can be configured to submit jobs to different versions of JABAWS, for example to your local, lab version, or publicly available version elsewhere. As JABAWS can be installed in your lab, or indeed on your personal computer, it eliminates the need to send your private information to the outside, to one of the publicly accessible servers. JABAWS can run programs with additional parameters defined by you, so you are no longer limited to defaults. JABAWS is safe to install for public access as it could limit the size of the tasks which it accepts and denies access to resources within web application folder.

-

JABA Web Services Programs

-

JABAWS currently uses the following programs under the hood

-
- -

What is JABAWS Server?

-

JABAWS Server is a Web Application which exposes a number of widely used Bioinformatics programs as SOAP web services. Currently it supports 5 multiple sequence alignment programs. You can download and install JABAWS on your own computer. JABAWS can be configured to execute programs on computer it is installed or submit them to the cluster. JABAWS provides the uniform API for each web service if supports.

-

What is JABAWS client?

-

JABAWS client is a command line Java application which can call all JABAWS methods on any instance of JABAWS Server, no matter local or remote. It is useful if you want to script against a JABAWS server and do not want to handle any web service specific details. We also offer a source code of the client so that you can find out how to work with JABA Web Services if you would like to write your own client software. JABAWS command line client offers the same functionality as Jalview when connected to JABAWS.

-

Programmatic access to JABAWS

-

JABA Web Services are WS-I basic profile compliant, they can be accessed in a standard way as any other web service. The WSDL for each service is published on the JABAWS home page. If you use Java, then you can use our client package to access JABAWS. This package contains value objects which you could alternatively generate with wsimport in Java, or similar tool in other language. On top of that it offers some additional methods which further simplify working with JABAWS. For more information please refer to the data model javadoc.

-
- -
- - -
- - - - - - - - diff --git a/website/man_client.html b/website/man_client.html deleted file mode 100644 index dc651ab..0000000 --- a/website/man_client.html +++ /dev/null @@ -1,110 +0,0 @@ - - - - -Java Bioinformatics Analyses Web Services (JABAWS) Command Line Client manual - - - - - -
- - -
- - - -
-

JABAWS MANUAL

- -

JABAWS Command Line Client Usage

-

The command line client comes as a part of client package which you are welcome to download. The command line client can be used to align sequences using any of JABAWS supported web services. The client is OS independent and supports most of the functions which can be accessed programmatically via JABAWS API. Using this client you could align sequences using presets or custom parameters, please see examples of this below. Here is the list of options supported by the command line client.

-Usage: java -jar <path_to_jar_file> -h=host_and_context -s=serviceName ACTION [OPTIONS] --h=<host_and_context> - a full URL to the JABAWS web server including context path e.g. http://10.31.10.159:8080/ws
--s=<ServiceName> - one of [MafftWS, MuscleWS, ClustalWS, TcoffeeWS, ProbconsWS] -

-
-ACTIONS:
--i=<inputFile> - full path to fasta formatted sequence file, from which to align sequences
--parameters - lists parameters supported by web service
--presets - lists presets supported by web service
--limits - lists web services limits
-Please note that if input file is specified other actions are ignored -

-
- OPTIONS: (only for use with -i action):
--r=<presetName> - name of the preset to use
--o=<outputFile> - full path to the file where to write an alignment
--f=<parameterInputFile> - the name of the file with the list of parameters to use.
-Please note that -r and -f options cannot be used together. Alignment is done with either preset or a parameters from the file, but not both!
-

Align sequences from input.fasta file using Mafft web service with default settings, print alignment in Clustal format to console.

-

java -jar jabaws-min-client.jar -h=http://myhost.compbio.ac.uk:8080/jabaws -s=MafftWS -i=d:\input.fasta

-

Content of input.fasta file is show below (please note sequences has been trimmed for clarity)>Foobar
- MTADGPRELLQLRAAVRHRPQDFVAWL
- >Bar
- MGDTTAGEMAVQRGLALHQ
- QRHAEAAVLLQQASDAAPE
- >Foofriend
- MTADGPRELLQLRAAV

-

Align as in above example, but write output alignment in a file out.clustal, using parameters defined in prm.in file

-

java -jar jabaws-min-client.jar -h=http://myhost.compbio.ac.uk:8080/jabaws -s=MafftWS -i=d:\input.fasta -o=d:\out.clustal -f=prm.in

-

The content of the prm.in file is shown below --nofft
- --noscore
- --fastaparttree
- --retree=10
- --op=2.2

-

The format of the file is the same for all JABAWS web services. Parameters are specified in exactly the same way as for native executables - alignment programs like Mafft etc. So parameters which you can use with command line version of an alignment program can be used with JABAWS. Most of the settings controlling alignment process are supported, but the setting controlling output are not. This is due to the fact the output have to be handled by JABAWS, so must remain within its control. For a list of parameters supported by a web service see the next example. In prm.in parameters are separated by the new line, and name of the parameter is separated from its value with an equal sign. This format is constant no matter which JABAWS web service is used.
- java -jar jabaws-min-client.jar -h=http://myhost.compbio.ac.uk:8080/jabaws -s=MafftWS -parameters

-

The same client can be used to access JABAWS on different hosts. Just point the client to the host you want to use by changing the value of -h key. For example you used -h=http://myhost.compbio.ac.uk:8080/jabaws server, now you want to use another server to -h=http://mylabserver.myuni.edu. This comes handy if your favorite server is off and you need to do the job yesterday.

-
- - - -
- - -
- - - - - - - - diff --git a/website/man_configuration.html b/website/man_configuration.html deleted file mode 100644 index 8c18617..0000000 --- a/website/man_configuration.html +++ /dev/null @@ -1,436 +0,0 @@ - - - - -Java Bioinformatics Analyses Web Services (JABAWS) Server Configuration manual - - - - - -
- - -
- - - -
-

JABAWS MANUAL

- -

JABAWS Configuration

- -

JABAWS Configuration

-

There are three parts of the system you can configure. The local -and the cluster engines, and the paths to the individual executables for -each engine. These settings are stored in configuration files -within the web application directory (for an overview, then take a -look at the war file content table).

-

Initially, JABAWS is configured with only the local engine - enabled, with job output written to directory called "jobsout" - within the web application itself. This means that JABAWS will work - out of the box, but may not be suitable for serving a whole lab or - a university.

-

Local Engine Configuration

- -

The Local execution engine configuration is defined in the -properties file conf/Engine.local.properties. The supported -configuration settings are:
- engine.local.enable=true - # -enable or disable local engine, valid values true | false
- local.tmp.directory=D:\\clusterengine\\testoutput -- a directory to use for temporary files storage, optional, -defaults to java temporary directory
- engine.local.thread.number=4 - -Number of threads for tasks execution (valid values between 1 and -2x cpu. Where x is a number of cores available in the system). -Optional defaults to the number of cores for core number <=4 and -number of cores-1 for greater core numbers.

- -

If the local engine going to be heavily loaded (which is often the case if you do not have a cluster) it is a good idea to increase -the amount of memory available for the web application server. If -you are using Apache-Tomcat, then you can define its memory -settings in the JAVA_OPTS environment variable. To specify which -JVM to use for Apache-Tomcat, put the full path to the JRE -installation in the JAVA_HOME environment variable (We would -recommend using Sun Java Virtual Machine (JVM) in preference to -Open JDK). Below is an example of code which can be added to <tomcat_dir>/bin/setenv.sh script -to define which JVM to use and a memory settings for Tomcat server. -Tomcat server startup script (catalina.sh) will execute setenv.sh on each server start -automatically.
- export -JAVA_HOME=/homes/ws-dev2/jdk1.6.0_17/
- export JAVA_OPTS="-server -Xincgc -Xms512m -Xmx1024m"

- -

Cluster Engine Configuration

- -

Supported configuration settings:
- engine.cluster.enable=true - # -enable or disable local engine true | false, defaults to -false
- cluster.tmp.directory=/homes/clustengine/testoutput- -a directory to use for temporary files storage. The value must be -an absolute path to the temporary directory. Required. The value -must be different from what is defined for local engine. This -directory must be accessible from all cluster nodes.
- For the cluster engine to work, the SGE_ROOT and LD_LIBRARY_PATH -environment variables have to be defined. They tell the cluster -engine where to find DRMAA libraries. These variables -should be defined when the web application server starts up, e.g.

- -

SGE_ROOT=/gridware/sge
- LD_LIBRARY_PATH=/gridware/sge/lib/lx24-amd64

- -

Finally, do not forget to configure executables for the cluster -execution, they may be the same as for the local execution but may -be different. Please refer to the executable configuration section -for further details.

- -

Executable Configuration

- -

All the executable programs -are configured in conf/Executable.properties file. Each executable -is configured with a number of options. They are: local.X.bin.windows=<path to executable under windows -system, optional>
- local.X.bin=<path to the executable under non-windows system, -optional>
- cluster.X.bin=<path to the executable on the cluster, all -cluster nodes must see it, optional>
- X.bin.env=<semicolon separated list of environment variables -for executable, use hash symbol as name value separator, -optional>
- X.--aamatrix.path=<path to the directory containing -substitution matrices, optional>
- X.presets.file=<path to the preset configuration file, optional ->
- X.parameters.file=<path to the parameters configuration file, -optional>
- X.limits.file=<path to the limits configuration file, -optional>
- X.cluster.settings=<list of the cluster specific options, -optional>

- -

Where X is either clustal, muscle, mafft, probcons or tcoffee.

- -

Default JABAWS configuration includes path to local executables -to be run by the local engine only, all cluster related settings -are commented out, but they are there for you as example. Cluster -engine is disabled by default. To configure executable for cluster -execution un comment the X.cluster settings and change them -appropriately.

-

By default limits are set well in excess of what you may want to offer to the users outside your lab, to make sure that the tasks are never rejected. The default limit is 100000 sequences of 100000 letters on average for all of the JABA web services. You can adjust the limits according to your needs by editing conf/settings/<X>Limit.xml files.
- After you have completed the editing your configuration may look like - this:local.mafft.bin.windows=
- local.mafft.bin=binaries/mafft
- cluster.mafft.bin=/homes/cengine/mafft
- mafft.bin.env=MAFFT_BINARIES#/homes/cengine/mafft;FASTA_4_MAFFT#/bin/fasta34;
- mafft.--aamatrix.path=binaries/matrices
- mafft.presets.file=conf/settings/MafftPresets.xml
- mafft.parameters.file=conf/settings/MafftParameters.xml
- mafft.limits.file=conf/settings/MafftLimits.xml
- mafft.cluster.settings=-q bigmem.q -l h_cpu=24:00:00 -l - h_vmem=6000M -l ram=6000M

-

Please not that relative paths must only be specified for the -files that reside inside web application directory, all other paths -must be supplied as absolute!

- -

Furthermore, you should avoid using environment variables within the paths or options - since these will not be evaluated correctly. Instead, please explicitly -specify the absolute path to anything -normally evaluated from an environment variable at execution time.

- -

If you are using JABAWS to submit jobs to the cluster (with -cluster engine enabled), executables must be available from all -cluster nodes the task can be sent to, also paths to the -executables on the cluster e.g. cluster.<exec_name>.bin must be -absolute.

- -

Executables can be located anywhere in your system, they do not -have to reside on the server as long as the web application server -can access and execute them.

- -

Cluster settings are treated as a black box, the system will -just pass whatever is specified in this line directly to the -cluster submission library. This is how DRMAA itself treats this -settings. More exactly DRMAA JobTemplate.setNativeSpecification() function will be called.

- -

Defining Environment Variables for -Executables

- -

Environment variables can be defined in property x.bin.env Where x is -one of five executables supported by JABAWS. Several environment -variables can be specified in the same line. For example.
- mafft.bin.env=MAFFT_BINARIES#/homes/cengine/mafft;FASTA_4_MAFFT#/bin/fasta34;

- -

The example above defines two environment variables with names -MAFFT-BINARIES and FASTA_4_MAFFT and values /homes/cengine/mafft -and /bin/fasta34 respectively. Semicolon is used as a separator -between different environment variables whereas hash is used as a -separator for name and value of the variable.

- -

Configure JABAWS to Work -with Mafft

- -

If you use default configuration you do not need to read any -further. The default configuration will work for you without any -changes, however, if you want to install Mafft yourself then there -is a couple of more steps to do.

- -

Mafft executable needs to know the location of other files -supplied with Mafft. In addition some Mafft functions depends on -the fasta executable, which is not supplied with Mafft, but is a -separate package. Mafft needs to know the location of fasta34 -executable.

- -

To let Mafft know where the other files from its package are -change the value of MAFFT-BINARIES environment variables. To let -Mafft know where is the fasta34 executable set the value of -FASTA_4_MAFFT environment variable to point to a location of -fasta34 program. The latter can be added to the PATH variable -instead. If you are using executables supplied with JABAWS, the -path to Mafft binaries would be like <relative path to web application -directory>/binaries/src/mafft/binaries and the path to -fasta34 binary would be <relative path -to web application -directory>/binaries/src/fasta34/fasta34. You can specify -the location of Mafft binaries as well as fasta34 program elsewhere -by providing an absolute path to them. All these settings are -defined in conf/Executable.properties file.

-

Limiting the size of the job accepted by JABAWS

-

JABAWS can be configured to reject excessively large tasks. This is useful if you operate JABAWS service for many users. By defining a maximum allowed task size you can provide an even service for all users and prevents waist of resources on the tasks too large to complete successfully. You can define the maximum number of sequences and the maximum average sequence length that JABAWS accepts for each JABA Web Service independently. -Furthermore, you can define different limits for different presets of the same web service.
-By default limits are set well in excess of what you may want to offer to the users outside your lab, to make sure that the tasks are never rejected. The default limit is 100000 sequences of 100000 letters on average for all of the JABA web services. You can adjust the limits according to your needs by editing conf/settings/<X>Limit.xml files.

-

Using a different version of the alignment program with JABAWS

-

JABAWS supplied with binaries and source code of the executables which version it supports. So normally you would not need to install your own executables. However, if you have a different version of an executable (e.g. an alignment program) which you prefer, you could use it as long as it supports all the functions JABAWS executable supported. This could be the case with more recent executable. If the options supported by your chosen executable is different when the standard JABAWS executable, than you need to edit ExecutableNameParamaters.xml  configuration file.

-

Load balancing

-

If your cluster is busy and have significant waiting times you can achieve a faster response by allowing the server machine to calculate small tasks and the reserve the cluster for bigger jobs. This works especially well if your server is a powerful machine with many CPUs. To do this you need to enable and configure both the cluster and the local engines. Once this is done decide on the maximum size of a task to be run on the server locally. Then, edit "# LocalEngineExecutionLimit #" preset in <ServiceName>Limits.xml file accordingly. JABAWS server then will balance the load according to the following rule: If the task size is smaller then the maximum task size for local engine, and the local engine has idle threads, then calculate task locally otherwise submit the task to the cluster.

-

Reviewing JABAWS configuration via web browser

-

Access to configuration files is prohibited to any unauthorized users by means of security constrain defined in web application descriptor file. There is a special user role called admin who can access these files. This comes handy if you would like to keep an eye on any of the task outputs stored in jobsout, or would like to view the configuration files. To access the configuration files add admin user into your application server. The way you do it depends on where you would like the user passwords to come from and your web application server. If you use Tomcat, then the simplest way is to use Tomcat Memory Realm which is linked to a plain text configuration file. To define the user in Tomcat server add an entry in conf/tomcat-user.xml file. <role rolename="admin"/>
- <user username="admin" password="your password here " roles="admin"/>

-

Once this is done make sure the servlet that returns the web application directory listings is enabled. Look in the <tomcatroot>/conf/web.xml file for the following <param-name>listings</param-name>
- <param-value>true</param-value>

-

The whole section that defines default listing servlet is below

-

<servlet>
- <servlet-name>default</servlet-name>
- <servlet-class>org.apache.catalina.servlets.DefaultServlet</servlet-class>
- <init-param>
- <param-name>debug</param-name>
- <param-value>0</param-value>
- </init-param>
- <init-param>
- <param-name>listings</param-name>
- <param-value>true</param-value>
- </init-param>
- <load-on-startup>1</load-on-startup>
- </servlet>
-

-

These listings are read only by default.

-

Testing JABA Web Services

-

You can use a command line client (part of the client only - package) to test your JABAWS installation as described here. If you downloaded a JABAWS - server package, you can use <your_jaba_context_name>/WEB-INF/lib/jaba-client.jar to test JABAWS installation as described in here. If you downloaded the source - code, then you could run a number of test suits defined in the - build.xml Apache Ant file.

-

JABAWS requests logging

-

Enable Tomcat log valve. To do this uncomment the following section of <tomcat_root>/conf/server.xml configuration file.

-

<Valve className="org.apache.catalina.valves.AccessLogValve" directory="logs"
- prefix="localhost_access_log." suffix=".txt" pattern="common" resolveHosts="false"/>

-

The following information will be logged:

- - - - - - - - - - - - - - - -
Remote IPDateMethod server_URL protocol HTTP status Response size in bytes
10.31.11.159[10/Feb/2010:16:51:32 +0000]"POST /jws2/MafftWS HTTP/1.1"2002067
-

Which can be processed in various programs for log analysis , such as WebAlizer, Analog, AWStats.

-

JABAWS internal logging

-

JABAWS can be configured to log what it is doing. This comes - handy if you would like to see who is using your web services or - need to chase some problems. JABAWS uses log4j to do the logging, - the example of log4j configuration is bundled with JABAWS war file. - You will find it in the /WEB-INF/classes/log4j.properties file. All the - lines in this file are commented out. The reason why the logging is - disabled by default it simple, log4j have to know the exact - location where the log files should be stored. This is not known up - until the deployment time. To enable the logging you need to - define logDir property in the log4j.properties and uncomment section of - the file which corresponds to your need. More information is given - in the log4j.properties file - itself. Restart the Tomcat or the JABAWS web application to apply - the settings.

-

After you have done this, assuming that you did not change the - log4j.properties file yourself, you should see the application log - file called activity.log. The - amount of information logged can be adjusted using different - logging levels, it is reduced in the following order of log levels - TRACE, DEBUG, INFO, WARN, ERROR, FATAL.

-

If you would like to know who is using your services, you might - want to enable Tomcat request - logging.

-

Monitoring JABAWS

-

JABAWS stores cluster task ids for all tasks which were run on the cluster. Using cluster ids the detailed statistics can be extracted from cluster accounting system. Due to the fact that each cluster supported by JABAWS have different accounting system it was not possible to provide ready to use statistics.
- For the local execution the starting and finishing time in nano seconds can be found in STARTED and FINISHED files respectively. In time we will provide the tools to extract execution time statistics, so keep the content of your working directory ready!

-

JABAWS War File Content

- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
DirectoryContent description
conf/contains configuration files such as Executable.properties, - Engine.local.properties, Engine.cluster.properties
conf/settingsContains individual executable description files. In particular - XXXParameters.xml, XXXPresets.xml, XXXLimits.xml where XXX is the - name of the executable
jobsout/Contains directories generated when running an individual executable. E.g. input and output files and some other task - related data. (optional)
binaries/Directory contains native executables - programs, - windows binaries (optional)
binaries/srcContains source of native executables and Linux i386 - binaries.
binaries/matricesSubstitution matrices -
WEB-INFWeb application descriptor
WEB-INF/libWeb application libraries
WEB-INF/classeslog4j.properties - log configuration file (optional)
Help Pages
/help pages, index.html is the starting page
dm_javadocjavadoc for JABAWS client (the link is available from How To - pages)
prog_docsdocumentation for programs that JABAWS uses
imagesimages referenced by html pages
-

 

-
- - -
- - -
- - - - - - - - diff --git a/website/man_dev.html b/website/man_dev.html deleted file mode 100644 index f16691d..0000000 --- a/website/man_dev.html +++ /dev/null @@ -1,358 +0,0 @@ - - - - -Java Bioinformatics Analyses Web Services (JABAWS) client developers manual - - - - - -
- - -
- - - -
-

JABAWS MANUAL

- -

Using JABAWS From Your Program

- -

Web services functions overview

-

All JABA multiple sequence alignment web services comply to the same interface, thus the function described below are available from all the services.

-

Functions for initiating the alignment String id = align(List<FastaSequence> list)
- String id = customAlign(List<FastaSequence> sequenceList, List<Option> optionList)
- String id = presetAlign(List<FastaSequence> sequenceList, Preset preset)

-

Functions pertaining to job monitoring and control
- JobStatus status = getJobStatus(String id)
- Alignment al = getResult(String id)
- boolean cancelled = cancelJob(String id)
- ChunkHolder chunk = pullExecStatistics(String id, long marker)

-

Functions relating to service features discovery
- RunnerConfig rc = getRunnerOptions()
- Limit limit = getLimit(String name)
- LimitsManager lm = getLimits()
- PresetManager pm = getPresets()

-

Please refer to a data model javadoc for a detailed description of each methods.

-

Structure of the template command line client

- - - - - - - - - - - - - - - - - - - - - -
PackagesClasses and Interfaces
compbio.data.msa MsaWS the interface for all multiple sequence alignment web services
compbio.data.sequenceJABAWS data types
compbio.metadataJABAWS meta data types
compbio.ws.clientJABAWS command line client
-

Additional utility libraries this client depend upon is the compbio-util-1.3.jar and compbio-annotation-1.0.jar.
- Please refer to a data model javadoc for a detailed description of each class and its methods.

-

Connecting to JABAWS

-

For a complete working example of JABAWS command line client please see compbio.ws.client.Jws2Client class. JABAWS command line client source code is available from the download page. Please note that for now all the examples are in Java other languages will follow given a sufficient demand.

-

Download a binary JABAWS client. Add the client to the class path. The following code excerpt will connect your program to Clustal web service deployed in the University of Dundee.

