2 * Jalview - A Sequence Alignment Editor and Viewer ($$Version-Rel$$)
3 * Copyright (C) $$Year-Rel$$ The Jalview Authors
5 * This file is part of Jalview.
7 * Jalview is free software: you can redistribute it and/or
8 * modify it under the terms of the GNU General Public License
9 * as published by the Free Software Foundation, either version 3
10 * of the License, or (at your option) any later version.
12 * Jalview is distributed in the hope that it will be useful, but
13 * WITHOUT ANY WARRANTY; without even the implied warranty
14 * of MERCHANTABILITY or FITNESS FOR A PARTICULAR
15 * PURPOSE. See the GNU General Public License for more details.
17 * You should have received a copy of the GNU General Public License
18 * along with Jalview. If not, see <http://www.gnu.org/licenses/>.
19 * The Jalview Authors are detailed in the 'AUTHORS' file.
21 package jalview.ws.sifts;
23 import static org.testng.Assert.assertEquals;
24 import static org.testng.Assert.assertTrue;
26 import jalview.api.DBRefEntryI;
27 import jalview.bin.Cache;
28 import jalview.datamodel.DBRefEntry;
29 import jalview.datamodel.DBRefSource;
30 import jalview.datamodel.Sequence;
31 import jalview.datamodel.SequenceI;
32 import jalview.gui.JvOptionPane;
33 import jalview.io.DataSourceType;
34 import jalview.structure.StructureMapping;
35 import jalview.xml.binding.sifts.Entry.Entity;
38 import java.io.IOException;
39 import java.util.ArrayList;
40 import java.util.HashMap;
41 import java.util.Iterator;
44 import org.testng.Assert;
45 import org.testng.FileAssert;
46 import org.testng.annotations.AfterTest;
47 import org.testng.annotations.BeforeClass;
48 import org.testng.annotations.BeforeTest;
49 import org.testng.annotations.Test;
52 import MCview.PDBfile;
54 public class SiftsClientTest
57 @BeforeClass(alwaysRun = true)
58 public void setUpJvOptionPane()
60 JvOptionPane.setInteractiveMode(false);
61 JvOptionPane.setMockResponse(JvOptionPane.CANCEL_OPTION);
64 public static final String DEFAULT_SIFTS_DOWNLOAD_DIR = System
65 .getProperty("user.home")
67 + ".sifts_downloads" + File.separatorChar;
69 private String testPDBId = "1a70";
71 private SiftsClient siftsClient = null;
73 SequenceI testSeq = new Sequence(
75 "MAAT..TTTMMG..MATTFVPKPQAPPMMAALPSNTGR..SLFGLKT.GSR..GGRMTMA"
76 + "AYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDD"
77 + "QSFLDDDQIDEGWVLTCAAYPVSDVTIETHKEEELTA.", 1, 147);
79 int u = SiftsClient.UNASSIGNED;
81 HashMap<Integer, int[]> expectedMapping = new HashMap<Integer, int[]>();
83 @BeforeTest(alwaysRun = true)
84 public void populateExpectedMapping() throws SiftsException
86 expectedMapping.put(51, new int[] { 1, 2 });
87 expectedMapping.put(52, new int[] { 2, 7 });
88 expectedMapping.put(53, new int[] { 3, 12 });
89 expectedMapping.put(54, new int[] { 4, 24 });
90 expectedMapping.put(55, new int[] { 5, 33 });
91 expectedMapping.put(56, new int[] { 6, 40 });
92 expectedMapping.put(57, new int[] { 7, 47 });
93 expectedMapping.put(58, new int[] { 8, 55 });
94 expectedMapping.put(59, new int[] { 9, 62 });
95 expectedMapping.put(60, new int[] { 10, 69 });
96 expectedMapping.put(61, new int[] { 11, 76 });
97 expectedMapping.put(62, new int[] { 12, 83 });
98 expectedMapping.put(63, new int[] { 13, 87 });
99 expectedMapping.put(64, new int[] { 14, 95 });
100 expectedMapping.put(65, new int[] { 15, 102 });
101 expectedMapping.put(66, new int[] { 16, 111 });
102 expectedMapping.put(67, new int[] { 17, 122 });
103 expectedMapping.put(68, new int[] { 18, 131 });
104 expectedMapping.put(69, new int[] { 19, 137 });
105 expectedMapping.put(70, new int[] { 20, 144 });
