--- /dev/null
+package jalview.analysis;
+
+import static org.junit.Assert.assertEquals;
+import static org.junit.Assert.assertNotNull;
+import static org.junit.Assert.assertTrue;
+import jalview.api.AlignViewportI;
+import jalview.datamodel.AlignedCodon;
+import jalview.datamodel.Alignment;
+import jalview.datamodel.AlignmentI;
+import jalview.datamodel.ColumnSelection;
+import jalview.datamodel.SequenceI;
+import jalview.gui.AlignViewport;
+import jalview.io.FormatAdapter;
+
+import java.io.IOException;
+
+import org.junit.Test;
+
+public class DnaTest
+{
+ // @formatter:off
+ // AA encoding codons as ordered on the Jalview help page Amino Acid Table
+ private static String fasta = ">B\n" + "GCT" + "GCC" + "GCA" + "GCG"
+ + "TGT" + "TGC" + "GAT" + "GAC" + "GAA" + "GAG" + "TTT" + "TTC"
+ + "GGT" + "GGC" + "GGA" + "GGG" + "CAT" + "CAC" + "ATT" + "ATC"
+ + "ATA" + "AAA" + "AAG" + "TTG" + "TTA" + "CTT" + "CTC" + "CTA"
+ + "CTG" + "ATG" + "AAT" + "AAC" + "CCT" + "CCC" + "CCA" + "CCG"
+ + "CAA" + "CAG" + "CGT" + "CGC" + "CGA" + "CGG" + "AGA" + "AGG"
+ + "TCT" + "TCC" + "TCA" + "TCG" + "AGT" + "AGC" + "ACT" + "ACC"
+ + "ACA" + "ACG" + "GTT" + "GTC" + "GTA" + "GTG" + "TGG" + "TAT"
+ + "TAC" + "TAA" + "TAG" + "TGA";
+
+ private static String JAL_1312_example_align_fasta = ">B.FR.83.HXB2_LAI_IIIB_BRU_K03455/45-306\n"
+ + "ATGGGAAAAAATTCGGTTAAGGCCAGGGGGAAAGAAAAAATATAAATTAAAACATATAGTATGGGCAAGCAG\n"
+ + "GGAGCTAGAACGATTCGCAGTTAATCCTGGCCTGTTAGAAACATCAGAAGGCTGTAGACAAATACTGGGACA\n"
+ + "GCTACAACCATCCCTTCAGACAGGATCAGAAGAACTTAGATCATTATATAATACAGTAGCAACCCTCTATTG\n"
+ + "TGTGCATCAAAGGATAGAGATAAAAGACACCAAGGAAGCTTTAGAC\n"
+ + ">gi|27804621|gb|AY178912.1|/1-259\n"
+ + "-TGGGAGAA-ATTCGGTT-CGGCCAGGGGGAAAGAAAAAATATCAGTTAAAACATATAGTATGGGCAAGCAG\n"
+ + "AGAGCTAGAACGATTCGCAGTTAACCCTGGCCTTTTAGAGACATCACAAGGCTGTAGACAAATACTGGGACA\n"
+ + "GCTACAACCATCCCTTCAGACAGGATCAGAAGAACTTAAATCATTATATAATACAGTAGCAACCCTCTATTG\n"
+ + "TGTTCATCAAAGGATAGATATAAAAGACACCAAGGAAGCTTTAGAT\n"
+ + ">gi|27804623|gb|AY178913.1|/1-259\n"
+ + "-TGGGAGAA-ATTCGGTT-CGGCCAGGGGGAAAGAAAAAATATCAGTTAAAACATATAGTATGGGCAAGCAG\n"
+ + "AGAGCTAGAACGATTCGCAGTTAACCCTGGCCTTTTAGAGACATCACAAGGCTGTAGACAAATACTGGAACA\n"
+ + "GCTACAACCATCCCTTCAGACAGGATCAGAAGAACTTAAATCATTATATAATACAGTAGCAACCCTCTATTG\n"
+ + "TGTTCATCAAAGGATAGATGTAAAAGACACCAAGGAAGCTTTAGAT\n"