-

import java.net.URL;
- import javax.xml.namespace.QName;
- import javax.xml.ws.Service;
- ...............
- 1) String qualifiedName = "http://msa.data.compbio/01/01/2010/";
- 2) URL url = new URL("http://www.compbio.dundee.ac.uk/jabaws/ClustalWS?wsdl");
- 3) QName qname = new QName(, "ClustalWS");
- 4) Service serv = Service.create(url, qname);
- 5) MsaWS msaws = serv.getPort(new QName(qualifiedName, "ClustalWSPort"), - MsaWS.class);

-

Line 1 makes a qualified name for JABA web services.
- Line 2 - constructs the URL to the web services WSDL.
- Line 3 makes a qualified name instance for Clustal JABA web service.
- Line 4 creates a service instance.
- Line 5 makes a connection to the server.

-

A more generic connection method would look like this

-

import java.net.URL;
- import javax.xml.namespace.QName;
- import javax.xml.ws.Service;
- import compbio.ws.client.Services
- ..............
- String qualifiedServiceName = "http://msa.data.compbio/01/01/2010/";
- String host = "http://www.compbio.dundee.ac.uk/jabaws";
- // In real life the service name can come from args
- Services clustal = Services.ClustalWS;
- URL url = new URL(host + "/" + clustal.toString() + "?wsdl");
- QName qname = new QName(qualifiedServiceName, clustal.toString());
- Service serv = Service.create(url, qname);
- MsaWS msaws = serv.getPort(new QName(qualifiedServiceName, clustal
- + "Port"), MsaWS.class);

-

Where Services is enumeration of JABAWS web services. All JABAWS multiple sequence alignment methods confirm to MsaWS specification, thus from the caller point of view all JABAWS web services can be represented by MsaWS interface. The full documentation of MsaWS functions is available from the javadoc.

-

Valid JABAWS service names and WSDL files

-
    -
  • ClustalWS (http://www.compbio.dundee.ac.uk/jabaws/ClustalWS?wsdl)
  • -
  • MuscleWS (http://www.compbio.dundee.ac.uk/jabaws/MuscleWS?wsdl)
  • -
  • MafftWS (http://www.compbio.dundee.ac.uk/jabaws/MafftWS?wsdl)
  • -
  • TcoffeeWS (http://www.compbio.dundee.ac.uk/jabaws/TcoffeeWS?wsdl)
  • -
  • ProbconsWS (http://www.compbio.dundee.ac.uk/jabaws/ProbconsWS?wsdl)
  • -
-

Aligning sequences

-

Given that msaws is web service proxy, created as described in "Connecting to JABAWS" section, the actual alignment can be obtained as follows:

-

1) List<FastaSequence> fastalist = SequenceUtil.readFasta(new FileInputStream(file));
- 2) String jobId = msaws.align(fastalist);
- 3) Alignment alignment = msaws.getResult(jobId);

-

Line one loads FASTA sequence from the file
- Line two submits them to web service represented by msaws proxy
- Line three retrieves the alignment from a web service. This line will block the execution until the result is available. Use this with caution. In general, you should make sure that the calculation has been completed before attempting retrieving results. This is to avoid keeping the connection to the server on hold for a prolonged periods of time. While this may be ok with your local server, our public server (www.compbio.dundee.ac.uk/jabaws) will not let you hold the connection for longer than 10 minutes. This is done to prevent excessive load on the server. The next section describes how to check the status of the calculation.
- Methods and classes mentioned in the excerpt are available from the JABAWS client library.

-

Checking the status of the calculation

-

You may have noticed that there was no pause between submitting the job and retrieving of the results. This is because getResult(jobId) method block the processing until the calculation is completed. However, taking into account that the connection holds server resources, our public server (www.compbio.dundee.ac.uk/jabaws) is configured to reset the connection after 10 minutes of waiting. To work around the connection reset you are encouraged to check whether the calculation has been completed before accessing the results. You can do it like this:

-

while (msaws.getJobStatus(jobId) != JobStatus.FINISHED) {
-     Thread.sleep(2000); // wait two seconds, then recheck the status
- }

-

Aligning with presets

-

1) PresetManager presetman = msaws.getPresets();
- 2) Preset preset = presetman.getPresetByName(presetName);
- 3) List<FastaSequence> fastalist = SequenceUtil.readFasta(new FileInputStream(file));
- 4) String jobId = msaws.presetAlign(fastalist, preset);
- 5) Alignment alignment = msaws.getResult(jobId);

-

Line one obtains the lists of presets supported by a web service.
- Line two return a particular Preset - by its name
- Lines three to five are doing the same job as in the first aligning sequences example.

-

Aligning with custom parameters

-

1) RunnerConfig options = msaws.getRunnerOptions();
- 2) Argument matrix = options.getArgument("MATRIX");
- 3) matrix.setValue("PAM300");
- 4) Argument gapopenpenalty = options.getArgument("GAPOPEN");
- 5) gapopenpenalty.setValue("20");
- 6) List<Argument> arguments = new ArrayList<Argument>();
- 7) arguments.add(matrix); - arguments.add(gapopenpenalty);
- 8) List<FastaSequence> fastalist = SequenceUtil.readFasta(new FileInputStream(file));
- 9) String jobId = msaws.customAlign(fastalist, arguments);
- 10) Alignment alignment = msaws.getResult(jobId);

-

Line one obtains the RunnerConfig object that holds information on supported parameters and their values
- Line two retrieve a particular parameter from the holder by its name
- Lines three sets a value to this parameter which will be used in the calculation.
- Line four and five do the same but for another parameter
- Line 6 makes a List to hold the parameters
- Line seven puts the parameters into that list
- Line eight - and ten is the same as in previous examples
- Line nine submit an alignment request with the sequences and the parameters
- The names of all the parameters supported by a web service e.g. "PAM300" can be obtained using options.getArguments() method. Further details on the methods available from RunnerConfig object are available from the javadoc.

-

Writing alignments to a file

-

There is a utility method in the client library that does exactly that.

-

Alignment alignment = align(...)
- FileOutputStream outStream = new FileOutputStream(file);
- ClustalAlignmentUtil.writeClustalAlignment(outStream, align);

-

A complete client example

-

Finally, a complete example of the program that connects to JABAWS Clustal service and aligns sequences using one of the Clustal web service preset. Three is also a PDF version of this example with syntax highlighted. The text comments are commented by block style comments e.g. /* comment */, the alternatives given in the code are line commented // comment. You may want to remove line style comments to test alternatives of the functions. All you need for this to work is a JABAWS binary client. Please make sure that the client is in the Java class path before running this example.

-
-import java.io.ByteArrayInputStream;
-import java.io.FileNotFoundException;
-import java.io.IOException;
-import java.net.URL;
-import java.util.List;
-
-import javax.xml.namespace.QName;
-import javax.xml.ws.Service;
-
-import compbio.data.msa.MsaWS;
-import compbio.data.sequence.Alignment;
-import compbio.data.sequence.FastaSequence;
-import compbio.data.sequence.SequenceUtil;
-import compbio.metadata.JobSubmissionException;
-import compbio.metadata.LimitExceededException;
-import compbio.metadata.Preset;
-import compbio.metadata.PresetManager;
-import compbio.metadata.ResultNotAvailableException;
-import compbio.metadata.UnsupportedRuntimeException;
-import compbio.metadata.WrongParameterException;
-
-public class Example {
-
-	/*
-	 * Input sequences for alignment
-	 */
-	static final String input = ">Foo\r\n"
-			+ "MTADGPRELLQLRAAVRHRPQDFVAWLMLADAELGMGDTTAGEMAVQRGLALHPGHPEAVARLGR"
-			+ "VRWTQQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDAGQAEAAAAAYTRAHQLLPEEPYITAQ"
-			+ "LLNWRRRLCDWRALDVLSAQVRAAVAQGVGAVEPFAFLSEDASAAEQLACARTRAQAIAASVRPL"
-			+ "APTRVRSKGPLRVGFVSNGFGAHPTGLLTVALFEALQRRQPDLQMHLFATSGDDGSTLRTRLAQA"
-			+ "STLHDVTALGHLATAKHIRHHGIDLLFDLRGWGGGGRPEVFALRPAPVQVNWLAYPGTSGAPWMD"
-			+ "YVLGDAFALPPALEPFYSEHVLRLQGAFQPSDTSRVVAEPPSRTQCGLPEQGVVLCCFNNSYKLN"
-			+ "PQSMARMLAVLREVPDSVLWLLSGPGEADARLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHAD"
-			+ "LFLDTHPYNAHTTASDALWTGCPVLTTPGETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALAS"
-			+ "DPAALTALHARVDVLRRESGVFEMDGFADDFGALLQALARRHGWLGI\r\n"
-			+ "\r\n"
-			+ ">Bar\r\n"
-			+ "MGDTTAGEMAVQRGLALHQQRHAEAAVLLQQASDAAPEHPGIALWLHALEDAGQAEAAAAYTRAH"
-			+ "QLLPEEPYITAQLLNAVAQGVGAVEPFAFLSEDASAAESVRPLAPTRVRSKGPLRVGFVSNGFGA"
-			+ "HPTGLLTVALFEALQRRQPDLQMHLFATSGDDGSTLRTRLAQASTLHDVTALGHLATAKHIRHHG"
-			+ "IDLLFDLRGWGGGGRPEVFALRPAPVQVNWLAYPGTSGAPWMDYVLGDAFALPPALEPFYSEHVL"
-			+ "RLQGAFQPSDTSRVVAEPPSRTQCGLPEQGVVLCCFNNSYKLNPQSMARMLAVLREVPDSVLWLL"
-			+ "SGPGEADARLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHADLFLDTHPYNAHTTASDALWTGC"
-			+ "PVLTTPGETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALASDPAALTALHARVDVLRRESGV"
-			+ "FEMDGFADDFGALLQALARRHGWLGI\r\n"
-			+ "\r\n"
-			+ ">Friends\r\n"
-			+ "MTADGPRELLQLRAAVRHRPQDVAWLMLADAELGMGDTTAGEMAVQRGLALHPGHPEAVARLGRV"
-			+ "RWTQQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDHQLLPEEPYITAQLDVLSAQVRAAVAQG"
-			+ "VGAVEPFAFLSEDASAAEQLACARTRAQAIAASVRPLAPTRVRSKGPLRVGFVSNGFGAHPTGLL"
-			+ "TVALFEALQRRQPDLQMHLFATSGDDGSTLRTRLAQASTLHDVTALGHLATAKHIRHHGIDLLFD"
-			+ "LRGWGGGGRPEVFALRPAPVQVNWLAYPGTSGAPWMDYVLGDAFALPPALEPFYSEHVLRLQGAF"
-			+ "QPSDTSRVVAEPPSRTQCGLPEQGVVLCCFNNSYKLNPQSMARMLAVLREVPDSVLWLLSGPGEA"
-			+ "DARLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHADLFLDTHPYNAHTTASDALWTGCPVLTTP"
-			+ "GETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALASDPAALTALHARVDVLRRESI";
-
-	public static void main(String[] args) throws UnsupportedRuntimeException,
-			LimitExceededException, JobSubmissionException,
-			WrongParameterException, FileNotFoundException, IOException,
-			ResultNotAvailableException, InterruptedException {
-
-		String qualifiedServiceName = "http://msa.data.compbio/01/01/2010/";
-
-		/* Make a URL pointing to web service WSDL */
-		URL url = new URL(
-				"http://www.compbio.dundee.ac.uk/jabaws/ClustalWS?wsdl");
-
-		/*
-		 * If you are making a client that connects to different web services
-		 * you can use something like this:
-		 */
-		// URL url = new URL(host + "/" + Services.ClustalWS.toString() +
-		// "?wsdl");
-
-		QName qname = new QName(qualifiedServiceName, "ClustalWS");
-		Service serv = Service.create(url, qname);
-		/*
-		 * Multiple sequence alignment interface for Clustal web service
-		 * instance
-		 */
-		MsaWS msaws = serv.getPort(new QName(qualifiedServiceName, "ClustalWS"
-				+ "Port"), MsaWS.class);
-
-		/* Get the list of available presets */
-		PresetManager presetman = msaws.getPresets();
-
-		/* Get the Preset object by preset name */
-		Preset preset = presetman
-				.getPresetByName("Disable gap weighting (Speed-oriented)");
-
-		/*
-		 * Load sequences in FASTA format from the file You can use something
-		 * like new FileInputStream(<filename>) to load sequence from the file
-		 */
-		List<FastaSequence> fastalist = SequenceUtil
-				.readFasta(new ByteArrayInputStream(input.getBytes()));
-
-		/*
-		 * Submit loaded sequences for an alignment using preset. The job
-		 * identifier is returned by this method, you can retrieve the results
-		 * with it sometime later.
-		 */
-		String jobId = msaws.presetAlign(fastalist, preset);
-
-		/* This method will block for the duration of the calculation */
-		Alignment alignment = msaws.getResult(jobId);
-
-		/*
-		 * This is a better way of obtaining results, it does not involve
-		 * holding the connection open for the duration of the calculation,
-		 * Besides, as the University of Dundee public server will reset the
-		 * connection after 10 minutes of idling, this is the only way to obtain
-		 * the results of long running task from our public server.
-		 */
-		// while (msaws.getJobStatus(jobId) != JobStatus.FINISHED) {
-		// Thread.sleep(1000); // wait a second, then recheck the status
-		// }
-
-		/* Output the alignment to standard out */
-		System.out.println(alignment);
-
-		// Alternatively, you can record retrieved alignment into the file in
-		// ClustalW format
-
-		// ClustalAlignmentUtil.writeClustalAlignment(new FileOutputStream(
-		// "output.al"), alignment);
-
-	}
-}
-
-For a more detailed description of all available types and their functions please refer to the data model javadoc. -

Building web services artifacts

-

JABAWS are the standard JAX-WS SOAP web services, which are WS-I basic profile compatible. This means that you could use whatever tool your language has to work with web services. Below is how you can generate portable artifacts to work with JABAWS from Java. However, if programming in Java we recommend using our client library as it provides a handful of useful methods in addition to plain data types.

-

wsimport -keep http://www.compbio.dundee.ac.uk/jabaws/ClustalWS?wsdl

-
- - - -
- - -
- - - - - - - - diff --git a/website/man_servervm.html b/website/man_servervm.html deleted file mode 100644 index 976d311..0000000 --- a/website/man_servervm.html +++ /dev/null @@ -1,167 +0,0 @@ - - - - -Java Bioinformatics Analyses Web Services (JABAWS) Server Virtual Appliance Manual - - - - - -
- - -
- - - -
-

JABAWS MANUAL

- -

JABAWS Server Virtual Appliance

- - -

Troubleshooting

- -

What is JABAWS Server Virtual Appliance?

-

The JABAWS Server Virtual Appliance is an installation of JABAWS Web Application Archive (WAR) with all dependencies on TurnKey Linux within a Virtual Machine. The JABAWS virtual appliance is a way to run JABAWS server locally without the need to connect to the internet or configure JABAWS. - - - All JABAWS clients, such as Jalview can be easily configured to use the appliance. - You can run the appliance with freely available VMWare Player or Oracle VirtualBox which you must install first. We have tested JABAWS appliance with VMware Player v 3.1.2 on Windows and Linux, and VirtualBox v 3.2.12 on Windows, Linux and Mac. - However, you are not limited to these virtualization systems and can use JABAWS appliance with any commercial alternative.

-

When to use the virtual appliance

-

The appliance best suits users who would like to use the JABA web services locally, without an Internet connection, want to keep their data private -or uses Windows as their main OS. The appliance is a self contained unit of software and as such may be an attractive option for Linux, UNIX or Mac users too. However, they can always deploy a JABAWS Server WAR distribution instead.
-The appliance comes pre configured to use 1 CPU and 512M of memory and the minimum amount of memory required is about 378M. If you thinking of running the JABAWS server for many users and want JABAWS to use a cluster for calculations you need a WAR version of JABAWS server instead. Virtual Appliance would not be the best option for that.

- -

How to install VMWare Player or VirtualBox

-

Please see the VMware Player -and Oracle VirtualBox web sites for up to date instructions and downloads.

- -

VMware Player appliance configuration

-

The free VMware Player can be used to run the JABAWS services from the Windows and Linux host operating systems, there is no support for Mac at the time of writing (December 2010). -However, VMware Fusion, a commercial VMware product, offers virtual machine support for Mac computers too.

-

To run the JABAWS server on VMware player, unpack the JABAWS VM into one of the folders on your local hard drive. Open VMware Player, click "Open Virtual Machine" and point the Player to the location of the JABAWS, then choose the JABAWS.vmx file to open an appliance.

-

When you play the machine for the first time the Player might ask you whether "This virtual machine may have been moved or copied.", say that you have copied it. That is all.

-

VirtualBox appliance configuration

-

VirtualBox can be used to run JABAWS services from Windows, Linux, Solaris or Mac host operating systems. Use the VitualBox "Import Appliance" option to import the JABAWS. Please bear in mind that to benefit from multiple CPU support under the VirtualBox software you need to enable hardware virtualization extensions, such as Intel Virtualization VT-x or AMD-V support in the BIOS of your computer. Unfortunately, we were unable to find a reliable way to do it on Mac, so some Macs running VirtualBox will be limited to one CPU only, irrespective of the number of CPUs of the host machine.

-

We found that, by default, virtualization extensions are enabled in VirtualBox irrespective of whether your computer supports them. You will get the VERR_VMX_MSR_LOCKED_OR_DISABLED exception if your computer does not support the extensions or their support is disabled. Just deselect the checkboxes shown on the screen shot below to solve the problem.

-

VirtualBox JABAWS VM configuration screen shot displaying virtualization settings.

-

VT-x extension on VirtualBox

-

JABAWS Appliance details

-

By default, the JABAWS virtual appliance is configured with 512M of memory and 1 CPU, but you are free to change these settings. If you have more than one CPU or CPU core on your computer you can make them available for the JABAWS virtual machine by editing virtual machine settings. Please bear in mind that more CPU power will not make a single calculation go faster, but it will enable the VM to do calculations in parallel. Similarly, you can add more memory to the virtual machine. More memory lets your VM deal with larger tasks, e.g. work with large alignments.

-

The VMware Player screen shot below displays JABAWS VM CPU settings.

-

vmware cpu settings

- -

JABAWS appliance configuration:

-

VMware info
- - CPUs : 1
- - RAM : 512 MB
- - Networking : Host only (the VM has no access to the outside network, nothing from the outside network can access the VM)
- - Hard disk : 20 GB (expanding)
- - VMware tools : Installed

-

OS info
- - OS : TurnKey Linux, based on Ubuntu 8.0.4 JEOS (Just-Enough-Operation-System)
- - Installation : Oracle Java 6, Tomcat 6, JABAWS v. 1.0
- - Hostname : tomcat
- - IPv4 address : dhcp
- - IPv6 address : auto
- - DNS name : none
- - Name server : dhcp
- - Route : dhcp
- - Keyboard : US_intl

-

Login credentials
- - Root password: jabaws

-

Services

-
    -
  • Default virtual console Alt+F7
  • -
  • Tomcat web server.
    - Access: http://VM_IP
  • -
  • JABAWS URL: http://VM_IP/jabaws
  • -
  • Web Shell
    - Access: https://VM_IP:12320/
  • -
  • Webmean
    - Access: https://VM_IP:12321/
  • -
  • SSH/SFTP
    - Access: root@VM_IP
  • -
-

Where VM_IP is the VM IP address. Under VMware Player host only networking, the first VM may have 192.168.227.128 IP address. Under VirtualBox host only networking, first VM may have 192.168.56.101 IP address.

-

Configuring Jalview to work with your JABAWS VM

-

After booting the JABAWS VM, you should see similar screen, however, the IP address of your VM may be different. To enable Jalview to work with your JABAWS appliance you need to go to Jalview->Tools->Preferences->Web Services -> New Service URL, and add JABAWS URL into the box provided. For more information please refer to Jalview help pages.

-

JABAWS welcome screen

-

If you click on Advanced Menu, you will see the configuration console, similar to the one below.

-

JABAWS welcome screen

-

If you need to configure a static IP address the configuration console will help you with this. Shutting down the VM is best from the configuration console as well.

-

VM Network Settings

-

By default the JABAWS VM is configured to use host-only networking. This means that the host can communicate with the VM via a network, but no other machines can. Similarly, the VM cannot communicate with any other computers apart from the host. If you want to connect to the Internet from the VM, configure your VM to use NAT network. However, you will not be able to connect to the VM from the host in such case. If you want to be able to connect to your VM and let VM connect to the internet at the same time you would have to use a Bridged network. In such a case you would have to configure the VM IP address manually (unless of course your network has a DHCP server to do that)

-

VirtualBox fails to open the VM due to VERR_VMX_MSR_LOCKED_OR_DISABLED exception

-

VERR_VMX_MSR_LOCKED_OR_DISABLED exception means that Intel Virtualization technology is disabled or not supported by your computer. If you have such a problem, please make sure you have configured the JABAWS VM with 1 CPU and disabled VT-X extensions. Alternatively you can enable virtualization extensions ion from the BIOS of your computer. Unfortunately, we cannot give you exact instructions on how to do this, as this would depend on your computer BIOS manufacturer. For MACs it may not be possible at all.

-

VirtualBox 4.0 fails to import the VM due to VBOX_E_INVALID_OBJECT_STATE exception

-

There were reports that VirtualBox version 4.0 suffers from this problem at least on Windows XP. The fix is to use the previous version of VirtualBox 3.2.12

-

VMWare Player fails to open the VM with "Fail to query source for information" exception

-

At the time of writing, the latest version of VMware Player 3.1.2 supported only a legacy OVF version 0.9. Whereas OVF packaged with JABAWS VM is version 1.0. Please use VMX - VMware specific configuration file with all VMware products.