106 expectedMapping.put(71, new int[] { 21, 152 });
107 expectedMapping.put(72, new int[] { 22, 160 });
108 expectedMapping.put(73, new int[] { 23, 167 });
109 expectedMapping.put(74, new int[] { 24, 179 });
110 expectedMapping.put(75, new int[] { 25, 187 });
111 expectedMapping.put(76, new int[] { 26, 195 });
112 expectedMapping.put(77, new int[] { 27, 203 });
113 expectedMapping.put(78, new int[] { 28, 208 });
114 expectedMapping.put(79, new int[] { 29, 213 });
115 expectedMapping.put(80, new int[] { 30, 222 });
116 expectedMapping.put(81, new int[] { 31, 231 });
117 expectedMapping.put(82, new int[] { 32, 240 });
118 expectedMapping.put(83, new int[] { 33, 244 });
119 expectedMapping.put(84, new int[] { 34, 252 });
120 expectedMapping.put(85, new int[] { 35, 260 });
121 expectedMapping.put(86, new int[] { 36, 268 });
122 expectedMapping.put(87, new int[] { 37, 275 });
123 expectedMapping.put(88, new int[] { 38, 287 });
124 expectedMapping.put(89, new int[] { 39, 293 });
125 expectedMapping.put(90, new int[] { 40, 299 });
126 expectedMapping.put(91, new int[] { 41, 310 });
127 expectedMapping.put(92, new int[] { 42, 315 });
128 expectedMapping.put(93, new int[] { 43, 319 });
129 expectedMapping.put(94, new int[] { 44, 325 });
130 expectedMapping.put(95, new int[] { 45, 331 });
131 expectedMapping.put(96, new int[] { 46, 337 });
132 expectedMapping.put(97, new int[] { 47, 343 });
133 expectedMapping.put(98, new int[] { 48, 349 });
134 expectedMapping.put(99, new int[] { 49, 354 });
135 expectedMapping.put(100, new int[] { 50, 358 });
136 expectedMapping.put(101, new int[] { 51, 367 });
137 expectedMapping.put(102, new int[] { 52, 375 });
138 expectedMapping.put(103, new int[] { 53, 384 });
139 expectedMapping.put(104, new int[] { 54, 391 });
140 expectedMapping.put(105, new int[] { 55, 395 });
141 expectedMapping.put(106, new int[] { 56, 401 });
142 expectedMapping.put(107, new int[] { 57, 409 });
143 expectedMapping.put(108, new int[] { 58, 417 });
144 expectedMapping.put(109, new int[] { 59, 426 });
145 expectedMapping.put(110, new int[] { 60, 434 });
146 expectedMapping.put(111, new int[] { 61, 442 });
147 expectedMapping.put(112, new int[] { 62, 451 });
148 expectedMapping.put(113, new int[] { 63, 457 });
149 expectedMapping.put(114, new int[] { 64, 468 });
150 expectedMapping.put(115, new int[] { 65, 476 });
151 expectedMapping.put(116, new int[] { 66, 484 });
152 expectedMapping.put(117, new int[] { 67, 492 });
153 expectedMapping.put(118, new int[] { 68, 500 });
154 expectedMapping.put(119, new int[] { 69, 509 });
155 expectedMapping.put(120, new int[] { 70, 517 });
156 expectedMapping.put(121, new int[] { 71, 525 });
157 expectedMapping.put(122, new int[] { 72, 534 });
158 expectedMapping.put(123, new int[] { 73, 538 });
159 expectedMapping.put(124, new int[] { 74, 552 });
160 expectedMapping.put(125, new int[] { 75, 559 });
161 expectedMapping.put(126, new int[] { 76, 567 });
162 expectedMapping.put(127, new int[] { 77, 574 });
163 expectedMapping.put(128, new int[] { 78, 580 });
164 expectedMapping.put(129, new int[] { 79, 585 });
165 expectedMapping.put(130, new int[] { 80, 590 });
166 expectedMapping.put(131, new int[] { 81, 602 });
167 expectedMapping.put(132, new int[] { 82, 609 });
168 expectedMapping.put(133, new int[] { 83, 616 });
169 expectedMapping.put(134, new int[] { 84, 622 });
170 expectedMapping.put(135, new int[] { 85, 630 });
171 expectedMapping.put(136, new int[] { 86, 637 });
172 expectedMapping.put(137, new int[] { 87, 644 });
173 expectedMapping.put(138, new int[] { 88, 652 });
174 expectedMapping.put(139, new int[] { 89, 661 });