+ + ">gi|27804627|gb|AY178915.1|/1-260\n"
+ + "-TGGGAAAA-ATTCGGTTAAGGCCAGGGGGAAAGAAAAAATATAAGTTAAAACATATAGTATGGGCAAGCAG\n"
+ + "GGAGCTAGAACGATTCGCAGTTAACCCTGGCCTGTTAGAAACATCAGAAGGTTGTAGACAAATATTGGGACA\n"
+ + "GCTACAACCATCCCTTGAGACAGGATCAGAAGAACTTAAATCATTATWTAATACCATAGCAGTCCTCTATTG\n"
+ + "TGTACATCAAAGGATAGATATAAAAGACACCAAGGAAGCTTTAGAG\n"
+ + ">gi|27804631|gb|AY178917.1|/1-261\n"
+ + "-TGGGAAAAAATTCGGTTGAGGCCAGGGGGAAAGAAAAAATATAAGTTAAAACATATAGTATGGGCAAGCAG\n"
+ + "GGAGCTAGAACGATTCGCAGTCAACCCTGGCCTGTTAGAAACACCAGAAGGCTGTAGACAAATACTGGGACA\n"
+ + "GCTACAACCGTCCCTTCAGACAGGATCGGAAGAACTTAAATCATTATATAATACAGTAGCAACCCTCTATTG\n"
+ + "TGTGCATCAAAGGATAGATGTAAAAGACACCAAGGAGGCTTTAGAC\n"
+ + ">gi|27804635|gb|AY178919.1|/1-261\n"
+ + "-TGGGAGAGAATTCGGTTACGGCCAGGAGGAAAGAAAAAATATAAATTGAAACATATAGTATGGGCAGGCAG\n"
+ + "AGAGCTAGATCGATTCGCAGTCAATCCTGGCCTGTTAGAAACATCAGAAGGCTGCAGACAGATATTGGGACA\n"
+ + "GCTACAACCGTCCCTTAAGACAGGATCAGAAGAACTTAAATCATTATATAATACAGTAGCAACCCTCTATTG\n"
+ + "TGTACATCAAAGGATAGATGTAAAAGACACCAAGGAAGCTTTAGAT\n"
+ + ">gi|27804641|gb|AY178922.1|/1-261\n"
+ + "-TGGGAGAAAATTCGGTTACGGCCAGGGGGAAAGAAAAGATATAAGTTAAAACATATAGTATGGGCAAGCAG\n"
+ + "GGAGCTAGAACGATTCGCAGTCAACCCTGGCCTGTTAGAAACATCAGAAGGCTGCAGACAAATACTGGGACA\n"
+ + "GTTACACCCATCCCTTCATACAGGATCAGAAGAACTTAAATCATTATATAATACAGTAGCAACCCTCTATTG\n"
+ + "TGTGCATCAAAGGATAGAAGTAAAAGACACCAAGGAAGCTTTAGAC\n"
+ + ">gi|27804647|gb|AY178925.1|/1-261\n"
+ + "-TGGGAAAAAATTCGGTTAAGGCCAGGGGGAAAGAAAAAATATCAATTAAAACATGTAGTATGGGCAAGCAG\n"
+ + "GGAACTAGAACGATTCGCAGTTAATCCTGGCCTGTTAGAAACATCAGAAGGCTGTAGACAAATATTGGGACA\n"
+ + "GCTACAACCATCCCTTCAGACAGGATCAGAGGAACTTAAATCATTATTTAATACAGTAGCAGTCCTCTATTG\n"
+ + "TGTACATCAAAGAATAGATGTAAAAGACACCAAGGAAGCTCTAGAA\n"
+ + ">gi|27804649|gb|AY178926.1|/1-261\n"
+ + "-TGGGAAAAAATTCGGTTAAGGCCAGGGGGAAAGAAAAAATATAAGTTAAAACATATAGTATGGGCAAGCAG\n"
+ + "GGAGCTAGAACGATTCGCGGTCAATCCTGGCCTGTTAGAAACATCAGAAGGCTGTAGACAACTACTGGGACA\n"
+ + "GTTACAACCATCCCTTCAGACAGGATCAGAAGAACTCAAATCATTATATAATACAATAGCAACCCTCTATTG\n"
+ + "TGTGCATCAAAGGATAGAGATAAAAGACACCAAGGAAGCCTTAGAT\n"
+ + ">gi|27804653|gb|AY178928.1|/1-261\n"
+ + "-TGGGAAAGAATTCGGTTAAGGCCAGGGGGAAAGAAACAATATAAATTAAAACATATAGTATGGGCAAGCAG\n"
+ + "GGAGCTAGACCGATTCGCACTTAACCCCGGCCTGTTAGAAACATCAGAAGGCTGTAGACAAATATTGGGACA\n"
+ + "GCTACAATCGTCCCTTCAGACAGGATCAGAAGAACTTAGATCACTATATAATACAGTAGCAGTCCTCTATTG\n"