-
- - - -
- - -
- - - - - - - - diff --git a/website/man_serverwar.html b/website/man_serverwar.html deleted file mode 100644 index 5d092e0..0000000 --- a/website/man_serverwar.html +++ /dev/null @@ -1,264 +0,0 @@ - - - - -Java Bioinformatics Analyses Web Services (JABAWS) Server Web Aplication aRchive manual - - - - - -
- - -
- - - -
-

JABAWS MANUAL

- -

JABAWS Server Web Application aRchive (WAR)

- -

Troubleshooting

- -

System Requirements

-

JABAWS requires a Java web application server compliant with -version 2.4 of the Java Servlet specification, and a Java 6 runtime -environment. We recommend using an official Oracle Java 6 runtime -environment, and Apache-Tomcat web application server version 6, but other versions may work as well.

- -

JABAWS Web Application aRchive can run on any host operating system that supports Java. However JABAWS depends on the third party programs which are not available for all operating systems. In particular, only Clustal and Muscle are currently available for MS Windows platform. - -

-

JABAWS comes with pre-compiled MS Windows and Linux IA32 binaries and contains all the binaries sources.

-

To run JABAWS on the cluster you must have shared disk space accessible from all cluster nodes.

-

Installing the JABAWS WAR file

-

JABAWS is distributed as a web application archive (WAR). To -deploy JABAWS in Apache-Tomcat - simply drop the war file into the -webapps directory of a running -Tomcat, and it will do the rest. If you used this deployment procedure, do not remove jabaws war file, otherwise Tomcat will undeploy your application!

-

For any other web application - server, please follow your server's specific deployment procedure - for 'WAR' files. If you install JABAWS on a MS Windows machine, then - at this point your JABAWS installation will already be up and - running, and you can try its services out as described here. If you install JABAWS on Linux you will need to set an executable flag for binaries. This is described here. If your host operating system is different from Windows or Linux then read on.

-

Preparing executables for use with JABAWS

- -

JABAWS's web services use command line programs to do -the actual analysis, so it must have access to programs -which can be executed on your platform. The native executables -bundled with JABAWS for Windows (32-bit) and Linux (i386, 32-bit) should be -OK for those systems. The source code for these -programs is also provided so you can recompile for your own -architecture and exploit any optimizations that your system can -provide. Alternately, if you have already got binaries on your -system, then you can simply change the paths in JABAWS's -configuration files so these are used instead.

- -

Using the pre-compiled i386 binaries on Linux

- -

Before the binaries that are bundled with JABAWS can be used, -they must first be made executable using the provided 'setexecflag.sh' script:

- -
    -
  1. cd to <webapplicationpath>/binaries/src
  2. - -
  3. run sh setexecflag.sh
  4. - -
  5. Make sure binaries supplied work under your OS.
    - For this run each binary, without any command line options or -input files. If you see an error message complaining about missing -libraries or other problems, then you probably need to recompile the binaries. with
  6. - -
  7. Restart the Tomcat.
  8. -
- -That's it! JABAWS should work at this point. Try it out using the JABAWS test client. If not, -read on... or have a look at deploying on Tomcat tips.
- Note: You may want to enable logging, as described here.
- - -

Recompiling the bundled -programs for your system

- -

If you have a fully equipped build environment on your -(POSIX-like) system, then you should be able to recompile the -programs from the source distributions which are included -in the JABAWS war file. A script called 'compilebin.sh' is provided -to automate this task.

- -
    -
  1. In a terminal window, change the working directory to binaries/src
  2. - -
  3. execute the compilebin.sh -script,
    - either use: chmod +x compilebin.sh; -compilebin.sh > compilebin.out;
    - or: sh compilebin.sh > -compilebin.out
  4. - -
  5. Now run sh setexecflag.sh
    - If any of the binaries was not recompiled, then a 'file not found' -error will be raised.
  6. - -
  7. Finally, restart your Tomcat server (or JABAWS application only), and test JABAWS to -check that it can use the new binaries.
  8. -
- -

If you couldn't compile everything, then it may be that your system does -not have all the tools required for compiling the programs. At the very -least check that you have gcc, g++ and make installed in your -system. If not install these packages and repeat the compilation -steps again. You should also review the compilebin.sh output - -which was redirected to compilebin.out, and any errors output to -the terminal. Finally, try obtaining the pre -compiled binaries for your OS.

- -

Reuse the binaries that are -already in your system

- -

If you would like to use the binaries you already have then you -just need to let JABAWS know there they are. To do this, edit: -conf/Executable.properties

-

When specifying paths to executables that already exist on your system, make sure you provide an absolute path, or one relative to the JABAWS directory inside webapps. For example, the default path for clustalw is defined -aslocal.clustalw.bin=binaries/src/clustalw/src/clustalw2 -Alternatively, instead of changing Executable.properties you could also replace -the executables bundled with JABAWS with the ones that you have, or make symbolic links to them. -Then the default configuration will work for you. More information -about the -Executable.properties file is given in the JABAWS Configuration chapter.

- -

Obtaining alignment -programs for your operating system

- -

You could search for pre-packaged compiled executable in your -system package repository or alternately, download pre-compiled -binaries from each alignment program's home page. Then, either -replace the executables supplied with the downloaded ones, or -modify the paths in executable.properties as described above. Below are some suggestions on where you may be able to get the binaries for your system.

- -

Testing JABAWS Server

-

First of all make sure that Tomcat server is started successfully. If this was the case, then you should see JABAWS home page when you navigate to your Tomcat JABAWS context path e.g. http://myhost.compbio.ac.uk:8080/jabawsIf you see it, then it is time to make sure that web services are working too. Assuming that you have unpacked/deployed JABAWS from the server war file, you should be able to navigate to the test program which can be found in <webapplicationpath>/WEB-INF/lib/jabaws-client.jar file. To run the tests type: java -jar jabaws-client.jar -h=<Your web application server host name, port and JABAWS context path>

-

For example to test all JABAWS web services on host myhost.compbio.ac.uk type:

-

java -jar jabaws-client.jar -h=http://myhost.compbio.ac.uk:8080/jabaws

-

You can choose a particular web server using -s option like this java -jar jabaws-client.jar -h=http://myhost.compbio.ac.uk:8080/jabaws -s=ClustalWS This command line assumes that java executable is in your path and jabaws-client.jar is located in the current directory.

-

An example of the report testing tool produces for operating web service looks like this:

-

Connecting to service MuscleWS on http://myhost.compbio.ac.uk:8080/jabaws ... OK
- Testing alignment with default parameters:
- Queering job status...OK
- Retrieving results...OK
- Testing alignment with presets:
- Aligning with preset 'Protein alignment(Fastest speed)'... OK
- Aligning with preset 'Nucleotide alignment(Fastest speed)'... OK
- Aligning with preset 'Huge alignments (speed-oriented)'... OK
- Queering presets...OK
- Queering Parameters...OK
- Queering Limits...OK
- Queering Local Engine Limits...OK
- Check is completed service MuscleWS IS WORKING
An example of the response of a web service which is deployed but is not operating is below:

-

Connecting to service ProbconsWS on http://localhost:8080/ws ... OK
- Testing alignment with default parameters:FAILED
- Service ProbconsWS IS NOT FUNCTIONAL
If the web server did not respond the message looks like following: Connecting to service TcoffeeWS on http://localhost:8080/ws ... FAILED

-

Running many JABAWS instances on the same server

-

JABAWS is supplied as a Web Application aRchive which can be dealt with as any other web applications. So it is perfectly possible to run two JABAWS instances from the same server. Just make two different contexts on your application server and unpack JABAWS in both of them. For example if your server name is http://www.align.ac.uk, and the context names are public and private. Than one group of users could be given a URL http://www.align.ac.uk/public and another http://www.align.ac.uk/private. These contexts will be served by two independent JABAWS instances, and could be configured differently. If you keep local engine enabled, make sure you reduce the number of threads local engine is allowed to use to avoid overloading the server. Alternatively two completely separate web application server instances (e.g. Apache-Tomcat) could be used. This will give you a better resilience and more flexibility in memory settings.

-

JABAWS on a single server

-

You can run JABAWS on a single server. Obviously the capacity will be limited, but may be sufficient for a small lab. Installed on a single server, JABAWS executes tasks in parallel, so the more cores the server has the more requests it will be able to handle.

-

JABAWS supported cluster batch management systems

-

JABAWS uses DRMAA v. 1.0 library to send and manage jobs on the cluster. DRMAA supports many different cluster job management systems. Namely Sun Grid Engine, Condor, PBS, GridWay, Globus 2/4, PBSPro, LSF. For up to date information please consult DRMAA web site. We found that DRMAA implementation differ from platform to platform and were trying to use only the basic functions. We have only tested JABAWS on Sun Grid Engine v 6.2. Please let use know if you have any experience of running JABAWS on other platforms.

-

Manually deploying JABAWS application on Apache-Tomcat

-

To stop Tomcat from automatically undeploying your application if the war file is removed use an explicit application descriptor. It could come in different flavors, the one I prefer if to drop a context descriptor file into <tomcatRoot>conf/Catalina/localhost directory. Name your context file the same as your application folder e.g. if you JABAWS resides in webappl/jabaws folder, then call the context file jabaws.xml. Below is an example of content this file might have.

-

<?xml version="1.0" encoding="UTF-8"?>
- <Context antiResourceLocking="false" privileged="true" />

-

This should be sufficient to prevent Tomcat from removing your JABAWS from WEBAPPS. For more information about the Tomcat deployer read this documentation on the Apache-Tomcat web site.

-

Apache-Tomcat fails to deploy jaba.war file

-
    -
  • Make sure Tomcat have sufficient access rights to read your war file.
  • -
  • Restart the Tomcat, sometimes it will not since that the new war file is added without restart
  • -
  • If Tomcat still refuses to unpack the war file, unpack it manually into web application folder (the war file is just a zip archive). Restart the Tomcat.
  • -
-
- - - -
- - -
- - - - - - - - diff --git a/website/manual.html b/website/manual.html deleted file mode 100644 index a012c5a..0000000 --- a/website/manual.html +++ /dev/null @@ -1,116 +0,0 @@ - - - - -Java Bioinformatics Analyses Web Services (JABAWS) manual - getting started - - - - - - -
- -
- - -
- -

JABAWS MANUAL

-

Quick Start Guide

- -

Choose JABAWS distribution

-

There are three main packages you could use

-
    -
  1. A JABAWS Server Virtual Appliance (or Virtual Machine) - for anyone who wants to run JABAWS locally for themselves
  2. -
  3. A JABAWS Server Web Application Archive (WAR) package - for anyone who wants to run JABAWS for their group, lab or organization. Wants to use the cluster or perform very large tasks
  4. -
  5. A client package - for anyone who wants to use JABAWS from their own code, without Jalview, scripting against local or public version of JABAWS Server.
  6. -
-

Virtual Appliance (VA) package (1) contains TurnKey Linux with JABAWS installed. JABAWS VA contains JABAWS WAR deployed on the Apache Tomcat 6 web application server. If you use MS Windows read no further - the VA is the way to go. You would need to install VMWare Player or Oracle VirtualBox (both are free) on your computer to use this package. More details about JABAWS virtual appliance is available from the Server VA section of the manual.

-

Option 2, Web Application Archive package contains JABAWS ready to be deployed on the Servlet 2.4 compatible web application server such as Apache Tomcat version 6. To make this version work you would need

-
    -
  1. Install Apache-Tomcat or similar web application server.
  2. -
  3. If you are not on Linux, you would have to make binaries for your system available to JABAWS.
  4. -
-

Read more on JABAWS WAR in the manual.

-

A client only package (3) contains the JABAWS command line client. It functionality is equivalent to that of Jalview . This is the package for anyone who wants to connect to and to use JABAWS from their own software. Read more about how to use command line client in the CMD Client section of the manual. Also, JABA Web Services are fully WS-I compliant, so one could use any language to access them.

-

If you chose option 1

-

and you work on Windows or Linux or Unix

-
    -
  • download and install VMWare Player
  • -
  • Download JABAWS Virtual Appliance
  • -
  • Unpack JABAWS virtual appliance and open it with VMware Player.
  • -
-

otherwise

-
    -
  • download and install Virtual Box.
  • -
  • Download JABAWS Virtual Appliance
  • -
  • Unpack JABAWS virtual appliance, import it into VirtualBox and then start the appliance.
  • -
-

If you chose option 2

-

If you are on Linux or Windows

-
  1. Download JABAWS WAR
  2. -
  3. Download and install Apache-Tomcat
  4. -
  5. Drop the JABAWS war file into tomcat/webapps directory.
  6. -
  7. If you are on Linux, cd to webapps/jabaws/binaries/src/ and execute ./setexecflag.sh script to set an executable flag for JABAWS binaries.
  8. -
  9. Restart the Tomcat
  10. -
-

otherwise

-
    -
  • Complete steps 1-3 from the above.
  • -
  • cd to webapps/jabaws/binaries/src/ and execute ./compilebin.sh script to compile all binaries JABAWS depends on.
  • -
  • cd to webapps/jabaws/binaries/src/ and execute ./setexecflag.sh script.
  • -
  • Restart the Tomcat
  • -
-

Once you have JABAWS working you can point the Jalview to your local JABAWS.

-
    -
  • Download and start the desktop version of Jalview
  • -
  • Go to Jalview->Tools->Preferences->Webservices->New Service URL and enter the JABAWS URL which you can see one your appliance is booted up.
  • -
-

if you chose option 3

-

You can use the client straight out of the box.