175 expectedMapping.put(140, new int[] { 90, 668 });
176 expectedMapping.put(141, new int[] { 91, 678 });
177 expectedMapping.put(142, new int[] { 92, 687 });
178 expectedMapping.put(143, new int[] { 93, 696 });
179 expectedMapping.put(144, new int[] { 94, 705 });
180 expectedMapping.put(145, new int[] { 95, 714 });
181 expectedMapping.put(146, new int[] { 96, 722 });
182 expectedMapping.put(147, new int[] { 97, 729 });
185 @BeforeTest(alwaysRun = true)
186 public void setUpSiftsClient() throws SiftsException, IOException
188 // read test props before manipulating config
189 Cache.loadProperties("test/jalview/io/testProps.jvprops");
190 // SIFTs entries are updated weekly - so use saved SIFTs file to enforce
191 // test reproducibility
193 SiftsSettings.setSiftDownloadDirectory(jalview.bin.Cache.getDefault(
194 "sifts_download_dir", DEFAULT_SIFTS_DOWNLOAD_DIR));
195 SiftsSettings.setMapWithSifts(true);
196 SiftsSettings.setCacheThresholdInDays("2");
197 SiftsSettings.setFailSafePIDThreshold("70");
199 pdbFile = new PDBfile(false, false, false, "test/jalview/io/"
200 + testPDBId + ".pdb", DataSourceType.FILE);
201 siftsClient = new SiftsClient(pdbFile);
204 @AfterTest(alwaysRun = true)
205 public void cleanUpSiftsClient()
210 @Test(groups = { "Network" })
211 public void getSIFTsFileTest() throws SiftsException, IOException
214 siftsFile = SiftsClient.downloadSiftsFile(testPDBId);
215 FileAssert.assertFile(siftsFile);
216 long t1 = siftsFile.lastModified();
218 // re-read file should be returned from cache
219 siftsFile = SiftsClient.downloadSiftsFile(testPDBId);
220 FileAssert.assertFile(siftsFile);
221 long t2 = siftsFile.lastModified();
222 assertEquals(t1, t2);
225 * force fetch by having 0 expiry of cache
226 * also wait one second, because file timestamp does not
227 * give millisecond resolution :-(
234 } catch (InterruptedException e)
238 SiftsSettings.setCacheThresholdInDays("0");
239 siftsFile = SiftsClient.getSiftsFile(testPDBId);
240 FileAssert.assertFile(siftsFile);
241 long t3 = siftsFile.lastModified();
242 assertTrue(t3 > t2, "file timestamp unchanged at " + t3);
244 SiftsSettings.setCacheThresholdInDays("2");
247 @Test(groups = { "Network" })
248 public void downloadSiftsFileTest() throws SiftsException, IOException
250 // Assert that file isn't yet downloaded - if already downloaded, assert it
252 Assert.assertTrue(SiftsClient.deleteSiftsFileByPDBId(testPDBId));
254 siftsFile = SiftsClient.downloadSiftsFile(testPDBId);
255 FileAssert.assertFile(siftsFile);
256 SiftsClient.downloadSiftsFile(testPDBId);
259 @Test(groups = { "Network" })
260 public void getAllMappingAccessionTest()
262 Assert.assertNotNull(siftsClient);
263 Assert.assertNotNull(siftsClient.getAllMappingAccession());
264 Assert.assertTrue(siftsClient.getAllMappingAccession().size() > 1);
267 @Test(groups = { "Network" })
268 public void getGreedyMappingTest()
270 Assert.assertNotNull(siftsClient);
271 Assert.assertNotNull(testSeq);
272 Assert.assertNotNull(expectedMapping);
274 // TODO delete when auto-fetching of DBRefEntry is implemented
275 DBRefEntry dbRef = new DBRefEntry("uniprot", "", "P00221");
276 testSeq.addDBRef(dbRef);
277 // testSeq.setSourceDBRef(dbRef);
281 HashMap<Integer, int[]> actualMapping = siftsClient.getGreedyMapping(
283 Assert.assertEquals(testSeq.getStart(), 1);
284 Assert.assertEquals(testSeq.getEnd(), 147);
285 // Can't do Assert.assertEquals(actualMapping, expectedMapping);
286 // because this fails in our version of TestNG
287 Assert.assertEquals(actualMapping.size(), expectedMapping.size());