+ + "TGTGCATCAAAAGATAGATGTAAAAGACACCAAGGAAGCCTTAGAC\n"
+ + ">gi|27804659|gb|AY178931.1|/1-261\n"
+ + "-TGGGAAAAAATTCGGTTACGGCCAGGAGGAAAGAAAAGATATAAATTAAAACATATAGTATGGGCAAGCAG\n"
+ + "GGAGCTAGAACGATTYGCAGTTAATCCTGGCCTTTTAGAAACAGCAGAAGGCTGTAGACAAATACTGGGACA\n"
+ + "GCTACAACCATCCCTTCAGACAGGATCAGAAGAACTTAAATCATTATATAATACAGTAGCAACCCTCTATTG\n"
+ + "TGTACATCAAAGGATAGAGATAAAAGACACCAAGGAAGCTTTAGAA\n";
+ // @formatter:on
+
+ /**
+ * Corner case for this test is the presence of codons after codons that were
+ * not translated.
+ *
+ * @throws IOException
+ */
+ @Test
+ public void testTranslateCdna_withUntranslatableCodons()
+ throws IOException
+ {
+ AlignmentI alf = new FormatAdapter().readFile(
+ JAL_1312_example_align_fasta, jalview.io.FormatAdapter.PASTE,
+ "FASTA");
+ ColumnSelection cs = new ColumnSelection();
+ AlignViewportI av = new AlignViewport(alf, cs);
+ Dna dna = new Dna(av, new int[]
+ { 0, alf.getWidth() - 1 });
+ AlignmentI translated = dna.translateCdna();
+ assertNotNull("Couldn't do a full width translation of test data.",
+ translated);
+ }
+
+ /**
+ * Test variant in which 15 column blocks at a time are translated (the rest
+ * hidden).
+ *
+ * @throws IOException
+ */
+ @Test
+ public void testTranslateCdna_withUntranslatableCodonsAndHiddenColumns()
+ throws IOException
+ {
+ AlignmentI alf = new FormatAdapter().readFile(
+ JAL_1312_example_align_fasta, jalview.io.FormatAdapter.PASTE,
+ "FASTA");
+ int vwidth = 15;
+ for (int ipos = 0; ipos + vwidth < alf.getWidth(); ipos += vwidth)
+ {
+ ColumnSelection cs = new ColumnSelection();
+ if (ipos > 0)
+ {
+ cs.hideColumns(0, ipos - 1);
+ }
+ cs.hideColumns(ipos + vwidth, alf.getWidth());
+ int[] vcontigs = cs.getVisibleContigs(0, alf.getWidth());
+ AlignViewportI av = new AlignViewport(alf, cs);
+ Dna dna = new Dna(av, vcontigs);
+ AlignmentI transAlf = dna.translateCdna();
+
+ assertTrue("Translation failed (ipos=" + ipos
+ + ") No alignment data.", transAlf != null);
+ assertTrue("Translation failed (ipos=" + ipos + ") Empty alignment.",
+ transAlf.getHeight() > 0);
+ assertTrue("Translation failed (ipos=" + ipos + ") Translated "
+ + transAlf.getHeight() + " sequences from " + alf.getHeight()
+ + " sequences", alf.getHeight() == transAlf.getHeight());
+ }
+ }
+
+ /**
+ * Test simple translation to Amino Acids (with STOP codons translated to X).