-
- -
- - -
- - - - - - - - diff --git a/website/print.css b/website/print.css deleted file mode 100644 index 4f6e7b8..0000000 --- a/website/print.css +++ /dev/null @@ -1,188 +0,0 @@ - -#banner { background:none !important; color:#000000 !important; text-align:center; } - -#panel { display:none !important } - -#content { margin:0.5em; border-bottom:solid 1px #6994af; } - -#page { margin: 0.5em; } - -#wrapper { background:none; } - -ul { - list-style-type: circle; -} - - -#panel a:link, a:visited { - text-decoration: none; - display:block; - line-height: 1em; - padding:10px; - color:#000000; - text-decoration:none; - } - -#panel a:hover { - background-color: transparent; - text-decoration: underline; - } - - -strong { - font-weight:bold; - color:#003366; -} - -pre { - font-family:Arial, Helvetica, sans-serif; -} - -p { - line-height: 1.4em; -} - -.hightlight { -font-style:italic; -font-family:"Courier New", Courier, monospace; -} - -.code { - font-size-adjust:0.4; - color:black; - background-color:#F5F5F5; - font-family:"Courier New",Courier,monospace; - font-style:normal; - margin:1em 0; - padding: 0.5em; - border: 1px dashed black; -} - - -.box { - font-size-adjust:0.5; - color:black; - background-color:#F5F5F5; - font-family:Arial, Helvetica, sans-serif; - font-style:normal; - margin:1em 0; - padding: 0.5em; - border: 1px solid black; - display:block; -} - -.u { text-decoration: underline; } -.headeru { text-shadow: black 0.05em 0.05em 0.01em ;} - -/* Table styles */ -table { - border-collapse: collapse; - border: 1px solid #666; - margin: 20px 0 20px 0; - width: 100%; -} -th, td { - margin: 2px 4px 2px 4px; - padding: 0 5px; - text-align: left; - vertical-align: top; - border: 1px solid #666; -} - -table caption { - font: 1.5em Georgia, "Times New Roman", Times, serif; - padding: 1em; - background-color: #9c9; -} - -.mainheader { - font: 1.5em Georgia, "Times New Roman", Times, serif; - background-color: #9c9; - text-align:center; - line-height:1em; -} - -tr { - background-color: #eee; -} - -tr:nth-child(odd) { - background-color: #ccc; -} - - -span.directory { -background: transparent url(images/dir.gif) no-repeat scroll left center; -color:#666666; -font-family:"Courier New",Courier,monospace; -font-style:normal; -padding:0 0 0 15px; -} - -.attention { -color:#993333; -} - -.source { - border:1px solid #858789; - display:block; - margin:26px 0; - overflow:visible; -} - -/* OPEN state styles */ -.source .body { - background:#F5F5F5 none repeat scroll right 0; - color:#434546; - padding:7px 15px; -/* white-space:pre-wrap; */ - word-wrap:break-word; -} - -.source .header { - background:#E9EAEC url(images/minus.png) no-repeat scroll 98% center; - color:#3B3D3F; - cursor:pointer; - font-weight:bold; - height:30px; - line-height:30px; - padding:0 0 0 15px; -} - -/* CLOSED state styles */ -.source .body.collapsed { - display:block !important; -} - -.source .header.collapsed { - background:#E9EAEC url(images/plus.png) no-repeat scroll 98% center; - padding:0 15px 0 15px; -} - -#copyright { text-align:right; - color:#999999; - font-family:Verdana, Arial, Helvetica, sans-serif; - font-size:smaller; - line-height:1em; - } - -.body .code { - margin:0; - padding:0; - border:0; - font-family:"Courier New",Courier,monospace; - font-style:normal; -} - -body { - font-family:Arial, Helvetica, sans-serif; - font-size: 9pt; - background-color: white; - line-height: 2em; -} - -h3 {border-bottom: 1px solid grey; margin-top: 2em; } - -#headtitle { margin:0; text-align:center; color:#003b62; font-weight:600;} - -h2 {margin:1.8em 0 0 0; color:#003b62; font-weight:600;} diff --git a/website/prototype-1.6.0.3.js b/website/prototype-1.6.0.3.js deleted file mode 100644 index dfe8ab4..0000000 --- a/website/prototype-1.6.0.3.js +++ /dev/null @@ -1,4320 +0,0 @@ -/* Prototype JavaScript framework, version 1.6.0.3 - * (c) 2005-2008 Sam Stephenson - * - * Prototype is freely distributable under the terms of an MIT-style license. - * For details, see the Prototype web site: http://www.prototypejs.org/ - * - *--------------------------------------------------------------------------*/ - -var Prototype = { - Version: '1.6.0.3', - - Browser: { - IE: !!(window.attachEvent && - navigator.userAgent.indexOf('Opera') === -1), - Opera: navigator.userAgent.indexOf('Opera') > -1, - WebKit: navigator.userAgent.indexOf('AppleWebKit/') > -1, - Gecko: navigator.userAgent.indexOf('Gecko') > -1 && - navigator.userAgent.indexOf('KHTML') === -1, - MobileSafari: !!navigator.userAgent.match(/Apple.*Mobile.*Safari/) - }, - - BrowserFeatures: { - XPath: !!document.evaluate, - SelectorsAPI: !!document.querySelector, - ElementExtensions: !!window.HTMLElement, - SpecificElementExtensions: - document.createElement('div')['__proto__'] && - document.createElement('div')['__proto__'] !== - document.createElement('form')['__proto__'] - }, - - ScriptFragment: ']*>([\\S\\s]*?)<\/script>', - JSONFilter: /^\/\*-secure-([\s\S]*)\*\/\s*$/, - - emptyFunction: function() { }, - K: function(x) { return x } -}; - -if (Prototype.Browser.MobileSafari) - Prototype.BrowserFeatures.SpecificElementExtensions = false; - - -/* Based on Alex Arnell's inheritance implementation. */ -var Class = { - create: function() { - var parent = null, properties = $A(arguments); - if (Object.isFunction(properties[0])) - parent = properties.shift(); - - function klass() { - this.initialize.apply(this, arguments); - } - - Object.extend(klass, Class.Methods); - klass.superclass = parent; - klass.subclasses = []; - - if (parent) { - var subclass = function() { }; - subclass.prototype = parent.prototype; - klass.prototype = new subclass; - parent.subclasses.push(klass); - } - - for (var i = 0; i < properties.length; i++) - klass.addMethods(properties[i]); - - if (!klass.prototype.initialize) - klass.prototype.initialize = Prototype.emptyFunction; - - klass.prototype.constructor = klass; - - return klass; - } -}; - -Class.Methods = { - addMethods: function(source) { - var ancestor = this.superclass && this.superclass.prototype; - var properties = Object.keys(source); - - if (!Object.keys({ toString: true }).length) - properties.push("toString", "valueOf"); - - for (var i = 0, length = properties.length; i < length; i++) { - var property = properties[i], value = source[property]; - if (ancestor && Object.isFunction(value) && - value.argumentNames().first() == "$super") { - var method = value; - value = (function(m) { - return function() { return ancestor[m].apply(this, arguments) }; - })(property).wrap(method); - - value.valueOf = method.valueOf.bind(method); - value.toString = method.toString.bind(method); - } - this.prototype[property] = value; - } - - return this; - } -}; - -var Abstract = { }; - -Object.extend = function(destination, source) { - for (var property in source) - destination[property] = source[property]; - return destination; -}; - -Object.extend(Object, { - inspect: function(object) { - try { - if (Object.isUndefined(object)) return 'undefined'; - if (object === null) return 'null'; - return object.inspect ? object.inspect() : String(object); - } catch (e) { - if (e instanceof RangeError) return '...'; - throw e; - } - }, - - toJSON: function(object) { - var type = typeof object; - switch (type) { - case 'undefined': - case 'function': - case 'unknown': return; - case 'boolean': return object.toString(); - } - - if (object === null) return 'null'; - if (object.toJSON) return object.toJSON(); - if (Object.isElement(object)) return; - - var results = []; - for (var property in object) { - var value = Object.toJSON(object[property]); - if (!Object.isUndefined(value)) - results.push(property.toJSON() + ': ' + value); - } - - return '{' + results.join(', ') + '}'; - }, - - toQueryString: function(object) { - return $H(object).toQueryString(); - }, - - toHTML: function(object) { - return object && object.toHTML ? object.toHTML() : String.interpret(object); - }, - - keys: function(object) { - var keys = []; - for (var property in object) - keys.push(property); - return keys; - }, - - values: function(object) { - var values = []; - for (var property in object) - values.push(object[property]); - return values; - }, - - clone: function(object) { - return Object.extend({ }, object); - }, - - isElement: function(object) { - return !!(object && object.nodeType == 1); - }, - - isArray: function(object) { - return object != null && typeof object == "object" && - 'splice' in object && 'join' in object; - }, - - isHash: function(object) { - return object instanceof Hash; - }, - - isFunction: function(object) { - return typeof object == "function"; - }, - - isString: function(object) { - return typeof object == "string"; - }, - - isNumber: function(object) { - return typeof object == "number"; - }, - - isUndefined: function(object) { - return typeof object == "undefined"; - } -}); - -Object.extend(Function.prototype, { - argumentNames: function() { - var names = this.toString().match(/^[\s\(]*function[^(]*\(([^\)]*)\)/)[1] - .replace(/\s+/g, '').split(','); - return names.length == 1 && !names[0] ? [] : names; - }, - - bind: function() { - if (arguments.length < 2 && Object.isUndefined(arguments[0])) return this; - var __method = this, args = $A(arguments), object = args.shift(); - return function() { - return __method.apply(object, args.concat($A(arguments))); - } - }, - - bindAsEventListener: function() { - var __method = this, args = $A(arguments), object = args.shift(); - return function(event) { - return __method.apply(object, [event || window.event].concat(args)); - } - }, - - curry: function() { - if (!arguments.length) return this; - var __method = this, args = $A(arguments); - return function() { - return __method.apply(this, args.concat($A(arguments))); - } - }, - - delay: function() { - var __method = this, args = $A(arguments), timeout = args.shift() * 1000; - return window.setTimeout(function() { - return __method.apply(__method, args); - }, timeout); - }, - - defer: function() { - var args = [0.01].concat($A(arguments)); - return this.delay.apply(this, args); - }, - - wrap: function(wrapper) { - var __method = this; - return function() { - return wrapper.apply(this, [__method.bind(this)].concat($A(arguments))); - } - }, - - methodize: function() { - if (this._methodized) return this._methodized; - var __method = this; - return this._methodized = function() { - return __method.apply(null, [this].concat($A(arguments))); - }; - } -}); - -Date.prototype.toJSON = function() { - return '"' + this.getUTCFullYear() + '-' + - (this.getUTCMonth() + 1).toPaddedString(2) + '-' + - this.getUTCDate().toPaddedString(2) + 'T' + - this.getUTCHours().toPaddedString(2) + ':' + - this.getUTCMinutes().toPaddedString(2) + ':' + - this.getUTCSeconds().toPaddedString(2) + 'Z"'; -}; - -var Try = { - these: function() { - var returnValue; - - for (var i = 0, length = arguments.length; i < length; i++) { - var lambda = arguments[i]; - try { - returnValue = lambda(); - break; - } catch (e) { } - } - - return returnValue; - } -}; - -RegExp.prototype.match = RegExp.prototype.test; - -RegExp.escape = function(str) { - return String(str).replace(/([.*+?^=!:${}()|[\]\/\\])/g, '\\$1'); -}; - -/*--------------------------------------------------------------------------*/ - -var PeriodicalExecuter = Class.create({ - initialize: function(callback, frequency) { - this.callback = callback; - this.frequency = frequency; - this.currentlyExecuting = false; - - this.registerCallback(); - }, - - registerCallback: function() { - this.timer = setInterval(this.onTimerEvent.bind(this), this.frequency * 1000); - }, - - execute: function() { - this.callback(this); - }, - - stop: function() { - if (!this.timer) return; - clearInterval(this.timer); - this.timer = null; - }, - - onTimerEvent: function() { - if (!this.currentlyExecuting) { - try { - this.currentlyExecuting = true; - this.execute(); - } finally { - this.currentlyExecuting = false; - } - } - } -}); -Object.extend(String, { - interpret: function(value) { - return value == null ? '' : String(value); - }, - specialChar: { - '\b': '\\b', - '\t': '\\t', - '\n': '\\n', - '\f': '\\f', - '\r': '\\r', - '\\': '\\\\' - } -}); - -Object.extend(String.prototype, { - gsub: function(pattern, replacement) { - var result = '', source = this, match; - replacement = arguments.callee.prepareReplacement(replacement); - - while (source.length > 0) { - if (match = source.match(pattern)) { - result += source.slice(0, match.index); - result += String.interpret(replacement(match)); - source = source.slice(match.index + match[0].length); - } else { - result += source, source = ''; - } - } - return result; - }, - - sub: function(pattern, replacement, count) { - replacement = this.gsub.prepareReplacement(replacement); - count = Object.isUndefined(count) ? 1 : count; - - return this.gsub(pattern, function(match) { - if (--count < 0) return match[0]; - return replacement(match); - }); - }, - - scan: function(pattern, iterator) { - this.gsub(pattern, iterator); - return String(this); - }, - - truncate: function(length, truncation) { - length = length || 30; - truncation = Object.isUndefined(truncation) ? '...' : truncation; - return this.length > length ? - this.slice(0, length - truncation.length) + truncation : String(this); - }, - - strip: function() { - return this.replace(/^\s+/, '').replace(/\s+$/, ''); - }, - - stripTags: function() { - return this.replace(/<\/?[^>]+>/gi, ''); - }, - - stripScripts: function() { - return this.replace(new RegExp(Prototype.ScriptFragment, 'img'), ''); - }, - - extractScripts: function() { - var matchAll = new RegExp(Prototype.ScriptFragment, 'img'); - var matchOne = new RegExp(Prototype.ScriptFragment, 'im'); - return (this.match(matchAll) || []).map(function(scriptTag) { - return (scriptTag.match(matchOne) || ['', ''])[1]; - }); - }, - - evalScripts: function() { - return this.extractScripts().map(function(script) { return eval(script) }); - }, - - escapeHTML: function() { - var self = arguments.callee; - self.text.data = this; - return self.div.innerHTML; - }, - - unescapeHTML: function() { - var div = new Element('div'); - div.innerHTML = this.stripTags(); - return div.childNodes[0] ? (div.childNodes.length > 1 ? - $A(div.childNodes).inject('', function(memo, node) { return memo+node.nodeValue }) : - div.childNodes[0].nodeValue) : ''; - }, - - toQueryParams: function(separator) { - var match = this.strip().match(/([^?#]*)(#.*)?$/); - if (!match) return { }; - - return match[1].split(separator || '&').inject({ }, function(hash, pair) { - if ((pair = pair.split('='))[0]) { - var key = decodeURIComponent(pair.shift()); - var value = pair.length > 1 ? pair.join('=') : pair[0]; - if (value != undefined) value = decodeURIComponent(value); - - if (key in hash) { - if (!Object.isArray(hash[key])) hash[key] = [hash[key]]; - hash[key].push(value); - } - else hash[key] = value; - } - return hash; - }); - }, - - toArray: function() { - return this.split(''); - }, - - succ: function() { - return this.slice(0, this.length - 1) + - String.fromCharCode(this.charCodeAt(this.length - 1) + 1); - }, - - times: function(count) { - return count < 1 ? '' : new Array(count + 1).join(this); - }, - - camelize: function() { - var parts = this.split('-'), len = parts.length; - if (len == 1) return parts[0]; - - var camelized = this.charAt(0) == '-' - ? parts[0].charAt(0).toUpperCase() + parts[0].substring(1) - : parts[0]; - - for (var i = 1; i < len; i++) - camelized += parts[i].charAt(0).toUpperCase() + parts[i].substring(1); - - return camelized; - }, - - capitalize: function() { - return this.charAt(0).toUpperCase() + this.substring(1).toLowerCase(); - }, - - underscore: function() { - return this.gsub(/::/, '/').gsub(/([A-Z]+)([A-Z][a-z])/,'#{1}_#{2}').gsub(/([a-z\d])([A-Z])/,'#{1}_#{2}').gsub(/-/,'_').toLowerCase(); - }, - - dasherize: function() { - return this.gsub(/_/,'-'); - }, - - inspect: function(useDoubleQuotes) { - var escapedString = this.gsub(/[\x00-\x1f\\]/, function(match) { - var character = String.specialChar[match[0]]; - return character ? character : '\\u00' + match[0].charCodeAt().toPaddedString(2, 16); - }); - if (useDoubleQuotes) return '"' + escapedString.replace(/"/g, '\\"') + '"'; - return "'" + escapedString.replace(/'/g, '\\\'') + "'"; - }, - - toJSON: function() { - return this.inspect(true); - }, - - unfilterJSON: function(filter) { - return this.sub(filter || Prototype.JSONFilter, '#{1}'); - }, - - isJSON: function() { - var str = this; - if (str.blank()) return false; - str = this.replace(/\\./g, '@').replace(/"[^"\\\n\r]*"/g, ''); - return (/^[,:{}\[\]0-9.\-+Eaeflnr-u \n\r\t]*$/).test(str); - }, - - evalJSON: function(sanitize) { - var json = this.unfilterJSON(); - try { - if (!sanitize || json.isJSON()) return eval('(' + json + ')'); - } catch (e) { } - throw new SyntaxError('Badly formed JSON string: ' + this.inspect()); - }, - - include: function(pattern) { - return this.indexOf(pattern) > -1; - }, - - startsWith: function(pattern) { - return this.indexOf(pattern) === 0; - }, - - endsWith: function(pattern) { - var d = this.length - pattern.length; - return d >= 0 && this.lastIndexOf(pattern) === d; - }, - - empty: function() { - return this == ''; - }, - - blank: function() { - return /^\s*$/.test(this); - }, - - interpolate: function(object, pattern) { - return new Template(this, pattern).evaluate(object); - } -}); - -if (Prototype.Browser.WebKit || Prototype.Browser.IE) Object.extend(String.prototype, { - escapeHTML: function() { - return this.replace(/&/g,'&').replace(//g,'>'); - }, - unescapeHTML: function() { - return this.stripTags().replace(/&/g,'&').replace(/</g,'<').replace(/>/g,'>'); - } -}); - -String.prototype.gsub.prepareReplacement = function(replacement) { - if (Object.isFunction(replacement)) return replacement; - var template = new Template(replacement); - return function(match) { return template.evaluate(match) }; -}; - -String.prototype.parseQuery = String.prototype.toQueryParams; - -Object.extend(String.prototype.escapeHTML, { - div: document.createElement('div'), - text: document.createTextNode('') -}); - -String.prototype.escapeHTML.div.appendChild(String.prototype.escapeHTML.text); - -var Template = Class.create({ - initialize: function(template, pattern) { - this.template = template.toString(); - this.pattern = pattern || Template.Pattern; - }, - - evaluate: function(object) { - if (Object.isFunction(object.toTemplateReplacements)) - object = object.toTemplateReplacements(); - - return this.template.gsub(this.pattern, function(match) { - if (object == null) return ''; - - var before = match[1] || ''; - if (before == '\\') return match[2]; - - var ctx = object, expr = match[3]; - var pattern = /^([^.[]+|\[((?:.*?[^\\])?)\])(\.|\[|$)/; - match = pattern.exec(expr); - if (match == null) return before; - - while (match != null) { - var comp = match[1].startsWith('[') ? match[2].gsub('\\\\]', ']') : match[1]; - ctx = ctx[comp]; - if (null == ctx || '' == match[3]) break; - expr = expr.substring('[' == match[3] ? match[1].length : match[0].length); - match = pattern.exec(expr); - } - - return before + String.interpret(ctx); - }); - } -}); -Template.Pattern = /(^|.|\r|\n)(#\{(.*?)\})/; - -var $break = { }; - -var Enumerable = { - each: function(iterator, context) { - var index = 0; - try { - this._each(function(value) { - iterator.call(context, value, index++); - }); - } catch (e) { - if (e != $break) throw e; - } - return this; - }, - - eachSlice: function(number, iterator, context) { - var index = -number, slices = [], array = this.toArray(); - if (number < 1) return array; - while ((index += number) < array.length) - slices.push(array.slice(index, index+number)); - return slices.collect(iterator, context); - }, - - all: function(iterator, context) { - iterator = iterator || Prototype.K; - var result = true; - this.each(function(value, index) { - result = result && !!iterator.call(context, value, index); - if (!result) throw $break; - }); - return result; - }, - - any: function(iterator, context) { - iterator = iterator || Prototype.K; - var result = false; - this.each(function(value, index) { - if (result = !!iterator.call(context, value, index)) - throw $break; - }); - return result; - }, - - collect: function(iterator, context) { - iterator = iterator || Prototype.K; - var results = []; - this.each(function(value, index) { - results.push(iterator.call(context, value, index)); - }); - return results; - }, - - detect: function(iterator, context) { - var result; - this.each(function(value, index) { - if (iterator.call(context, value, index)) { - result = value; - throw $break; - } - }); - return result; - }, - - findAll: function(iterator, context) { - var results = []; - this.each(function(value, index) { - if (iterator.call(context, value, index)) - results.push(value); - }); - return results; - }, - - grep: function(filter, iterator, context) { - iterator = iterator || Prototype.K; - var results = []; - - if (Object.isString(filter)) - filter = new RegExp(filter); - - this.each(function(value, index) { - if (filter.match(value)) - results.push(iterator.call(context, value, index)); - }); - return results; - }, - - include: function(object) { - if (Object.isFunction(this.indexOf)) - if (this.indexOf(object) != -1) return true; - - var found = false; - this.each(function(value) { - if (value == object) { - found = true; - throw $break; - } - }); - return found; - }, - - inGroupsOf: function(number, fillWith) { - fillWith = Object.isUndefined(fillWith) ? null : fillWith; - return this.eachSlice(number, function(slice) { - while(slice.length < number) slice.push(fillWith); - return slice; - }); - }, - - inject: function(memo, iterator, context) { - this.each(function(value, index) { - memo = iterator.call(context, memo, value, index); - }); - return memo; - }, - - invoke: function(method) { - var args = $A(arguments).slice(1); - return this.map(function(value) { - return value[method].apply(value, args); - }); - }, - - max: function(iterator, context) { - iterator = iterator || Prototype.K; - var result; - this.each(function(value, index) { - value = iterator.call(context, value, index); - if (result == null || value >= result) - result = value; - }); - return result; - }, - - min: function(iterator, context) { - iterator = iterator || Prototype.K; - var result; - this.each(function(value, index) { - value = iterator.call(context, value, index); - if (result == null || value < result) - result = value; - }); - return result; - }, - - partition: function(iterator, context) { - iterator = iterator || Prototype.K; - var trues = [], falses = []; - this.each(function(value, index) { - (iterator.call(context, value, index) ? - trues : falses).push(value); - }); - return [trues, falses]; - }, - - pluck: function(property) { - var results = []; - this.each(function(value) { - results.push(value[property]); - }); - return results; - }, - - reject: function(iterator, context) { - var results = []; - this.each(function(value, index) { - if (!iterator.call(context, value, index)) - results.push(value); - }); - return results; - }, - - sortBy: function(iterator, context) { - return this.map(function(value, index) { - return { - value: value, - criteria: iterator.call(context, value, index) - }; - }).sort(function(left, right) { - var a = left.criteria, b = right.criteria; - return a < b ? -1 : a > b ? 