288 Iterator<Map.Entry<Integer, int[]>> it = expectedMapping.entrySet()
292 Map.Entry<Integer, int[]> pair = it.next();
293 Assert.assertTrue(actualMapping.containsKey(pair.getKey()));
294 Assert.assertEquals(actualMapping.get(pair.getKey()),
298 } catch (Exception e)
301 Assert.fail("Exception thrown while generating mapping...");
305 @Test(groups = { "Network" })
306 private void getAtomIndexTest()
308 ArrayList<Atom> atoms = new ArrayList<Atom>();
309 Atom atom = new Atom(u, u, u);
313 int actualAtomIndex = siftsClient.getAtomIndex(1, atoms);
314 Assert.assertEquals(actualAtomIndex, -1);
315 actualAtomIndex = siftsClient.getAtomIndex(43, atoms);
316 Assert.assertEquals(actualAtomIndex, 7);
320 groups = { "Network" },
321 expectedExceptions = IllegalArgumentException.class)
322 private void getAtomIndexNullTest()
324 siftsClient.getAtomIndex(1, null);
327 @Test(groups = { "Network" })
328 private void padWithGapsTest()
334 groups = { "Network" },
335 expectedExceptions = SiftsException.class)
336 private void populateAtomPositionsNullTest1()
337 throws IllegalArgumentException, SiftsException
339 siftsClient.populateAtomPositions(null, null);
343 groups = { "Network" },
344 expectedExceptions = SiftsException.class)
345 private void populateAtomPositionsNullTest2()
346 throws IllegalArgumentException, SiftsException
348 siftsClient.populateAtomPositions("A", null);
351 @Test(groups = { "Network" })
352 public void getValidSourceDBRefTest() throws SiftsException
354 DBRefEntryI actualValidSrcDBRef = siftsClient
355 .getValidSourceDBRef(testSeq);
356 DBRefEntryI expectedDBRef = new DBRefEntry();
357 expectedDBRef.setSource(DBRefSource.UNIPROT);
358 expectedDBRef.setAccessionId("P00221");
359 expectedDBRef.setVersion("");
360 Assert.assertEquals(actualValidSrcDBRef, expectedDBRef);
364 groups = { "Network" },
365 expectedExceptions = SiftsException.class)
366 public void getValidSourceDBRefExceptionTest() throws SiftsException
368 SequenceI invalidTestSeq = new Sequence("testSeq", "ABCDEFGH");
369 siftsClient.getValidSourceDBRef(invalidTestSeq);
373 groups = { "Network" },
374 expectedExceptions = SiftsException.class)
375 public void getValidSourceDBRefExceptionXTest() throws SiftsException
377 SequenceI invalidTestSeq = new Sequence("testSeq", "ABCDEFGH");
378 DBRefEntry invalidDBRef = new DBRefEntry();
379 invalidDBRef.setAccessionId("BLAR");
380 invalidTestSeq.addDBRef(invalidDBRef);
381 siftsClient.getValidSourceDBRef(invalidTestSeq);
384 @Test(groups = { "Network" })
385 public void isValidDBRefEntryTest()
387 DBRefEntryI validDBRef = new DBRefEntry();
388 validDBRef.setSource(DBRefSource.UNIPROT);
389 validDBRef.setAccessionId("P00221");
390 validDBRef.setVersion("");
391 Assert.assertTrue(siftsClient.isValidDBRefEntry(validDBRef));
394 @Test(groups = { "Network" })
395 public void getSiftsStructureMappingTest() throws SiftsException
397 Assert.assertTrue(SiftsSettings.isMapWithSifts());
398 StructureMapping strucMapping = siftsClient.getSiftsStructureMapping(
399 testSeq, testPDBId, "A");
400 String expectedMappingOutput = "\nSequence ⟷ Structure mapping details\n"
401 + "Method: SIFTS\n\n"
402 + "P00221 : 51 - 147 Maps to \n"
403 + "1A70|A : 1 - 97\n\n"
404 + "P00221 AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLD\n"
405 + " |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||\n"
406 + "1A70|A AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLD\n\n"
408 + "P00221 DDQIDEGWVLTCAAYPVSDVTIETHKEEELTA\n"
409 + " |||||||||||||||||||||||||| |||||\n"
410 + "1A70|A DDQIDEGWVLTCAAYPVSDVTIETHKKEELTA\n\n" +
412 "Length of alignment = 97\n" + "Percentage ID = 98.97\n";