1 : 0; - }).pluck('value'); - }, - - toArray: function() { - return this.map(); - }, - - zip: function() { - var iterator = Prototype.K, args = $A(arguments); - if (Object.isFunction(args.last())) - iterator = args.pop(); - - var collections = [this].concat(args).map($A); - return this.map(function(value, index) { - return iterator(collections.pluck(index)); - }); - }, - - size: function() { - return this.toArray().length; - }, - - inspect: function() { - return '#'; - } -}; - -Object.extend(Enumerable, { - map: Enumerable.collect, - find: Enumerable.detect, - select: Enumerable.findAll, - filter: Enumerable.findAll, - member: Enumerable.include, - entries: Enumerable.toArray, - every: Enumerable.all, - some: Enumerable.any -}); -function $A(iterable) { - if (!iterable) return []; - if (iterable.toArray) return iterable.toArray(); - var length = iterable.length || 0, results = new Array(length); - while (length--) results[length] = iterable[length]; - return results; -} - -if (Prototype.Browser.WebKit) { - $A = function(iterable) { - if (!iterable) return []; - // In Safari, only use the `toArray` method if it's not a NodeList. - // A NodeList is a function, has an function `item` property, and a numeric - // `length` property. Adapted from Google Doctype. - if (!(typeof iterable === 'function' && typeof iterable.length === - 'number' && typeof iterable.item === 'function') && iterable.toArray) - return iterable.toArray(); - var length = iterable.length || 0, results = new Array(length); - while (length--) results[length] = iterable[length]; - return results; - }; -} - -Array.from = $A; - -Object.extend(Array.prototype, Enumerable); - -if (!Array.prototype._reverse) Array.prototype._reverse = Array.prototype.reverse; - -Object.extend(Array.prototype, { - _each: function(iterator) { - for (var i = 0, length = this.length; i < length; i++) - iterator(this[i]); - }, - - clear: function() { - this.length = 0; - return this; - }, - - first: function() { - return this[0]; - }, - - last: function() { - return this[this.length - 1]; - }, - - compact: function() { - return this.select(function(value) { - return value != null; - }); - }, - - flatten: function() { - return this.inject([], function(array, value) { - return array.concat(Object.isArray(value) ? - value.flatten() : [value]); - }); - }, - - without: function() { - var values = $A(arguments); - return this.select(function(value) { - return !values.include(value); - }); - }, - - reverse: function(inline) { - return (inline !== false ? this : this.toArray())._reverse(); - }, - - reduce: function() { - return this.length > 1 ? this : this[0]; - }, - - uniq: function(sorted) { - return this.inject([], function(array, value, index) { - if (0 == index || (sorted ? array.last() != value : !array.include(value))) - array.push(value); - return array; - }); - }, - - intersect: function(array) { - return this.uniq().findAll(function(item) { - return array.detect(function(value) { return item === value }); - }); - }, - - clone: function() { - return [].concat(this); - }, - - size: function() { - return this.length; - }, - - inspect: function() { - return '[' + this.map(Object.inspect).join(', ') + ']'; - }, - - toJSON: function() { - var results = []; - this.each(function(object) { - var value = Object.toJSON(object); - if (!Object.isUndefined(value)) results.push(value); - }); - return '[' + results.join(', ') + ']'; - } -}); - -// use native browser JS 1.6 implementation if available -if (Object.isFunction(Array.prototype.forEach)) - Array.prototype._each = Array.prototype.forEach; - -if (!Array.prototype.indexOf) Array.prototype.indexOf = function(item, i) { - i || (i = 0); - var length = this.length; - if (i < 0) i = length + i; - for (; i < length; i++) - if (this[i] === item) return i; - return -1; -}; - -if (!Array.prototype.lastIndexOf) Array.prototype.lastIndexOf = function(item, i) { - i = isNaN(i) ? this.length : (i < 0 ? this.length + i : i) + 1; - var n = this.slice(0, i).reverse().indexOf(item); - return (n < 0) ? n : i - n - 1; -}; - -Array.prototype.toArray = Array.prototype.clone; - -function $w(string) { - if (!Object.isString(string)) return []; - string = string.strip(); - return string ? string.split(/\s+/) : []; -} - -if (Prototype.Browser.Opera){ - Array.prototype.concat = function() { - var array = []; - for (var i = 0, length = this.length; i < length; i++) array.push(this[i]); - for (var i = 0, length = arguments.length; i < length; i++) { - if (Object.isArray(arguments[i])) { - for (var j = 0, arrayLength = arguments[i].length; j < arrayLength; j++) - array.push(arguments[i][j]); - } else { - array.push(arguments[i]); - } - } - return array; - }; -} -Object.extend(Number.prototype, { - toColorPart: function() { - return this.toPaddedString(2, 16); - }, - - succ: function() { - return this + 1; - }, - - times: function(iterator, context) { - $R(0, this, true).each(iterator, context); - return this; - }, - - toPaddedString: function(length, radix) { - var string = this.toString(radix || 10); - return '0'.times(length - string.length) + string; - }, - - toJSON: function() { - return isFinite(this) ? this.toString() : 'null'; - } -}); - -$w('abs round ceil floor').each(function(method){ - Number.prototype[method] = Math[method].methodize(); -}); -function $H(object) { - return new Hash(object); -}; - -var Hash = Class.create(Enumerable, (function() { - - function toQueryPair(key, value) { - if (Object.isUndefined(value)) return key; - return key + '=' + encodeURIComponent(String.interpret(value)); - } - - return { - initialize: function(object) { - this._object = Object.isHash(object) ? object.toObject() : Object.clone(object); - }, - - _each: function(iterator) { - for (var key in this._object) { - var value = this._object[key], pair = [key, value]; - pair.key = key; - pair.value = value; - iterator(pair); - } - }, - - set: function(key, value) { - return this._object[key] = value; - }, - - get: function(key) { - // simulating poorly supported hasOwnProperty - if (this._object[key] !== Object.prototype[key]) - return this._object[key]; - }, - - unset: function(key) { - var value = this._object[key]; - delete this._object[key]; - return value; - }, - - toObject: function() { - return Object.clone(this._object); - }, - - keys: function() { - return this.pluck('key'); - }, - - values: function() { - return this.pluck('value'); - }, - - index: function(value) { - var match = this.detect(function(pair) { - return pair.value === value; - }); - return match && match.key; - }, - - merge: function(object) { - return this.clone().update(object); - }, - - update: function(object) { - return new Hash(object).inject(this, function(result, pair) { - result.set(pair.key, pair.value); - return result; - }); - }, - - toQueryString: function() { - return this.inject([], function(results, pair) { - var key = encodeURIComponent(pair.key), values = pair.value; - - if (values && typeof values == 'object') { - if (Object.isArray(values)) - return results.concat(values.map(toQueryPair.curry(key))); - } else results.push(toQueryPair(key, values)); - return results; - }).join('&'); - }, - - inspect: function() { - return '#'; - }, - - toJSON: function() { - return Object.toJSON(this.toObject()); - }, - - clone: function() { - return new Hash(this); - } - } -})()); - -Hash.prototype.toTemplateReplacements = Hash.prototype.toObject; -Hash.from = $H; -var ObjectRange = Class.create(Enumerable, { - initialize: function(start, end, exclusive) { - this.start = start; - this.end = end; - this.exclusive = exclusive; - }, - - _each: function(iterator) { - var value = this.start; - while (this.include(value)) { - iterator(value); - value = value.succ(); - } - }, - - include: function(value) { - if (value < this.start) - return false; - if (this.exclusive) - return value < this.end; - return value <= this.end; - } -}); - -var $R = function(start, end, exclusive) { - return new ObjectRange(start, end, exclusive); -}; - -var Ajax = { - getTransport: function() { - return Try.these( - function() {return new XMLHttpRequest()}, - function() {return new ActiveXObject('Msxml2.XMLHTTP')}, - function() {return new ActiveXObject('Microsoft.XMLHTTP')} - ) || false; - }, - - activeRequestCount: 0 -}; - -Ajax.Responders = { - responders: [], - - _each: function(iterator) { - this.responders._each(iterator); - }, - - register: function(responder) { - if (!this.include(responder)) - this.responders.push(responder); - }, - - unregister: function(responder) { - this.responders = this.responders.without(responder); - }, - - dispatch: function(callback, request, transport, json) { - this.each(function(responder) { - if (Object.isFunction(responder[callback])) { - try { - responder[callback].apply(responder, [request, transport, json]); - } catch (e) { } - } - }); - } -}; - -Object.extend(Ajax.Responders, Enumerable); - -Ajax.Responders.register({ - onCreate: function() { Ajax.activeRequestCount++ }, - onComplete: function() { Ajax.activeRequestCount-- } -}); - -Ajax.Base = Class.create({ - initialize: function(options) { - this.options = { - method: 'post', - asynchronous: true, - contentType: 'application/x-www-form-urlencoded', - encoding: 'UTF-8', - parameters: '', - evalJSON: true, - evalJS: true - }; - Object.extend(this.options, options || { }); - - this.options.method = this.options.method.toLowerCase(); - - if (Object.isString(this.options.parameters)) - this.options.parameters = this.options.parameters.toQueryParams(); - else if (Object.isHash(this.options.parameters)) - this.options.parameters = this.options.parameters.toObject(); - } -}); - -Ajax.Request = Class.create(Ajax.Base, { - _complete: false, - - initialize: function($super, url, options) { - $super(options); - this.transport = Ajax.getTransport(); - this.request(url); - }, - - request: function(url) { - this.url = url; - this.method = this.options.method; - var params = Object.clone(this.options.parameters); - - if (!['get', 'post'].include(this.method)) { - // simulate other verbs over post - params['_method'] = this.method; - this.method = 'post'; - } - - this.parameters = params; - - if (params = Object.toQueryString(params)) { - // when GET, append parameters to URL - if (this.method == 'get') - this.url += (this.url.include('?') ? '&' : '?') + params; - else if (/Konqueror|Safari|KHTML/.test(navigator.userAgent)) - params += '&_='; - } - - try { - var response = new Ajax.Response(this); - if (this.options.onCreate) this.options.onCreate(response); - Ajax.Responders.dispatch('onCreate', this, response); - - this.transport.open(this.method.toUpperCase(), this.url, - this.options.asynchronous); - - if (this.options.asynchronous) this.respondToReadyState.bind(this).defer(1); - - this.transport.onreadystatechange = this.onStateChange.bind(this); - this.setRequestHeaders(); - - this.body = this.method == 'post' ? (this.options.postBody || params) : null; - this.transport.send(this.body); - - /* Force Firefox to handle ready state 4 for synchronous requests */ - if (!this.options.asynchronous && this.transport.overrideMimeType) - this.onStateChange(); - - } - catch (e) { - this.dispatchException(e); - } - }, - - onStateChange: function() { - var readyState = this.transport.readyState; - if (readyState > 1 && !((readyState == 4) && this._complete)) - this.respondToReadyState(this.transport.readyState); - }, - - setRequestHeaders: function() { - var headers = { - 'X-Requested-With': 'XMLHttpRequest', - 'X-Prototype-Version': Prototype.Version, - 'Accept': 'text/javascript, text/html, application/xml, text/xml, */*' - }; - - if (this.method == 'post') { - headers['Content-type'] = this.options.contentType + - (this.options.encoding ? '; charset=' + this.options.encoding : ''); - - /* Force "Connection: close" for older Mozilla browsers to work - * around a bug where XMLHttpRequest sends an incorrect - * Content-length header. See Mozilla Bugzilla #246651. - */ - if (this.transport.overrideMimeType && - (navigator.userAgent.match(/Gecko\/(\d{4})/) || [0,2005])[1] < 2005) - headers['Connection'] = 'close'; - } - - // user-defined headers - if (typeof this.options.requestHeaders == 'object') { - var extras = this.options.requestHeaders; - - if (Object.isFunction(extras.push)) - for (var i = 0, length = extras.length; i < length; i += 2) - headers[extras[i]] = extras[i+1]; - else - $H(extras).each(function(pair) { headers[pair.key] = pair.value }); - } - - for (var name in headers) - this.transport.setRequestHeader(name, headers[name]); - }, - - success: function() { - var status = this.getStatus(); - return !status || (status >= 200 && status < 300); - }, - - getStatus: function() { - try { - return this.transport.status || 0; - } catch (e) { return 0 } - }, - - respondToReadyState: function(readyState) { - var state = Ajax.Request.Events[readyState], response = new Ajax.Response(this); - - if (state == 'Complete') { - try { - this._complete = true; - (this.options['on' + response.status] - || this.options['on' + (this.success() ? 'Success' : 'Failure')] - || Prototype.emptyFunction)(response, response.headerJSON); - } catch (e) { - this.dispatchException(e); - } - - var contentType = response.getHeader('Content-type'); - if (this.options.evalJS == 'force' - || (this.options.evalJS && this.isSameOrigin() && contentType - && contentType.match(/^\s*(text|application)\/(x-)?(java|ecma)script(;.*)?\s*$/i))) - this.evalResponse(); - } - - try { - (this.options['on' + state] || Prototype.emptyFunction)(response, response.headerJSON); - Ajax.Responders.dispatch('on' + state, this, response, response.headerJSON); - } catch (e) { - this.dispatchException(e); - } - - if (state == 'Complete') { - // avoid memory leak in MSIE: clean up - this.transport.onreadystatechange = Prototype.emptyFunction; - } - }, - - isSameOrigin: function() { - var m = this.url.match(/^\s*https?:\/\/[^\/]*/); - return !m || (m[0] == '#{protocol}//#{domain}#{port}'.interpolate({ - protocol: location.protocol, - domain: document.domain, - port: location.port ? ':' + location.port : '' - })); - }, - - getHeader: function(name) { - try { - return this.transport.getResponseHeader(name) || null; - } catch (e) { return null } - }, - - evalResponse: function() { - try { - return eval((this.transport.responseText || '').unfilterJSON()); - } catch (e) { - this.dispatchException(e); - } - }, - - dispatchException: function(exception) { - (this.options.onException || Prototype.emptyFunction)(this, exception); - Ajax.Responders.dispatch('onException', this, exception); - } -}); - -Ajax.Request.Events = - ['Uninitialized', 'Loading', 'Loaded', 'Interactive', 'Complete']; - -Ajax.Response = Class.create({ - initialize: function(request){ - this.request = request; - var transport = this.transport = request.transport, - readyState = this.readyState = transport.readyState; - - if((readyState > 2 && !Prototype.Browser.IE) || readyState == 4) { - this.status = this.getStatus(); - this.statusText = this.getStatusText(); - this.responseText = String.interpret(transport.responseText); - this.headerJSON = this._getHeaderJSON(); - } - - if(readyState == 4) { - var xml = transport.responseXML; - this.responseXML = Object.isUndefined(xml) ? null : xml; - this.responseJSON = this._getResponseJSON(); - } - }, - - status: 0, - statusText: '', - - getStatus: Ajax.Request.prototype.getStatus, - - getStatusText: function() { - try { - return this.transport.statusText || ''; - } catch (e) { return '' } - }, - - getHeader: Ajax.Request.prototype.getHeader, - - getAllHeaders: function() { - try { - return this.getAllResponseHeaders(); - } catch (e) { return null } - }, - - getResponseHeader: function(name) { - return this.transport.getResponseHeader(name); - }, - - getAllResponseHeaders: function() { - return this.transport.getAllResponseHeaders(); - }, - - _getHeaderJSON: function() { - var json = this.getHeader('X-JSON'); - if (!json) return null; - json = decodeURIComponent(escape(json)); - try { - return json.evalJSON(this.request.options.sanitizeJSON || - !this.request.isSameOrigin()); - } catch (e) { - this.request.dispatchException(e); - } - }, - - _getResponseJSON: function() { - var options = this.request.options; - if (!options.evalJSON || (options.evalJSON != 'force' && - !(this.getHeader('Content-type') || '').include('application/json')) || - this.responseText.blank()) - return null; - try { - return this.responseText.evalJSON(options.sanitizeJSON || - !this.request.isSameOrigin()); - } catch (e) { - this.request.dispatchException(e); - } - } -}); - -Ajax.Updater = Class.create(Ajax.Request, { - initialize: function($super, container, url, options) { - this.container = { - success: (container.success || container), - failure: (container.failure || (container.success ? null : container)) - }; - - options = Object.clone(options); - var onComplete = options.onComplete; - options.onComplete = (function(response, json) { - this.updateContent(response.responseText); - if (Object.isFunction(onComplete)) onComplete(response, json); - }).bind(this); - - $super(url, options); - }, - - updateContent: function(responseText) { - var receiver = this.container[this.success() ? 'success' : 'failure'], - options = this.options; - - if (!options.evalScripts) responseText = responseText.stripScripts(); - - if (receiver = $(receiver)) { - if (options.insertion) { - if (Object.isString(options.insertion)) { - var insertion = { }; insertion[options.insertion] = responseText; - receiver.insert(insertion); - } - else options.insertion(receiver, responseText); - } - else receiver.update(responseText); - } - } -}); - -Ajax.PeriodicalUpdater = Class.create(Ajax.Base, { - initialize: function($super, container, url, options) { - $super(options); - this.onComplete = this.options.onComplete; - - this.frequency = (this.options.frequency || 2); - this.decay = (this.options.decay || 1); - - this.updater = { }; - this.container = container; - this.url = url; - - this.start(); - }, - - start: function() { - this.options.onComplete = this.updateComplete.bind(this); - this.onTimerEvent(); - }, - - stop: function() { - this.updater.options.onComplete = undefined; - clearTimeout(this.timer); - (this.onComplete || Prototype.emptyFunction).apply(this, arguments); - }, - - updateComplete: function(response) { - if (this.options.decay) { - this.decay = (response.responseText == this.lastText ? - this.decay * this.options.decay : 1); - - this.lastText = response.responseText; - } - this.timer = this.onTimerEvent.bind(this).delay(this.decay * this.frequency); - }, - - onTimerEvent: function() { - this.updater = new Ajax.Updater(this.container, this.url, this.options); - } -}); -function $(element) { - if (arguments.length > 1) { - for (var i = 0, elements = [], length = arguments.length; i < length; i++) - elements.push($(arguments[i])); - return elements; - } - if (Object.isString(element)) - element = document.getElementById(element); - return Element.extend(element); -} - -if (Prototype.BrowserFeatures.XPath) { - document._getElementsByXPath = function(expression, parentElement) { - var results = []; - var query = document.evaluate(expression, $(parentElement) || document, - null, XPathResult.ORDERED_NODE_SNAPSHOT_TYPE, null); - for (var i = 0, length = query.snapshotLength; i < length; i++) - results.push(Element.extend(query.snapshotItem(i))); - return results; - }; -} - -/*--------------------------------------------------------------------------*/ - -if (!window.Node) var Node = { }; - -if (!Node.ELEMENT_NODE) { - // DOM level 2 ECMAScript Language Binding - Object.extend(Node, { - ELEMENT_NODE: 1, - ATTRIBUTE_NODE: 2, - TEXT_NODE: 3, - CDATA_SECTION_NODE: 4, - ENTITY_REFERENCE_NODE: 5, - ENTITY_NODE: 6, - PROCESSING_INSTRUCTION_NODE: 7, - COMMENT_NODE: 8, - DOCUMENT_NODE: 9, - DOCUMENT_TYPE_NODE: 10, - DOCUMENT_FRAGMENT_NODE: 11, - NOTATION_NODE: 12 - }); -} - -(function() { - var element = this.Element; - this.Element = function(tagName, attributes) { - attributes = attributes || { }; - tagName = tagName.toLowerCase(); - var cache = Element.cache; - if (Prototype.Browser.IE && attributes.name) { - tagName = '<' + tagName + ' name="' + attributes.name + '">'; - delete attributes.name; - return Element.writeAttribute(document.createElement(tagName), attributes); - } - if (!cache[tagName]) cache[tagName] = Element.extend(document.createElement(tagName)); - return Element.writeAttribute(cache[tagName].cloneNode(false), attributes); - }; - Object.extend(this.Element, element || { }); - if (element) this.Element.prototype = element.prototype; -}).call(window); - -Element.cache = { }; - -Element.Methods = { - visible: function(element) { - return $(element).style.display != 'none'; - }, - - toggle: function(element) { - element = $(element); - Element[Element.visible(element) ? 'hide' : 'show'](element); - return element; - }, - - hide: function(element) { - element = $(element); - element.style.display = 'none'; - return element; - }, - - show: function(element) { - element = $(element); - element.style.display = ''; - return element; - }, - - remove: function(element) { - element = $(element); - element.parentNode.removeChild(element); - return element; - }, - - update: function(element, content) { - element = $(element); - if (content && content.toElement) content = content.toElement(); - if (Object.isElement(content)) return element.update().insert(content); - content = Object.toHTML(content); - element.innerHTML = content.stripScripts(); - content.evalScripts.bind(content).defer(); - return element; - }, - - replace: function(element, content) { - element = $(element); - if (content && content.toElement) content = content.toElement(); - else if (!Object.isElement(content)) { - content = Object.toHTML(content); - var range = element.ownerDocument.createRange(); - range.selectNode(element); - content.evalScripts.bind(content).defer(); - content = range.createContextualFragment(content.stripScripts()); - } - element.parentNode.replaceChild(content, element); - return element; - }, - - insert: function(element, insertions) { - element = $(element); - - if (Object.isString(insertions) || Object.isNumber(insertions) || - Object.isElement(insertions) || (insertions && (insertions.toElement || insertions.toHTML))) - insertions = {bottom:insertions}; - - var content, insert, tagName, childNodes; - - for (var position in insertions) { - content = insertions[position]; - position = position.toLowerCase(); - insert = Element._insertionTranslations[position]; - - if (content && content.toElement) content = content.toElement(); - if (Object.isElement(content)) { - insert(element, content); - continue; - } - - content = Object.toHTML(content); - - tagName = ((position == 'before' || position == 'after') - ? element.parentNode : element).tagName.toUpperCase(); - - childNodes = Element._getContentFromAnonymousElement(tagName, content.stripScripts()); - - if (position == 'top' || position == 'after') childNodes.reverse(); - childNodes.each(insert.curry(element)); - - content.evalScripts.bind(content).defer(); - } - - return element; - }, - - wrap: function(element, wrapper, attributes) { - element = $(element); - if (Object.isElement(wrapper)) - $(wrapper).writeAttribute(attributes || { }); - else if (Object.isString(wrapper)) wrapper = new Element(wrapper, attributes); - else wrapper = new Element('div', wrapper); - if (element.parentNode) - element.parentNode.replaceChild(wrapper, element); - wrapper.appendChild(element); - return wrapper; - }, - - inspect: function(element) { - element = $(element); - var result = '<' + element.tagName.toLowerCase(); - $H({'id': 'id', 'className': 'class'}).each(function(pair) { - var property = pair.first(), attribute = pair.last(); - var value = (element[property] || '').toString(); - if (value) result += ' ' + attribute + '=' + value.inspect(true); - }); - return result + '>'; - }, - - recursivelyCollect: function(element, property) { - element = $(element); - var elements = []; - while (element = element[property]) - if (element.nodeType == 1) - elements.push(Element.extend(element)); - return elements; - }, - - ancestors: function(element) { - return $(element).recursivelyCollect('parentNode'); - }, - - descendants: function(element) { - return $(element).select("*"); - }, - - firstDescendant: function(element) { - element = $(element).firstChild; - while (element && element.nodeType != 1) element = element.nextSibling; - return $(element); - }, - - immediateDescendants: function(element) { - if (!(element = $(element).firstChild)) return []; - while (element && element.nodeType != 1) element = element.nextSibling; - if (element) return [element].concat($(element).nextSiblings()); - return []; - }, - - previousSiblings: function(element) { - return $(element).recursivelyCollect('previousSibling'); - }, - - nextSiblings: function(element) { - return $(element).recursivelyCollect('nextSibling'); - }, - - siblings: function(element) { - element = $(element); - return element.previousSiblings().reverse().concat(element.nextSiblings()); - }, - - match: function(element, selector) { - if (Object.isString(selector)) - selector = new Selector(selector); - return selector.match($(element)); - }, - - up: function(element, expression, index) { - element = $(element); - if (arguments.length == 1) return $(element.parentNode); - var ancestors = element.ancestors(); - return Object.isNumber(expression) ? ancestors[expression] : - Selector.findElement(ancestors, expression, index); - }, - - down: function(element, expression, index) { - element = $(element); - if (arguments.length == 1) return element.firstDescendant(); - return Object.isNumber(expression) ? element.descendants()[expression] : - Element.select(element, expression)[index || 0]; - }, - - previous: function(element, expression, index) { - element = $(element); - if (arguments.length == 1) return $(Selector.handlers.previousElementSibling(element)); - var previousSiblings = element.previousSiblings(); - return Object.isNumber(expression) ? previousSiblings[expression] : - Selector.findElement(previousSiblings, expression, index); - }, - - next: function(element, expression, index) { - element = $(element); - if (arguments.length == 1) return $(Selector.handlers.nextElementSibling(element)); - var nextSiblings = element.nextSiblings(); - return Object.isNumber(expression) ? nextSiblings[expression] : - Selector.findElement(nextSiblings, expression, index); - }, - - select: function() { - var args = $A(arguments), element = $(args.shift()); - return Selector.findChildElements(element, args); - }, - - adjacent: function() { - var args = $A(arguments), element = $(args.shift()); - return Selector.findChildElements(element.parentNode, args).without(element); - }, - - identify: function(element) { - element = $(element); - var id = element.readAttribute('id'), self = arguments.callee; - if (id) return id; - do { id = 'anonymous_element_' + self.counter++ } while ($(id)); - element.writeAttribute('id', id); - return id; - }, - - readAttribute: function(element, name) { - element = $(element); - if (Prototype.Browser.IE) { - var t = Element._attributeTranslations.read; - if (t.values[name]) return t.values[name](element, name); - if (t.names[name]) name = t.names[name]; - if (name.include(':')) { - return (!element.attributes || !element.attributes[name]) ? null : - element.attributes[name].value; - } - } - return element.getAttribute(name); - }, - - writeAttribute: function(element, name, value) { - element = $(element); - var attributes = { }, t = Element._attributeTranslations.write; - - if (typeof name == 'object') attributes = name; - else attributes[name] = Object.isUndefined(value) ? true : value; - - for (var attr in attributes) { - name = t.names[attr] || attr; - value = attributes[attr]; - if (t.values[attr]) name = t.values[attr](element, value); - if (value === false || value === null) - element.removeAttribute(name); - else if (value === true) - element.setAttribute(name, name); - else element.setAttribute(name, value); - } - return element; - }, - - getHeight: function(element) { - return $(element).getDimensions().height; - }, - - getWidth: function(element) { - return $(element).getDimensions().width; - }, - - classNames: function(element) { - return new Element.ClassNames(element); - }, - - hasClassName: function(element, className) { - if (!(element = $(element))) return; - var elementClassName = element.className; - return (elementClassName.length > 0 && (elementClassName == className || - new RegExp("(^|\\s)" + className + "(\\s|$)").test(elementClassName))); - }, - - addClassName: function(element, className) { - if (!(element = $(element))) return; - if (!element.hasClassName(className)) - element.className += (element.className ? ' ' : '') + className; - return element; - }, - - removeClassName: function(element, className) { - if (!(element = $(element))) return; - element.className = element.className.replace( - new RegExp("(^|\\s+)" + className + "(\\s+|$)"), ' ').strip(); - return element; - }, - - toggleClassName: function(element, className) { - if (!(element = $(element))) return; - return element[element.hasClassName(className) ? - 'removeClassName' : 'addClassName'](className); - }, - - // removes whitespace-only text node children - cleanWhitespace: function(element) { - element = $(element); - var node = element.firstChild; - while (node) { - var nextNode = node.nextSibling; - if (node.nodeType == 3 && !/\S/.test(node.nodeValue)) - element.removeChild(node); - node = nextNode; - } - return element; - }, - - empty: function(element) { - return $(element).innerHTML.blank(); - }, - - descendantOf: function(element, ancestor) { - element = $(element), ancestor = $(ancestor); - - if (element.compareDocumentPosition) - return (element.compareDocumentPosition(ancestor) & 8) === 8; - - if (ancestor.contains) - return ancestor.contains(element) && ancestor !== element; - - while (element = element.parentNode) - if (element == ancestor) return true; - - return false; - }, - - scrollTo: function(element) { - element = $(element); - var pos = element.cumulativeOffset(); - window.scrollTo(pos[0], pos[1]); - return element; - }, - - getStyle: function(element, style) { - element = $(element); - style = style == 'float' ? 'cssFloat' : style.camelize(); - var value = element.style[style]; - if (!value || value == 'auto') { - var css = document.defaultView.getComputedStyle(element, null); - value = css ? css[style] : null; - } - if (style == 'opacity') return value ? parseFloat(value) : 1.0; - return value == 'auto' ? null : value; - }, - - getOpacity: function(element) { - return $(element).getStyle('opacity'); - }, - - setStyle: function(element, styles) { - element = $(element); - var elementStyle = element.style, match; - if (Object.isString(styles)) { - element.style.cssText += ';' + styles; - return styles.include('opacity') ? - element.setOpacity(styles.match(/opacity:\s*(\d?\.?\d*)/)[1]) : element; - } - for (var property in styles) - if (property == 'opacity') element.setOpacity(styles[property]); - else - elementStyle[(property == 'float' || property == 'cssFloat') ? - (Object.isUndefined(elementStyle.styleFloat) ? 'cssFloat' : 'styleFloat') : - property] = styles[property]; - - return element; - }, - - setOpacity: function(element, value) { - element = $(element); - element.style.opacity = (value == 1 || value === '') ? '' : - (value < 0.00001) ? 0 : value; - return element; - }, - - getDimensions: function(element) { - element = $(element); - var display = element.getStyle('display'); - if (display != 'none' && display != null) // Safari bug - return {width: element.offsetWidth, height: element.offsetHeight}; - - // All *Width and *Height properties give 0 on elements with display none, - // so enable the element temporarily - var els = element.style; - var originalVisibility = els.visibility; - var originalPosition = els.position; - var originalDisplay = els.display; - els.visibility = 'hidden'; - els.position = 'absolute'; - els.display = 'block'; - var originalWidth = element.clientWidth; - var originalHeight = element.clientHeight; - els.display = originalDisplay; - els.position = originalPosition; - els.visibility = originalVisibility; - return {width: originalWidth, height: originalHeight}; - }, - - makePositioned: function(element) { - element = $(element); - var pos = Element.getStyle(element, 'position'); - if (pos == 'static' || !pos) { - element._madePositioned = true; - element.style.position = 'relative'; - // Opera returns the offset relative to the positioning context, when an - // element is position relative but top and left have not been defined - if (Prototype.Browser.Opera) { - element.style.top = 0; - element.style.left = 0; - } - } - return element; - }, - - undoPositioned: function(element) { - element = $(element); - if (element._madePositioned) { - element._madePositioned = undefined; - element.style.position = - element.style.top = - element.style.left = - element.style.bottom = - element.style.right = ''; - } - return element; - }, - - makeClipping: function(element) { - element = $(element); - if (element._overflow) return element; - element._overflow = Element.getStyle(element, 'overflow') || 'auto'; - if (element._overflow !== 'hidden') - element.style.overflow = 'hidden'; - return element; - }, - - undoClipping: function(element) { - element = $(element); - if (!element._overflow) return element; - element.style.overflow = element._overflow == 'auto' ? '' : element._overflow; - element._overflow = null; - return element; - }, - - cumulativeOffset: function(element) { - var valueT = 0, valueL = 0; - do { - valueT += element.offsetTop || 0; - valueL += element.offsetLeft || 0; - element = element.offsetParent; - } while (element); - return Element._returnOffset(valueL, valueT); - }, - - positionedOffset: function(element) { - var valueT = 0, valueL = 0; - do { - valueT += element.offsetTop || 0; - valueL += element.offsetLeft || 0; - element = element.offsetParent; - if (element) { - if (element.tagName.toUpperCase() == 'BODY') break; - var p = Element.getStyle(element, 'position'); - if (p !== 'static') break; - } - } while (element); - return Element._returnOffset(valueL, valueT); - }, - - absolutize: function(element) { - element = $(element); - if (element.getStyle('position') == 'absolute') return element; - // Position.prepare(); // To be done manually by Scripty when it needs it. - - var offsets = element.positionedOffset(); - var top = offsets[1]; - var left = offsets[0]; - var width = element.clientWidth; - var height = element.clientHeight; - - element._originalLeft = left - parseFloat(element.style.left || 0); - element._originalTop = top - parseFloat(element.style.top || 0); - element._originalWidth = element.style.width; - element._originalHeight = element.style.height; - - element.style.position = 'absolute'; - element.style.top = top + 'px'; - element.style.left = left + 'px'; - element.style.width = width + 'px'; - element.style.height = height + 'px'; - return element; - }, - - relativize: function(element) { - element = $(element); - if (element.getStyle('position') == 'relative') return element; - // Position.prepare(); // To be done manually by Scripty when it needs it. - - element.style.position = 'relative'; - var top = parseFloat(element.style.top || 0) - (element._originalTop || 0); - var left = parseFloat(element.style.left || 0) - (element._originalLeft || 0); - - element.style.top = top + 'px'; - element.style.left = left + 'px'; - element.style.height = element._originalHeight; - element.style.width = element._originalWidth; - return element; - }, - - cumulativeScrollOffset: function(element) { - var valueT = 0, valueL = 0; - do { - valueT += element.scrollTop || 0; - valueL += element.scrollLeft || 0; - element = element.parentNode; - } while (element); - return Element._returnOffset(valueL, valueT); - }, - - getOffsetParent: function(element) { - if (element.offsetParent) return $(element.offsetParent); - if (element == document.body) return $(element); - - while ((element = element.parentNode) && element != document.body) - if (Element.getStyle(element, 'position') != 'static') - return $(element); - - return $(document.body); - }, - - viewportOffset: function(forElement) { - var valueT = 0, valueL = 0; - - var element = forElement; - do { - valueT += element.offsetTop || 0; - valueL += element.offsetLeft || 0; - - // Safari fix - if (element.offsetParent == document.body && - Element.getStyle(element, 'position') == 'absolute') break; - - } while (element = element.offsetParent); - - element = forElement; - do { - if (!Prototype.Browser.Opera || (element.tagName && (element.tagName.toUpperCase() == 'BODY'))) { - valueT -= element.scrollTop || 0; - valueL -= element.scrollLeft || 0; - } - } while (element = element.parentNode); - - return Element._returnOffset(valueL, valueT); - }, - - clonePosition: function(element, source) { - var options = Object.extend({ - setLeft: true, - setTop: true, - setWidth: true, - setHeight: true, - offsetTop: 0, - offsetLeft: 0 - }, arguments[2] || { }); - - // find page position of source - source = $(source); - var p = source.viewportOffset(); - - // find coordinate system to use - element = $(element); - var delta = [0, 0]; - var parent = null; - // delta [0,0] will do fine with position: fixed elements, - // position:absolute needs offsetParent deltas - if (Element.getStyle(element, 'position') == 'absolute') { - parent = element.getOffsetParent(); - delta = parent.viewportOffset(); - } - - // correct by body offsets (fixes Safari) - if (parent == document.body) { - delta[0] -= document.body.offsetLeft; - delta[1] -= document.body.offsetTop; - } - - // set position - if (options.setLeft) element.style.left = (p[0] - delta[0] + options.offsetLeft) + 'px'; - if (options.setTop) element.style.top = (p[1] - delta[1] + options.offsetTop) + 'px'; - if (options.setWidth) element.style.width = source.offsetWidth + 'px'; - if (options.setHeight) element.style.height = source.offsetHeight + 'px'; - return element; - } -}; - -Element.Methods.identify.counter = 1; - -Object.extend(Element.Methods, { - getElementsBySelector: Element.Methods.select, - childElements: Element.Methods.immediateDescendants -}); - -Element._attributeTranslations = { - write: { - names: { - className: 'class', - htmlFor: 'for' - }, - values: { } - } -}; - -if (Prototype.Browser.Opera) { - Element.Methods.getStyle = Element.Methods.getStyle.wrap( - function(proceed, element, style) { - switch (style) { - case 'left': case 'top': case 'right': case 'bottom': - if (proceed(element, 'position') === 'static') return null; - case 'height': case 'width': - // returns '0px' for hidden elements; we want it to return null - if (!Element.visible(element)) return null; - - // returns the border-box dimensions rather than the content-box - // dimensions, so we subtract padding and borders from the value - var dim = parseInt(proceed(element, style), 10); - - if (dim !== element['offset' + style.capitalize()]) - return dim + 'px'; - - var properties; - if (style === 'height') { - properties = ['border-top-width', 'padding-top', - 'padding-bottom', 'border-bottom-width']; - } - else { - properties = ['border-left-width', 'padding-left', - 'padding-right', 'border-right-width']; - } - return properties.inject(dim, function(memo, property) { - var val = proceed(element, property); - return val === null ? memo : memo - parseInt(val, 10); - }) + 'px'; - default: return proceed(element, style); - } - } - ); - - Element.Methods.readAttribute = Element.Methods.readAttribute.wrap( - function(proceed, element, attribute) { - if (attribute === 'title') return element.title; - return proceed(element, attribute); - } - ); -} - -else if (Prototype.Browser.IE) { - // IE doesn't report offsets correctly for static elements, so we change them - // to "relative" to get the values, then change them back. - Element.Methods.getOffsetParent = Element.Methods.getOffsetParent.wrap( - function(proceed, element) { - element = $(element); - // IE throws an error if element is not in document - try { element.offsetParent } - catch(e) { return $(document.body) } - var position = element.getStyle('position'); - if (position !== 'static') return proceed(element); - element.setStyle({ position: 'relative' }); - var value = proceed(element); - element.setStyle({ position: position }); - return value; - } - ); - - $w('positionedOffset viewportOffset').each(function(method) { - Element.Methods[method] = Element.Methods[method].wrap( - function(proceed, element) { - element = $(element); - try { element.offsetParent } - catch(e) { return Element._returnOffset(0,0) } - var position = element.getStyle('position'); - if (position !== 'static') return proceed(element); - // Trigger hasLayout on the offset parent so that IE6 reports - // accurate offsetTop and offsetLeft values for position: fixed. - var offsetParent = element.getOffsetParent(); - if (offsetParent && offsetParent.getStyle('position') === 'fixed') - offsetParent.setStyle({ zoom: 1 }); - element.setStyle({ position: 'relative' }); - var value = proceed(element); - element.setStyle({ position: position }); - return value; - } - ); - }); - - Element.Methods.cumulativeOffset = Element.Methods.cumulativeOffset.wrap( - function(proceed, element) { - try { element.offsetParent } - catch(e) { return Element._returnOffset(0,0) } - return proceed(element); - } - ); - - Element.Methods.getStyle = function(element, style) { - element = $(element); - style = (style == 'float' || style == 'cssFloat') ? 'styleFloat' : style.camelize(); - var value = element.style[style]; - if (!value && element.currentStyle) value = element.currentStyle[style]; - - if (style == 'opacity') { - if (value = (element.getStyle('filter') || '').match(/alpha\(opacity=(.*)\)/)) - if (value[1]) return parseFloat(value[1]) / 100; - return 1.0; - } - - if (value == 'auto') { - if ((style == 'width' || style == 'height') && (element.getStyle('display') != 'none')) - return element['offset' + style.capitalize()] + 'px'; - return null; - } - return value; - }; - - Element.Methods.setOpacity = function(element, value) { - function stripAlpha(filter){ - return filter.replace(/alpha\([^\)]*\)/gi,''); - } - element = $(element); - var currentStyle = element.currentStyle; - if ((currentStyle && !currentStyle.hasLayout) || - (!currentStyle && element.style.zoom == 'normal')) - element.style.zoom = 1; - - var filter = element.getStyle('filter'), style = element.style; - if (value == 1 || value === '') { - (filter = stripAlpha(filter)) ? - style.filter = filter : style.removeAttribute('filter'); - return element; - } else if (value < 0.00001) value = 0; - style.filter = stripAlpha(filter) + - 'alpha(opacity=' + (value * 100) + ')'; - return element; - }; - - Element._attributeTranslations = { - read: { - names: { - 'class': 'className', - 'for': 'htmlFor' - }, - values: { - _getAttr: function(element, attribute) { - return element.getAttribute(attribute, 2); - }, - _getAttrNode: function(element, attribute) { - var node = element.getAttributeNode(attribute); - return node ? node.value : ""; - }, - _getEv: function(element, attribute) { - attribute = element.getAttribute(attribute); - return attribute ? attribute.toString().slice(23, -2) : null; - }, - _flag: function(element, attribute) { - return $(element).hasAttribute(attribute) ? attribute : null; - }, - style: function(element) { - return element.style.cssText.toLowerCase(); - }, - title: function(element) { - return element.title; - } - } - } - }; - - Element._attributeTranslations.write = { - names: Object.extend({ - cellpadding: 'cellPadding', - cellspacing: 'cellSpacing' - }, Element._attributeTranslations.read.names), - values: { - checked: function(element, value) { - element.checked = !!value; - }, - - style: function(element, value) { - element.style.cssText = value ? value : ''; - } - } - }; - - Element._attributeTranslations.has = {}; - - $w('colSpan rowSpan vAlign dateTime accessKey tabIndex ' + - 'encType maxLength readOnly longDesc frameBorder').each(function(attr) { - Element._attributeTranslations.write.names[attr.toLowerCase()] = attr; - Element._attributeTranslations.has[attr.toLowerCase()] = attr; - }); - - (function(v) { - Object.extend(v, { - href: v._getAttr, - src: v._getAttr, - type: v._getAttr, - action: v._getAttrNode, - disabled: v._flag, - checked: v._flag, - readonly: v._flag, - multiple: v._flag, - onload: v._getEv, - onunload: v._getEv, - onclick: v._getEv, - ondblclick: v._getEv, - onmousedown: v._getEv, - onmouseup: v._getEv, - onmouseover: v._getEv, - onmousemove: v._getEv, - onmouseout: v._getEv, - onfocus: v._getEv, - onblur: v._getEv, - onkeypress: v._getEv, - onkeydown: v._getEv, - onkeyup: v._getEv, - onsubmit: v._getEv, - onreset: v._getEv, - onselect: v._getEv, - onchange: v._getEv - }); - })(Element._attributeTranslations.read.values); -} - -else if (Prototype.Browser.Gecko && /rv:1\.8\.0/.test(navigator.userAgent)) { - Element.Methods.setOpacity = function(element, value) { - element = $(element); - element.style.opacity = (value == 1) ? 0.999999 : - (value === '') ? '' : (value < 0.00001) ? 0 : value; - return element; - }; -} - -else if (Prototype.Browser.WebKit) { - Element.Methods.setOpacity = function(element, value) { - element = $(element); - element.style.opacity = (value == 1 || value === '') ? '' : - (value < 0.00001) ? 0 : value; - - if (value == 1) - if(element.tagName.toUpperCase() == 'IMG' && element.width) { - element.width++; element.width--; - } else try { - var n = document.createTextNode(' '); - element.appendChild(n); - element.removeChild(n); - } catch (e) { } - - return element; - }; - - // Safari returns margins on body which is incorrect if the child is absolutely - // positioned. For performance reasons, redefine Element#cumulativeOffset for - // KHTML/WebKit only. - Element.Methods.cumulativeOffset = function(element) { - var valueT = 0, valueL = 0; - do { - valueT += element.offsetTop || 0; - valueL += element.offsetLeft || 0; - if (element.offsetParent == document.body) - if (Element.getStyle(element, 'position') == 'absolute') break; - - element = element.offsetParent; - } while (element); - - return Element._returnOffset(valueL, valueT); - }; -} - -if (Prototype.Browser.IE || Prototype.Browser.Opera) { - // IE and Opera are missing .innerHTML support for TABLE-related and SELECT elements - Element.Methods.update = function(element, content) { - element = $(element); - - if (content && content.toElement) content = content.toElement(); - if (Object.isElement(content)) return element.update().insert(content); - - content = Object.toHTML(content); - var tagName = element.tagName.toUpperCase(); - - if (tagName in Element._insertionTranslations.tags) { - $A(element.childNodes).each(function(node) { element.removeChild(node) }); - Element._getContentFromAnonymousElement(tagName, content.stripScripts()) - .each(function(node) { element.appendChild(node) }); - } - else element.innerHTML = content.stripScripts(); - - content.evalScripts.bind(content).defer(); - return element; - }; -} - -if ('outerHTML' in document.createElement('div')) { - Element.Methods.replace = function(element, content) { - element = $(element); - - if (content && content.toElement) content = content.toElement(); - if (Object.isElement(content)) { - element.parentNode.replaceChild(content, element); - return element; - } - - content = Object.toHTML(content); - var parent = element.parentNode, tagName = parent.tagName.toUpperCase(); - - if (Element._insertionTranslations.tags[tagName]) { - var nextSibling = element.next(); - var fragments = Element._getContentFromAnonymousElement(tagName, content.stripScripts()); - parent.removeChild(element); - if (nextSibling) - fragments.each(function(node) { parent.insertBefore(node, nextSibling) }); - else - fragments.each(function(node) { parent.appendChild(node) }); - } - else element.outerHTML = content.stripScripts(); - - content.evalScripts.bind(content).defer(); - return element; - }; -} - -Element._returnOffset = function(l, t) { - var result = [l, t]; - result.left = l; - result.top = t; - return result; -}; - -Element._getContentFromAnonymousElement = function(tagName, html) { - var div = new Element('div'), t = Element._insertionTranslations.tags[tagName]; - if (t) { - div.innerHTML = t[0] + html + t[1]; - t[2].times(function() { div = div.firstChild }); - } else div.innerHTML = html; - return $A(div.childNodes); -}; - -Element._insertionTranslations = { - before: function(element, node) { - element.parentNode.insertBefore(node, element); - }, - top: function(element, node) { - element.insertBefore(node, element.firstChild); - }, - bottom: function(element, node) { - element.appendChild(node); - }, - after: function(element, node) { - element.parentNode.insertBefore(node, element.nextSibling); - }, - tags: { - TABLE: ['', '