414 Assert.assertEquals(strucMapping.getMappingDetailsOutput(),
415 expectedMappingOutput);
417 // Can't do Assert.assertEquals(strucMapping.getMapping(), expectedMapping);
418 // because this fails in our version of TestNG
419 Assert.assertEquals(strucMapping.getMapping().size(),
420 expectedMapping.size());
421 Iterator<Map.Entry<Integer, int[]>> it = expectedMapping.entrySet()
425 Map.Entry<Integer, int[]> pair = it.next();
426 Assert.assertTrue(strucMapping.getMapping()
427 .containsKey(pair.getKey()));
428 Assert.assertEquals(strucMapping.getMapping().get(pair.getKey()),
433 @Test(groups = { "Network" })
434 public void getEntityCountTest()
436 int actualEntityCount = siftsClient.getEntityCount();
437 System.out.println("actual entity count : " + actualEntityCount);
438 Assert.assertEquals(actualEntityCount, 1);
441 @Test(groups = { "Network" })
442 public void getDbAccessionIdTest()
444 String actualDbAccId = siftsClient.getDbAccessionId();
445 System.out.println("Actual Db Accession Id: " + actualDbAccId);
446 Assert.assertEquals(actualDbAccId, "1a70");
449 @Test(groups = { "Network" })
450 public void getDbCoordSysTest()
452 String actualDbCoordSys = siftsClient.getDbCoordSys();
453 System.out.println("Actual DbCoordSys: " + actualDbCoordSys);
454 Assert.assertEquals(actualDbCoordSys, "PDBe");
457 @Test(groups = { "Network" })
458 public void getDbSourceTest()
460 String actualDbSource = siftsClient.getDbSource();
461 System.out.println("Actual DbSource: " + actualDbSource);
462 Assert.assertEquals(actualDbSource, "PDBe");
465 @Test(groups = { "Network" })
466 public void getDbVersionTest()
468 String actualDbVersion = siftsClient.getDbVersion();
469 System.out.println("Actual DbVersion: " + actualDbVersion);
470 Assert.assertEquals(actualDbVersion, "2.0");
473 @Test(groups = { "Network" })
474 public void getEntityByMostOptimalMatchedIdTest1() throws IOException,
477 SiftsClient siftsClientX = null;
479 pdbFile = new PDBfile(false, false, false, "test/jalview/io/2nq2"
480 + ".pdb", DataSourceType.FILE);
481 siftsClientX = new SiftsClient(pdbFile);
482 Entity entityA = siftsClientX.getEntityByMostOptimalMatchedId("A");
483 Assert.assertEquals(entityA.getEntityId(), "A");
484 Entity entityB = siftsClientX.getEntityByMostOptimalMatchedId("B");
485 Assert.assertEquals(entityB.getEntityId(), "C");
486 Entity entityC = siftsClientX.getEntityByMostOptimalMatchedId("C");
487 Assert.assertEquals(entityC.getEntityId(), "B");
488 Entity entityD = siftsClientX.getEntityByMostOptimalMatchedId("D");
489 Assert.assertEquals(entityD.getEntityId(), "D");
493 @Test(groups = { "Network" })
494 public void getEntityByMostOptimalMatchedIdTest2() throws IOException,
497 // This test is for a SIFTS file in which entity A should map to chain P for
498 // the given PDB Id. All the other chains shouldn't be mapped as there are
499 // no SIFTS entity records for them.
500 SiftsClient siftsClientX = null;
502 pdbFile = new PDBfile(false, false, false, "test/jalview/io/3ucu.cif",
503 DataSourceType.FILE);
504 siftsClientX = new SiftsClient(pdbFile);
505 Entity entityA = siftsClientX.getEntityByMostOptimalMatchedId("P");
506 Entity entityP = siftsClientX.getEntityByMostOptimalMatchedId("A");
507 Entity entityR = siftsClientX.getEntityByMostOptimalMatchedId("R");
508 Assert.assertEquals(entityA.getEntityId(), "A");
509 Assert.assertNotEquals(entityR, "A");
510 Assert.assertNotEquals(entityP, "A");
511 Assert.assertNotEquals(entityR, "R");
512 Assert.assertNotEquals(entityP, "P");
513 Assert.assertNull(entityR);
514 Assert.assertNull(entityP);