', 1], - TBODY: ['', '
', 2], - TR: ['', '
', 3], - TD: ['
', '
', 4], - SELECT: ['', 1] - } -}; - -(function() { - Object.extend(this.tags, { - THEAD: this.tags.TBODY, - TFOOT: this.tags.TBODY, - TH: this.tags.TD - }); -}).call(Element._insertionTranslations); - -Element.Methods.Simulated = { - hasAttribute: function(element, attribute) { - attribute = Element._attributeTranslations.has[attribute] || attribute; - var node = $(element).getAttributeNode(attribute); - return !!(node && node.specified); - } -}; - -Element.Methods.ByTag = { }; - -Object.extend(Element, Element.Methods); - -if (!Prototype.BrowserFeatures.ElementExtensions && - document.createElement('div')['__proto__']) { - window.HTMLElement = { }; - window.HTMLElement.prototype = document.createElement('div')['__proto__']; - Prototype.BrowserFeatures.ElementExtensions = true; -} - -Element.extend = (function() { - if (Prototype.BrowserFeatures.SpecificElementExtensions) - return Prototype.K; - - var Methods = { }, ByTag = Element.Methods.ByTag; - - var extend = Object.extend(function(element) { - if (!element || element._extendedByPrototype || - element.nodeType != 1 || element == window) return element; - - var methods = Object.clone(Methods), - tagName = element.tagName.toUpperCase(), property, value; - - // extend methods for specific tags - if (ByTag[tagName]) Object.extend(methods, ByTag[tagName]); - - for (property in methods) { - value = methods[property]; - if (Object.isFunction(value) && !(property in element)) - element[property] = value.methodize(); - } - - element._extendedByPrototype = Prototype.emptyFunction; - return element; - - }, { - refresh: function() { - // extend methods for all tags (Safari doesn't need this) - if (!Prototype.BrowserFeatures.ElementExtensions) { - Object.extend(Methods, Element.Methods); - Object.extend(Methods, Element.Methods.Simulated); - } - } - }); - - extend.refresh(); - return extend; -})(); - -Element.hasAttribute = function(element, attribute) { - if (element.hasAttribute) return element.hasAttribute(attribute); - return Element.Methods.Simulated.hasAttribute(element, attribute); -}; - -Element.addMethods = function(methods) { - var F = Prototype.BrowserFeatures, T = Element.Methods.ByTag; - - if (!methods) { - Object.extend(Form, Form.Methods); - Object.extend(Form.Element, Form.Element.Methods); - Object.extend(Element.Methods.ByTag, { - "FORM": Object.clone(Form.Methods), - "INPUT": Object.clone(Form.Element.Methods), - "SELECT": Object.clone(Form.Element.Methods), - "TEXTAREA": Object.clone(Form.Element.Methods) - }); - } - - if (arguments.length == 2) { - var tagName = methods; - methods = arguments[1]; - } - - if (!tagName) Object.extend(Element.Methods, methods || { }); - else { - if (Object.isArray(tagName)) tagName.each(extend); - else extend(tagName); - } - - function extend(tagName) { - tagName = tagName.toUpperCase(); - if (!Element.Methods.ByTag[tagName]) - Element.Methods.ByTag[tagName] = { }; - Object.extend(Element.Methods.ByTag[tagName], methods); - } - - function copy(methods, destination, onlyIfAbsent) { - onlyIfAbsent = onlyIfAbsent || false; - for (var property in methods) { - var value = methods[property]; - if (!Object.isFunction(value)) continue; - if (!onlyIfAbsent || !(property in destination)) - destination[property] = value.methodize(); - } - } - - function findDOMClass(tagName) { - var klass; - var trans = { - "OPTGROUP": "OptGroup", "TEXTAREA": "TextArea", "P": "Paragraph", - "FIELDSET": "FieldSet", "UL": "UList", "OL": "OList", "DL": "DList", - "DIR": "Directory", "H1": "Heading", "H2": "Heading", "H3": "Heading", - "H4": "Heading", "H5": "Heading", "H6": "Heading", "Q": "Quote", - "INS": "Mod", "DEL": "Mod", "A": "Anchor", "IMG": "Image", "CAPTION": - "TableCaption", "COL": "TableCol", "COLGROUP": "TableCol", "THEAD": - "TableSection", "TFOOT": "TableSection", "TBODY": "TableSection", "TR": - "TableRow", "TH": "TableCell", "TD": "TableCell", "FRAMESET": - "FrameSet", "IFRAME": "IFrame" - }; - if (trans[tagName]) klass = 'HTML' + trans[tagName] + 'Element'; - if (window[klass]) return window[klass]; - klass = 'HTML' + tagName + 'Element'; - if (window[klass]) return window[klass]; - klass = 'HTML' + tagName.capitalize() + 'Element'; - if (window[klass]) return window[klass]; - - window[klass] = { }; - window[klass].prototype = document.createElement(tagName)['__proto__']; - return window[klass]; - } - - if (F.ElementExtensions) { - copy(Element.Methods, HTMLElement.prototype); - copy(Element.Methods.Simulated, HTMLElement.prototype, true); - } - - if (F.SpecificElementExtensions) { - for (var tag in Element.Methods.ByTag) { - var klass = findDOMClass(tag); - if (Object.isUndefined(klass)) continue; - copy(T[tag], klass.prototype); - } - } - - Object.extend(Element, Element.Methods); - delete Element.ByTag; - - if (Element.extend.refresh) Element.extend.refresh(); - Element.cache = { }; -}; - -document.viewport = { - getDimensions: function() { - var dimensions = { }, B = Prototype.Browser; - $w('width height').each(function(d) { - var D = d.capitalize(); - if (B.WebKit && !document.evaluate) { - // Safari <3.0 needs self.innerWidth/Height - dimensions[d] = self['inner' + D]; - } else if (B.Opera && parseFloat(window.opera.version()) < 9.5) { - // Opera <9.5 needs document.body.clientWidth/Height - dimensions[d] = document.body['client' + D] - } else { - dimensions[d] = document.documentElement['client' + D]; - } - }); - return dimensions; - }, - - getWidth: function() { - return this.getDimensions().width; - }, - - getHeight: function() { - return this.getDimensions().height; - }, - - getScrollOffsets: function() { - return Element._returnOffset( - window.pageXOffset || document.documentElement.scrollLeft || document.body.scrollLeft, - window.pageYOffset || document.documentElement.scrollTop || document.body.scrollTop); - } -}; -/* Portions of the Selector class are derived from Jack Slocum's DomQuery, - * part of YUI-Ext version 0.40, distributed under the terms of an MIT-style - * license. Please see http://www.yui-ext.com/ for more information. */ - -var Selector = Class.create({ - initialize: function(expression) { - this.expression = expression.strip(); - - if (this.shouldUseSelectorsAPI()) { - this.mode = 'selectorsAPI'; - } else if (this.shouldUseXPath()) { - this.mode = 'xpath'; - this.compileXPathMatcher(); - } else { - this.mode = "normal"; - this.compileMatcher(); - } - - }, - - shouldUseXPath: function() { - if (!Prototype.BrowserFeatures.XPath) return false; - - var e = this.expression; - - // Safari 3 chokes on :*-of-type and :empty - if (Prototype.Browser.WebKit && - (e.include("-of-type") || e.include(":empty"))) - return false; - - // XPath can't do namespaced attributes, nor can it read - // the "checked" property from DOM nodes - if ((/(\[[\w-]*?:|:checked)/).test(e)) - return false; - - return true; - }, - - shouldUseSelectorsAPI: function() { - if (!Prototype.BrowserFeatures.SelectorsAPI) return false; - - if (!Selector._div) Selector._div = new Element('div'); - - // Make sure the browser treats the selector as valid. Test on an - // isolated element to minimize cost of this check. - try { - Selector._div.querySelector(this.expression); - } catch(e) { - return false; - } - - return true; - }, - - compileMatcher: function() { - var e = this.expression, ps = Selector.patterns, h = Selector.handlers, - c = Selector.criteria, le, p, m; - - if (Selector._cache[e]) { - this.matcher = Selector._cache[e]; - return; - } - - this.matcher = ["this.matcher = function(root) {", - "var r = root, h = Selector.handlers, c = false, n;"]; - - while (e && le != e && (/\S/).test(e)) { - le = e; - for (var i in ps) { - p = ps[i]; - if (m = e.match(p)) { - this.matcher.push(Object.isFunction(c[i]) ? c[i](m) : - new Template(c[i]).evaluate(m)); - e = e.replace(m[0], ''); - break; - } - } - } - - this.matcher.push("return h.unique(n);\n}"); - eval(this.matcher.join('\n')); - Selector._cache[this.expression] = this.matcher; - }, - - compileXPathMatcher: function() { - var e = this.expression, ps = Selector.patterns, - x = Selector.xpath, le, m; - - if (Selector._cache[e]) { - this.xpath = Selector._cache[e]; return; - } - - this.matcher = ['.//*']; - while (e && le != e && (/\S/).test(e)) { - le = e; - for (var i in ps) { - if (m = e.match(ps[i])) { - this.matcher.push(Object.isFunction(x[i]) ? x[i](m) : - new Template(x[i]).evaluate(m)); - e = e.replace(m[0], ''); - break; - } - } - } - - this.xpath = this.matcher.join(''); - Selector._cache[this.expression] = this.xpath; - }, - - findElements: function(root) { - root = root || document; - var e = this.expression, results; - - switch (this.mode) { - case 'selectorsAPI': - // querySelectorAll queries document-wide, then filters to descendants - // of the context element. That's not what we want. - // Add an explicit context to the selector if necessary. - if (root !== document) { - var oldId = root.id, id = $(root).identify(); - e = "#" + id + " " + e; - } - - results = $A(root.querySelectorAll(e)).map(Element.extend); - root.id = oldId; - - return results; - case 'xpath': - return document._getElementsByXPath(this.xpath, root); - default: - return this.matcher(root); - } - }, - - match: function(element) { - this.tokens = []; - - var e = this.expression, ps = Selector.patterns, as = Selector.assertions; - var le, p, m; - - while (e && le !== e && (/\S/).test(e)) { - le = e; - for (var i in ps) { - p = ps[i]; - if (m = e.match(p)) { - // use the Selector.assertions methods unless the selector - // is too complex. - if (as[i]) { - this.tokens.push([i, Object.clone(m)]); - e = e.replace(m[0], ''); - } else { - // reluctantly do a document-wide search - // and look for a match in the array - return this.findElements(document).include(element); - } - } - } - } - - var match = true, name, matches; - for (var i = 0, token; token = this.tokens[i]; i++) { - name = token[0], matches = token[1]; - if (!Selector.assertions[name](element, matches)) { - match = false; break; - } - } - - return match; - }, - - toString: function() { - return this.expression; - }, - - inspect: function() { - return "#"; - } -}); - -Object.extend(Selector, { - _cache: { }, - - xpath: { - descendant: "//*", - child: "/*", - adjacent: "/following-sibling::*[1]", - laterSibling: '/following-sibling::*', - tagName: function(m) { - if (m[1] == '*') return ''; - return "[local-name()='" + m[1].toLowerCase() + - "' or local-name()='" + m[1].toUpperCase() + "']"; - }, - className: "[contains(concat(' ', @class, ' '), ' #{1} ')]", - id: "[@id='#{1}']", - attrPresence: function(m) { - m[1] = m[1].toLowerCase(); - return new Template("[@#{1}]").evaluate(m); - }, - attr: function(m) { - m[1] = m[1].toLowerCase(); - m[3] = m[5] || m[6]; - return new Template(Selector.xpath.operators[m[2]]).evaluate(m); - }, - pseudo: function(m) { - var h = Selector.xpath.pseudos[m[1]]; - if (!h) return ''; - if (Object.isFunction(h)) return h(m); - return new Template(Selector.xpath.pseudos[m[1]]).evaluate(m); - }, - operators: { - '=': "[@#{1}='#{3}']", - '!=': "[@#{1}!='#{3}']", - '^=': "[starts-with(@#{1}, '#{3}')]", - '$=': "[substring(@#{1}, (string-length(@#{1}) - string-length('#{3}') + 1))='#{3}']", - '*=': "[contains(@#{1}, '#{3}')]", - '~=': "[contains(concat(' ', @#{1}, ' '), ' #{3} ')]", - '|=': "[contains(concat('-', @#{1}, '-'), '-#{3}-')]" - }, - pseudos: { - 'first-child': '[not(preceding-sibling::*)]', - 'last-child': '[not(following-sibling::*)]', - 'only-child': '[not(preceding-sibling::* or following-sibling::*)]', - 'empty': "[count(*) = 0 and (count(text()) = 0)]", - 'checked': "[@checked]", - 'disabled': "[(@disabled) and (@type!='hidden')]", - 'enabled': "[not(@disabled) and (@type!='hidden')]", - 'not': function(m) { - var e = m[6], p = Selector.patterns, - x = Selector.xpath, le, v; - - var exclusion = []; - while (e && le != e && (/\S/).test(e)) { - le = e; - for (var i in p) { - if (m = e.match(p[i])) { - v = Object.isFunction(x[i]) ? x[i](m) : new Template(x[i]).evaluate(m); - exclusion.push("(" + v.substring(1, v.length - 1) + ")"); - e = e.replace(m[0], ''); - break; - } - } - } - return "[not(" + exclusion.join(" and ") + ")]"; - }, - 'nth-child': function(m) { - return Selector.xpath.pseudos.nth("(count(./preceding-sibling::*) + 1) ", m); - }, - 'nth-last-child': function(m) { - return Selector.xpath.pseudos.nth("(count(./following-sibling::*) + 1) ", m); - }, - 'nth-of-type': function(m) { - return Selector.xpath.pseudos.nth("position() ", m); - }, - 'nth-last-of-type': function(m) { - return Selector.xpath.pseudos.nth("(last() + 1 - position()) ", m); - }, - 'first-of-type': function(m) { - m[6] = "1"; return Selector.xpath.pseudos['nth-of-type'](m); - }, - 'last-of-type': function(m) { - m[6] = "1"; return Selector.xpath.pseudos['nth-last-of-type'](m); - }, - 'only-of-type': function(m) { - var p = Selector.xpath.pseudos; return p['first-of-type'](m) + p['last-of-type'](m); - }, - nth: function(fragment, m) { - var mm, formula = m[6], predicate; - if (formula == 'even') formula = '2n+0'; - if (formula == 'odd') formula = '2n+1'; - if (mm = formula.match(/^(\d+)$/)) // digit only - return '[' + fragment + "= " + mm[1] + ']'; - if (mm = formula.match(/^(-?\d*)?n(([+-])(\d+))?/)) { // an+b - if (mm[1] == "-") mm[1] = -1; - var a = mm[1] ? Number(mm[1]) : 1; - var b = mm[2] ? Number(mm[2]) : 0; - predicate = "[((#{fragment} - #{b}) mod #{a} = 0) and " + - "((#{fragment} - #{b}) div #{a} >= 0)]"; - return new Template(predicate).evaluate({ - fragment: fragment, a: a, b: b }); - } - } - } - }, - - criteria: { - tagName: 'n = h.tagName(n, r, "#{1}", c); c = false;', - className: 'n = h.className(n, r, "#{1}", c); c = false;', - id: 'n = h.id(n, r, "#{1}", c); c = false;', - attrPresence: 'n = h.attrPresence(n, r, "#{1}", c); c = false;', - attr: function(m) { - m[3] = (m[5] || m[6]); - return new Template('n = h.attr(n, r, "#{1}", "#{3}", "#{2}", c); c = false;').evaluate(m); - }, - pseudo: function(m) { - if (m[6]) m[6] = m[6].replace(/"/g, '\\"'); - return new Template('n = h.pseudo(n, "#{1}", "#{6}", r, c); c = false;').evaluate(m); - }, - descendant: 'c = "descendant";', - child: 'c = "child";', - adjacent: 'c = "adjacent";', - laterSibling: 'c = "laterSibling";' - }, - - patterns: { - // combinators must be listed first - // (and descendant needs to be last combinator) - laterSibling: /^\s*~\s*/, - child: /^\s*>\s*/, - adjacent: /^\s*\+\s*/, - descendant: /^\s/, - - // selectors follow - tagName: /^\s*(\*|[\w\-]+)(\b|$)?/, - id: /^#([\w\-\*]+)(\b|$)/, - className: /^\.([\w\-\*]+)(\b|$)/, - pseudo: -/^:((first|last|nth|nth-last|only)(-child|-of-type)|empty|checked|(en|dis)abled|not)(\((.*?)\))?(\b|$|(?=\s|[:+~>]))/, - attrPresence: /^\[((?:[\w]+:)?[\w]+)\]/, - attr: /\[((?:[\w-]*:)?[\w-]+)\s*(?:([!^$*~|]?=)\s*((['"])([^\4]*?)\4|([^'"][^\]]*?)))?\]/ - }, - - // for Selector.match and Element#match - assertions: { - tagName: function(element, matches) { - return matches[1].toUpperCase() == element.tagName.toUpperCase(); - }, - - className: function(element, matches) { - return Element.hasClassName(element, matches[1]); - }, - - id: function(element, matches) { - return element.id === matches[1]; - }, - - attrPresence: function(element, matches) { - return Element.hasAttribute(element, matches[1]); - }, - - attr: function(element, matches) { - var nodeValue = Element.readAttribute(element, matches[1]); - return nodeValue && Selector.operators[matches[2]](nodeValue, matches[5] || matches[6]); - } - }, - - handlers: { - // UTILITY FUNCTIONS - // joins two collections - concat: function(a, b) { - for (var i = 0, node; node = b[i]; i++) - a.push(node); - return a; - }, - - // marks an array of nodes for counting - mark: function(nodes) { - var _true = Prototype.emptyFunction; - for (var i = 0, node; node = nodes[i]; i++) - node._countedByPrototype = _true; - return nodes; - }, - - unmark: function(nodes) { - for (var i = 0, node; node = nodes[i]; i++) - node._countedByPrototype = undefined; - return nodes; - }, - - // mark each child node with its position (for nth calls) - // "ofType" flag indicates whether we're indexing for nth-of-type - // rather than nth-child - index: function(parentNode, reverse, ofType) { - parentNode._countedByPrototype = Prototype.emptyFunction; - if (reverse) { - for (var nodes = parentNode.childNodes, i = nodes.length - 1, j = 1; i >= 0; i--) { - var node = nodes[i]; - if (node.nodeType == 1 && (!ofType || node._countedByPrototype)) node.nodeIndex = j++; - } - } else { - for (var i = 0, j = 1, nodes = parentNode.childNodes; node = nodes[i]; i++) - if (node.nodeType == 1 && (!ofType || node._countedByPrototype)) node.nodeIndex = j++; - } - }, - - // filters out duplicates and extends all nodes - unique: function(nodes) { - if (nodes.length == 0) return nodes; - var results = [], n; - for (var i = 0, l = nodes.length; i < l; i++) - if (!(n = nodes[i])._countedByPrototype) { - n._countedByPrototype = Prototype.emptyFunction; - results.push(Element.extend(n)); - } - return Selector.handlers.unmark(results); - }, - - // COMBINATOR FUNCTIONS - descendant: function(nodes) { - var h = Selector.handlers; - for (var i = 0, results = [], node; node = nodes[i]; i++) - h.concat(results, node.getElementsByTagName('*')); - return results; - }, - - child: function(nodes) { - var h = Selector.handlers; - for (var i = 0, results = [], node; node = nodes[i]; i++) { - for (var j = 0, child; child = node.childNodes[j]; j++) - if (child.nodeType == 1 && child.tagName != '!') results.push(child); - } - return results; - }, - - adjacent: function(nodes) { - for (var i = 0, results = [], node; node = nodes[i]; i++) { - var next = this.nextElementSibling(node); - if (next) results.push(next); - } - return results; - }, - - laterSibling: function(nodes) { - var h = Selector.handlers; - for (var i = 0, results = [], node; node = nodes[i]; i++) - h.concat(results, Element.nextSiblings(node)); - return results; - }, - - nextElementSibling: function(node) { - while (node = node.nextSibling) - if (node.nodeType == 1) return node; - return null; - }, - - previousElementSibling: function(node) { - while (node = node.previousSibling) - if (node.nodeType == 1) return node; - return null; - }, - - // TOKEN FUNCTIONS - tagName: function(nodes, root, tagName, combinator) { - var uTagName = tagName.toUpperCase(); - var results = [], h = Selector.handlers; - if (nodes) { - if (combinator) { - // fastlane for ordinary descendant combinators - if (combinator == "descendant") { - for (var i = 0, node; node = nodes[i]; i++) - h.concat(results, node.getElementsByTagName(tagName)); - return results; - } else nodes = this[combinator](nodes); - if (tagName == "*") return nodes; - } - for (var i = 0, node; node = nodes[i]; i++) - if (node.tagName.toUpperCase() === uTagName) results.push(node); - return results; - } else return root.getElementsByTagName(tagName); - }, - - id: function(nodes, root, id, combinator) { - var targetNode = $(id), h = Selector.handlers; - if (!targetNode) return []; - if (!nodes && root == document) return [targetNode]; - if (nodes) { - if (combinator) { - if (combinator == 'child') { - for (var i = 0, node; node = nodes[i]; i++) - if (targetNode.parentNode == node) return [targetNode]; - } else if (combinator == 'descendant') { - for (var i = 0, node; node = nodes[i]; i++) - if (Element.descendantOf(targetNode, node)) return [targetNode]; - } else if (combinator == 'adjacent') { - for (var i = 0, node; node = nodes[i]; i++) - if (Selector.handlers.previousElementSibling(targetNode) == node) - return [targetNode]; - } else nodes = h[combinator](nodes); - } - for (var i = 0, node; node = nodes[i]; i++) - if (node == targetNode) return [targetNode]; - return []; - } - return (targetNode && Element.descendantOf(targetNode, root)) ? [targetNode] : []; - }, - - className: function(nodes, root, className, combinator) { - if (nodes && combinator) nodes = this[combinator](nodes); - return Selector.handlers.byClassName(nodes, root, className); - }, - - byClassName: function(nodes, root, className) { - if (!nodes) nodes = Selector.handlers.descendant([root]); - var needle = ' ' + className + ' '; - for (var i = 0, results = [], node, nodeClassName; node = nodes[i]; i++) { - nodeClassName = node.className; - if (nodeClassName.length == 0) continue; - if (nodeClassName == className || (' ' + nodeClassName + ' ').include(needle)) - results.push(node); - } - return results; - }, - - attrPresence: function(nodes, root, attr, combinator) { - if (!nodes) nodes = root.getElementsByTagName("*"); - if (nodes && combinator) nodes = this[combinator](nodes); - var results = []; - for (var i = 0, node; node = nodes[i]; i++) - if (Element.hasAttribute(node, attr)) results.push(node); - return results; - }, - - attr: function(nodes, root, attr, value, operator, combinator) { - if (!nodes) nodes = root.getElementsByTagName("*"); - if (nodes && combinator) nodes = this[combinator](nodes); - var handler = Selector.operators[operator], results = []; - for (var i = 0, node; node = nodes[i]; i++) { - var nodeValue = Element.readAttribute(node, attr); - if (nodeValue === null) continue; - if (handler(nodeValue, value)) results.push(node); - } - return results; - }, - - pseudo: function(nodes, name, value, root, combinator) { - if (nodes && combinator) nodes = this[combinator](nodes); - if (!nodes) nodes = root.getElementsByTagName("*"); - return Selector.pseudos[name](nodes, value, root); - } - }, - - pseudos: { - 'first-child': function(nodes, value, root) { - for (var i = 0, results = [], node; node = nodes[i]; i++) { - if (Selector.handlers.previousElementSibling(node)) continue; - results.push(node); - } - return results; - }, - 'last-child': function(nodes, value, root) { - for (var i = 0, results = [], node; node = nodes[i]; i++) { - if (Selector.handlers.nextElementSibling(node)) continue; - results.push(node); - } - return results; - }, - 'only-child': function(nodes, value, root) { - var h = Selector.handlers; - for (var i = 0, results = [], node; node = nodes[i]; i++) - if (!h.previousElementSibling(node) && !h.nextElementSibling(node)) - results.push(node); - return results; - }, - 'nth-child': function(nodes, formula, root) { - return Selector.pseudos.nth(nodes, formula, root); - }, - 'nth-last-child': function(nodes, formula, root) { - return Selector.pseudos.nth(nodes, formula, root, true); - }, - 'nth-of-type': function(nodes, formula, root) { - return Selector.pseudos.nth(nodes, formula, root, false, true); - }, - 'nth-last-of-type': function(nodes, formula, root) { - return Selector.pseudos.nth(nodes, formula, root, true, true); - }, - 'first-of-type': function(nodes, formula, root) { - return Selector.pseudos.nth(nodes, "1", root, false, true); - }, - 'last-of-type': function(nodes, formula, root) { - return Selector.pseudos.nth(nodes, "1", root, true, true); - }, - 'only-of-type': function(nodes, formula, root) { - var p = Selector.pseudos; - return p['last-of-type'](p['first-of-type'](nodes, formula, root), formula, root); - }, - - // handles the an+b logic - getIndices: function(a, b, total) { - if (a == 0) return b > 0 ? [b] : []; - return $R(1, total).inject([], function(memo, i) { - if (0 == (i - b) % a && (i - b) / a >= 0) memo.push(i); - return memo; - }); - }, - - // handles nth(-last)-child, nth(-last)-of-type, and (first|last)-of-type - nth: function(nodes, formula, root, reverse, ofType) { - if (nodes.length == 0) return []; - if (formula == 'even') formula = '2n+0'; - if (formula == 'odd') formula = '2n+1'; - var h = Selector.handlers, results = [], indexed = [], m; - h.mark(nodes); - for (var i = 0, node; node = nodes[i]; i++) { - if (!node.parentNode._countedByPrototype) { - h.index(node.parentNode, reverse, ofType); - indexed.push(node.parentNode); - } - } - if (formula.match(/^\d+$/)) { // just a number - formula = Number(formula); - for (var i = 0, node; node = nodes[i]; i++) - if (node.nodeIndex == formula) results.push(node); - } else if (m = formula.match(/^(-?\d*)?n(([+-])(\d+))?/)) { // an+b - if (m[1] == "-") m[1] = -1; - var a = m[1] ? Number(m[1]) : 1; - var b = m[2] ? Number(m[2]) : 0; - var indices = Selector.pseudos.getIndices(a, b, nodes.length); - for (var i = 0, node, l = indices.length; node = nodes[i]; i++) { - for (var j = 0; j < l; j++) - if (node.nodeIndex == indices[j]) results.push(node); - } - } - h.unmark(nodes); - h.unmark(indexed); - return results; - }, - - 'empty': function(nodes, value, root) { - for (var i = 0, results = [], node; node = nodes[i]; i++) { - // IE treats comments as element nodes - if (node.tagName == '!' || node.firstChild) continue; - results.push(node); - } - return results; - }, - - 'not': function(nodes, selector, root) { - var h = Selector.handlers, selectorType, m; - var exclusions = new Selector(selector).findElements(root); - h.mark(exclusions); - for (var i = 0, results = [], node; node = nodes[i]; i++) - if (!node._countedByPrototype) results.push(node); - h.unmark(exclusions); - return results; - }, - - 'enabled': function(nodes, value, root) { - for (var i = 0, results = [], node; node = nodes[i]; i++) - if (!node.disabled && (!node.type || node.type !== 'hidden')) - results.push(node); - return results; - }, - - 'disabled': function(nodes, value, root) { - for (var i = 0, results = [], node; node = nodes[i]; i++) - if (node.disabled) results.push(node); - return results; - }, - - 'checked': function(nodes, value, root) { - for (var i = 0, results = [], node; node = nodes[i]; i++) - if (node.checked) results.push(node); - return results; - } - }, - - operators: { - '=': function(nv, v) { return nv == v; }, - '!=': function(nv, v) { return nv != v; }, - '^=': function(nv, v) { return nv == v || nv && nv.startsWith(v); }, - '$=': function(nv, v) { return nv == v || nv && nv.endsWith(v); }, - '*=': function(nv, v) { return nv == v || nv && nv.include(v); }, - '$=': function(nv, v) { return nv.endsWith(v); }, - '*=': function(nv, v) { return nv.include(v); }, - '~=': function(nv, v) { return (' ' + nv + ' ').include(' ' + v + ' '); }, - '|=': function(nv, v) { return ('-' + (nv || "").toUpperCase() + - '-').include('-' + (v || "").toUpperCase() + '-'); } - }, - - split: function(expression) { - var expressions = []; - expression.scan(/(([\w#:.~>+()\s-]+|\*|\[.*?\])+)\s*(,|$)/, function(m) { - expressions.push(m[1].strip()); - }); - return expressions; - }, - - matchElements: function(elements, expression) { - var matches = $$(expression), h = Selector.handlers; - h.mark(matches); - for (var i = 0, results = [], element; element = elements[i]; i++) - if (element._countedByPrototype) results.push(element); - h.unmark(matches); - return results; - }, - - findElement: function(elements, expression, index) { - if (Object.isNumber(expression)) { - index = expression; expression = false; - } - return Selector.matchElements(elements, expression || '*')[index || 0]; - }, - - findChildElements: function(element, expressions) { - expressions = Selector.split(expressions.join(',')); - var results = [], h = Selector.handlers; - for (var i = 0, l = expressions.length, selector; i < l; i++) { - selector = new Selector(expressions[i].strip()); - h.concat(results, selector.findElements(element)); - } - return (l > 1) ? h.unique(results) : results; - } -}); - -if (Prototype.Browser.IE) { - Object.extend(Selector.handlers, { - // IE returns comment nodes on getElementsByTagName("*"). - // Filter them out. - concat: function(a, b) { - for (var i = 0, node; node = b[i]; i++) - if (node.tagName !== "!") a.push(node); - return a; - }, - - // IE improperly serializes _countedByPrototype in (inner|outer)HTML. - unmark: function(nodes) { - for (var i = 0, node; node = nodes[i]; i++) - node.removeAttribute('_countedByPrototype'); - return nodes; - } - }); -} - -function $$() { - return Selector.findChildElements(document, $A(arguments)); -} -var Form = { - reset: function(form) { - $(form).reset(); - return form; - }, - - serializeElements: function(elements, options) { - if (typeof options != 'object') options = { hash: !!options }; - else if (Object.isUndefined(options.hash)) options.hash = true; - var key, value, submitted = false, submit = options.submit; - - var data = elements.inject({ }, function(result, element) { - if (!element.disabled && element.name) { - key = element.name; value = $(element).getValue(); - if (value != null && element.type != 'file' && (element.type != 'submit' || (!submitted && - submit !== false && (!submit || key == submit) && (submitted = true)))) { - if (key in result) { - // a key is already present; construct an array of values - if (!Object.isArray(result[key])) result[key] = [result[key]]; - result[key].push(value); - } - else result[key] = value; - } - } - return result; - }); - - return options.hash ? data : Object.toQueryString(data); - } -}; - -Form.Methods = { - serialize: function(form, options) { - return Form.serializeElements(Form.getElements(form), options); - }, - - getElements: function(form) { - return $A($(form).getElementsByTagName('*')).inject([], - function(elements, child) { - if (Form.Element.Serializers[child.tagName.toLowerCase()]) - elements.push(Element.extend(child)); - return elements; - } - ); - }, - - getInputs: function(form, typeName, name) { - form = $(form); - var inputs = form.getElementsByTagName('input'); - - if (!typeName && !name) return $A(inputs).map(Element.extend); - - for (var i = 0, matchingInputs = [], length = inputs.length; i < length; i++) { - var input = inputs[i]; - if ((typeName && input.type != typeName) || (name && input.name != name)) - continue; - matchingInputs.push(Element.extend(input)); - } - - return matchingInputs; - }, - - disable: function(form) { - form = $(form); - Form.getElements(form).invoke('disable'); - return form; - }, - - enable: function(form) { - form = $(form); - Form.getElements(form).invoke('enable'); - return form; - }, - - findFirstElement: function(form) { - var elements = $(form).getElements().findAll(function(element) { - return 'hidden' != element.type && !element.disabled; - }); - var firstByIndex = elements.findAll(function(element) { - return element.hasAttribute('tabIndex') && element.tabIndex >= 0; - }).sortBy(function(element) { return element.tabIndex }).first(); - - return firstByIndex ? firstByIndex : elements.find(function(element) { - return ['input', 'select', 'textarea'].include(element.tagName.toLowerCase()); - }); - }, - - focusFirstElement: function(form) { - form = $(form); - form.findFirstElement().activate(); - return form; - }, - - request: function(form, options) { - form = $(form), options = Object.clone(options || { }); - - var params = options.parameters, action = form.readAttribute('action') || ''; - if (action.blank()) action = window.location.href; - options.parameters = form.serialize(true); - - if (params) { - if (Object.isString(params)) params = params.toQueryParams(); - Object.extend(options.parameters, params); - } - - if (form.hasAttribute('method') && !options.method) - options.method = form.method; - - return new Ajax.Request(action, options); - } -}; - -/*--------------------------------------------------------------------------*/ - -Form.Element = { - focus: function(element) { - $(element).focus(); - return element; - }, - - select: function(element) { - $(element).select(); - return element; - } -}; - -Form.Element.Methods = { - serialize: function(element) { - element = $(element); - if (!element.disabled && element.name) { - var value = element.getValue(); - if (value != undefined) { - var pair = { }; - pair[element.name] = value; - return Object.toQueryString(pair); - } - } - return ''; - }, - - getValue: function(element) { - element = $(element); - var method = element.tagName.toLowerCase(); - return Form.Element.Serializers[method](element); - }, - - setValue: function(element, value) { - element = $(element); - var method = element.tagName.toLowerCase(); - Form.Element.Serializers[method](element, value); - return element; - }, - - clear: function(element) { - $(element).value = ''; - return element; - }, - - present: function(element) { - return $(element).value != ''; - }, - - activate: function(element) { - element = $(element); - try { - element.focus(); - if (element.select && (element.tagName.toLowerCase() != 'input' || - !['button', 'reset', 'submit'].include(element.type))) - element.select(); - } catch (e) { } - return element; - }, - - disable: function(element) { - element = $(element); - element.disabled = true; - return element; - }, - - enable: function(element) { - element = $(element); - element.disabled = false; - return element; - } -}; - -/*--------------------------------------------------------------------------*/ - -var Field = Form.Element; -var $F = Form.Element.Methods.getValue; - -/*--------------------------------------------------------------------------*/ - -Form.Element.Serializers = { - input: function(element, value) { - switch (element.type.toLowerCase()) { - case 'checkbox': - case 'radio': - return Form.Element.Serializers.inputSelector(element, value); - default: - return Form.Element.Serializers.textarea(element, value); - } - }, - - inputSelector: function(element, value) { - if (Object.isUndefined(value)) return element.checked ? element.value : null; - else element.checked = !!value; - }, - - textarea: function(element, value) { - if (Object.isUndefined(value)) return element.value; - else element.value = value; - }, - - select: function(element, value) { - if (Object.isUndefined(value)) - return this[element.type == 'select-one' ? - 'selectOne' : 'selectMany'](element); - else { - var opt, currentValue, single = !Object.isArray(value); - for (var i = 0, length = element.length; i < length; i++) { - opt = element.options[i]; - currentValue = this.optionValue(opt); - if (single) { - if (currentValue == value) { - opt.selected = true; - return; - } - } - else opt.selected = value.include(currentValue); - } - } - }, - - selectOne: function(element) { - var index = element.selectedIndex; - return index >= 0 ? this.optionValue(element.options[index]) : null; - }, - - selectMany: function(element) { - var values, length = element.length; - if (!length) return null; - - for (var i = 0, values = []; i < length; i++) { - var opt = element.options[i]; - if (opt.selected) values.push(this.optionValue(opt)); - } - return values; - }, - - optionValue: function(opt) { - // extend element because hasAttribute may not be native - return Element.extend(opt).hasAttribute('value') ? opt.value : opt.text; - } -}; - -/*--------------------------------------------------------------------------*/ - -Abstract.TimedObserver = Class.create(PeriodicalExecuter, { - initialize: function($super, element, frequency, callback) { - $super(callback, frequency); - this.element = $(element); - this.lastValue = this.getValue(); - }, - - execute: function() { - var value = this.getValue(); - if (Object.isString(this.lastValue) && Object.isString(value) ? - this.lastValue != value : String(this.lastValue) != String(value)) { - this.callback(this.element, value); - this.lastValue = value; - } - } -}); - -Form.Element.Observer = Class.create(Abstract.TimedObserver, { - getValue: function() { - return Form.Element.getValue(this.element); - } -}); - -Form.Observer = Class.create(Abstract.TimedObserver, { - getValue: function() { - return Form.serialize(this.element); - } -}); - -/*--------------------------------------------------------------------------*/ - -Abstract.EventObserver = Class.create({ - initialize: function(element, callback) { - this.element = $(element); - this.callback = callback; - - this.lastValue = this.getValue(); - if (this.element.tagName.toLowerCase() == 'form') - this.registerFormCallbacks(); - else - this.registerCallback(this.element); - }, - - onElementEvent: function() { - var value = this.getValue(); - if (this.lastValue != value) { - this.callback(this.element, value); - this.lastValue = value; - } - }, - - registerFormCallbacks: function() { - Form.getElements(this.element).each(this.registerCallback, this); - }, - - registerCallback: function(element) { - if (element.type) { - switch (element.type.toLowerCase()) { - case 'checkbox': - case 'radio': - Event.observe(element, 'click', this.onElementEvent.bind(this)); - break; - default: - Event.observe(element, 'change', this.onElementEvent.bind(this)); - break; - } - } - } -}); - -Form.Element.EventObserver = Class.create(Abstract.EventObserver, { - getValue: function() { - return Form.Element.getValue(this.element); - } -}); - -Form.EventObserver = Class.create(Abstract.EventObserver, { - getValue: function() { - return Form.serialize(this.element); - } -}); -if (!window.Event) var Event = { }; - -Object.extend(Event, { - KEY_BACKSPACE: 8, - KEY_TAB: 9, - KEY_RETURN: 13, - KEY_ESC: 27, - KEY_LEFT: 37, - KEY_UP: 38, - KEY_RIGHT: 39, - KEY_DOWN: 40, - KEY_DELETE: 46, - KEY_HOME: 36, - KEY_END: 35, - KEY_PAGEUP: 33, - KEY_PAGEDOWN: 34, - KEY_INSERT: 45, - - cache: { }, - - relatedTarget: function(event) { - var element; - switch(event.type) { - case 'mouseover': element = event.fromElement; break; - case 'mouseout': element = event.toElement; break; - default: return null; - } - return Element.extend(element); - } -}); - -Event.Methods = (function() { - var isButton; - - if (Prototype.Browser.IE) { - var buttonMap = { 0: 1, 1: 4, 2: 2 }; - isButton = function(event, code) { - return event.button == buttonMap[code]; - }; - - } else if (Prototype.Browser.WebKit) { - isButton = function(event, code) { - switch (code) { - case 0: return event.which == 1 && !event.metaKey; - case 1: return event.which == 1 && event.metaKey; - default: return false; - } - }; - - } else { - isButton = function(event, code) { - return event.which ? (event.which === code + 1) : (event.button === code); - }; - } - - return { - isLeftClick: function(event) { return isButton(event, 0) }, - isMiddleClick: function(event) { return isButton(event, 1) }, - isRightClick: function(event) { return isButton(event, 2) }, - - element: function(event) { - event = Event.extend(event); - - var node = event.target, - type = event.type, - currentTarget = event.currentTarget; - - if (currentTarget && currentTarget.tagName) { - // Firefox screws up the "click" event when moving between radio buttons - // via arrow keys. It also screws up the "load" and "error" events on images, - // reporting the document as the target instead of the original image. - if (type === 'load' || type === 'error' || - (type === 'click' && currentTarget.tagName.toLowerCase() === 'input' - && currentTarget.type === 'radio')) - node = currentTarget; - } - if (node.nodeType == Node.TEXT_NODE) node = node.parentNode; - return Element.extend(node); - }, - - findElement: function(event, expression) { - var element = Event.element(event); - if (!expression) return element; - var elements = [element].concat(element.ancestors()); - return Selector.findElement(elements, expression, 0); - }, - - pointer: function(event) { - var docElement = document.documentElement, - body = document.body || { scrollLeft: 0, scrollTop: 0 }; - return { - x: event.pageX || (event.clientX + - (docElement.scrollLeft || body.scrollLeft) - - (docElement.clientLeft || 0)), - y: event.pageY || (event.clientY + - (docElement.scrollTop || body.scrollTop) - - (docElement.clientTop || 0)) - }; - }, - - pointerX: function(event) { return Event.pointer(event).x }, - pointerY: function(event) { return Event.pointer(event).y }, - - stop: function(event) { - Event.extend(event); - event.preventDefault(); - event.stopPropagation(); - event.stopped = true; - } - }; -})(); - -Event.extend = (function() { - var methods = Object.keys(Event.Methods).inject({ }, function(m, name) { - m[name] = Event.Methods[name].methodize(); - return m; - }); - - if (Prototype.Browser.IE) { - Object.extend(methods, { - stopPropagation: function() { this.cancelBubble = true }, - preventDefault: function() { this.returnValue = false }, - inspect: function() { return "[object Event]" } - }); - - return function(event) { - if (!event) return false; - if (event._extendedByPrototype) return event; - - event._extendedByPrototype = Prototype.emptyFunction; - var pointer = Event.pointer(event); - Object.extend(event, { - target: event.srcElement, - relatedTarget: Event.relatedTarget(event), - pageX: pointer.x, - pageY: pointer.y - }); - return Object.extend(event, methods); - }; - - } else { - Event.prototype = Event.prototype || document.createEvent("HTMLEvents")['__proto__']; - Object.extend(Event.prototype, methods); - return Prototype.K; - } -})(); - -Object.extend(Event, (function() { - var cache = Event.cache; - - function getEventID(element) { - if (element._prototypeEventID) return element._prototypeEventID[0]; - arguments.callee.id = arguments.callee.id || 1; - return element._prototypeEventID = [++arguments.callee.id]; - } - - function getDOMEventName(eventName) { - if (eventName && eventName.include(':')) return "dataavailable"; - return eventName; - } - - function getCacheForID(id) { - return cache[id] = cache[id] || { }; - } - - function getWrappersForEventName(id, eventName) { - var c = getCacheForID(id); - return c[eventName] = c[eventName] || []; - } - - function createWrapper(element, eventName, handler) { - var id = getEventID(element); - var c = getWrappersForEventName(id, eventName); - if (c.pluck("handler").include(handler)) return false; - - var wrapper = function(event) { - if (!Event || !Event.extend || - (event.eventName && event.eventName != eventName)) - return false; - - Event.extend(event); - handler.call(element, event); - }; - - wrapper.handler = handler; - c.push(wrapper); - return wrapper; - } - - function findWrapper(id, eventName, handler) { - var c = getWrappersForEventName(id, eventName); - return c.find(function(wrapper) { return wrapper.handler == handler }); - } - - function destroyWrapper(id, eventName, handler) { - var c = getCacheForID(id); - if (!c[eventName]) return false; - c[eventName] = c[eventName].without(findWrapper(id, eventName, handler)); - } - - function destroyCache() { - for (var id in cache) - for (var eventName in cache[id]) - cache[id][eventName] = null; - } - - - // Internet Explorer needs to remove event handlers on page unload - // in order to avoid memory leaks. - if (window.attachEvent) { - window.attachEvent("onunload", destroyCache); - } - - // Safari has a dummy event handler on page unload so that it won't - // use its bfcache. Safari <= 3.1 has an issue with restoring the "document" - // object when page is returned to via the back button using its bfcache. - if (Prototype.Browser.WebKit) { - window.addEventListener('unload', Prototype.emptyFunction, false); - } - - return { - observe: function(element, eventName, handler) { - element = $(element); - var name = getDOMEventName(eventName); - - var wrapper = createWrapper(element, eventName, handler); - if (!wrapper) return element; - - if (element.addEventListener) { - element.addEventListener(name, wrapper, false); - } else { - element.attachEvent("on" + name, wrapper); - } - - return element; - }, - - stopObserving: function(element, eventName, handler) { - element = $(element); - var id = getEventID(element), name = getDOMEventName(eventName); - - if (!handler && eventName) { - getWrappersForEventName(id, eventName).each(function(wrapper) { - element.stopObserving(eventName, wrapper.handler); - }); - return element; - - } else if (!eventName) { - Object.keys(getCacheForID(id)).each(function(eventName) { - element.stopObserving(eventName); - }); - return element; - } - - var wrapper = findWrapper(id, eventName, handler); - if (!wrapper) return element; - - if (element.removeEventListener) { - element.removeEventListener(name, wrapper, false); - } else { - element.detachEvent("on" + name, wrapper); - } - - destroyWrapper(id, eventName, handler); - - return element; - }, - - fire: function(element, eventName, memo) { - element = $(element); - if (element == document && document.createEvent && !element.dispatchEvent) - element = document.documentElement; - - var event; - if (document.createEvent) { - event = document.createEvent("HTMLEvents"); - event.initEvent("dataavailable", true, true); - } else { - event = document.createEventObject(); - event.eventType = "ondataavailable"; - } - - event.eventName = eventName; - event.memo = memo || { }; - - if (document.createEvent) { - element.dispatchEvent(event); - } else { - element.fireEvent(event.eventType, event); - } - - return Event.extend(event); - } - }; -})()); - -Object.extend(Event, Event.Methods); - -Element.addMethods({ - fire: Event.fire, - observe: Event.observe, - stopObserving: Event.stopObserving -}); - -Object.extend(document, { - fire: Element.Methods.fire.methodize(), - observe: Element.Methods.observe.methodize(), - stopObserving: Element.Methods.stopObserving.methodize(), - loaded: false -}); - -(function() { - /* Support for the DOMContentLoaded event is based on work by Dan Webb, - Matthias Miller, Dean Edwards and John Resig. */ - - var timer; - - function fireContentLoadedEvent() { - if (document.loaded) return; - if (timer) window.clearInterval(timer); - document.fire("dom:loaded"); - document.loaded = true; - } - - if (document.addEventListener) { - if (Prototype.Browser.WebKit) { - timer = window.setInterval(function() { - if (/loaded|complete/.test(document.readyState)) - fireContentLoadedEvent(); - }, 0); - - Event.observe(window, "load", fireContentLoadedEvent); - - } else { - document.addEventListener("DOMContentLoaded", - fireContentLoadedEvent, false); - } - - } else { - document.write("