+ *
+ * @throws IOException
+ */
+ @Test
+ public void testTranslateCdna_simple() throws IOException
+ {
+ AlignmentI alf = new FormatAdapter().readFile(fasta,
+ FormatAdapter.PASTE, "FASTA");
+ ColumnSelection cs = new ColumnSelection();
+ AlignViewportI av = new AlignViewport(alf, cs);
+ Dna dna = new Dna(av, new int[]
+ { 0, alf.getWidth() - 1 });
+ AlignmentI translated = dna.translateCdna();
+ String aa = translated.getSequenceAt(0).getSequenceAsString();
+ assertEquals(
+ "AAAACCDDEEFFGGGGHHIIIKKLLLLLLMNNPPPPQQRRRRRRSSSSSSTTTTVVVVWYYXXX",
+ aa);
+ }
+
+ /**
+ * Test translation excluding hidden columns.
+ *
+ * @throws IOException
+ */
+ @Test
+ public void testTranslateCdna_hiddenColumns() throws IOException
+ {
+ AlignmentI alf = new FormatAdapter().readFile(fasta,
+ FormatAdapter.PASTE, "FASTA");
+ ColumnSelection cs = new jalview.datamodel.ColumnSelection();
+ cs.hideColumns(6, 14); // hide codons 3/4/5
+ cs.hideColumns(24, 35); // hide codons 9-12
+ cs.hideColumns(177, 191); // hide codons 60-64
+ AlignViewportI av = new AlignViewport(alf, cs);
+ Dna dna = new Dna(av, new int[]
+ { 0, alf.getWidth() - 1 });
+ AlignmentI translated = dna.translateCdna();
+ String aa = translated.getSequenceAt(0).getSequenceAsString();
+ assertEquals("AACDDGGGGHHIIIKKLLLLLLMNNPPPPQQRRRRRRSSSSSSTTTTVVVVW", aa);
+ }
+
+ /**
+ * Use this test to help debug into any cases of interest.
+ */
+ @Test
+ public void testCompareCodonPos_oneOnly()
+ {
+ assertFollows("-AA--A", "G--GG"); // 2 shifted seq2, 3 shifted seq1
+ }
+
+ /**
+ * Tests for method that compares 'alignment' of two codon position triplets.
+ */
+ @Test
+ public void testCompareCodonPos()
+ {
+ /*
+ * Returns 0 for any null argument
+ */
+ assertEquals(0, Dna.compareCodonPos(new AlignedCodon(1, 2, 3), null));
+ assertEquals(0, Dna.compareCodonPos(null, new AlignedCodon(1, 2, 3)));
+
+ /*
+ * Work through 27 combinations. First 9 cases where first position matches.
+ */
+ assertMatches("AAA", "GGG"); // 2 and 3 match
+ assertFollows("AA-A", "GGG"); // 2 matches, 3 shifted seq1
+ assertPrecedes("AAA", "GG-G"); // 2 matches, 3 shifted seq2
+ assertFollows("A-AA", "GG-G"); // 2 shifted seq1, 3 matches
+ assertFollows("A-A-A", "GG-G"); // 2 shifted seq1, 3 shifted seq1
+ assertPrecedes("A-AA", "GG--G"); // 2 shifted seq1, 3 shifted seq2
+ assertPrecedes("AA-A", "G-GG"); // 2 shifted seq2, 3 matches
+ assertFollows("AA--A", "G-GG"); // 2 shifted seq2, 3 shifted seq1
+ assertPrecedes("AAA", "G-GG"); // 2 shifted seq2, 3 shifted seq2
+
+ /*
+ * 9 cases where first position is shifted in first sequence.
+ */
+ assertFollows("-AAA", "G-GG"); // 2 and 3 match
+ assertFollows("-AA-A", "G-GG"); // 2 matches, 3 shifted seq1
+ // 'enclosing' case: pick first to start precedes
+ assertFollows("-AAA", "G-G-G"); // 2 matches, 3 shifted seq2
+ assertFollows("-A-AA", "G-G-G"); // 2 shifted seq1, 3 matches
+ assertFollows("-A-A-A", "G-G-G"); // 2 shifted seq1, 3 shifted seq1
+ // 'enclosing' case: pick first to start precedes
+ assertFollows("-A-AA", "G-G--G"); // 2 shifted seq1, 3 shifted seq2
+ assertFollows("-AA-A", "G--GG"); // 2 shifted seq2, 3 matches
+ assertFollows("-AA--A", "G--GG"); // 2 shifted seq2, 3 shifted seq1
+ assertPrecedes("-AAA", "G--GG"); // 2 shifted seq2, 3 shifted seq2
+
+ /*
+ * 9 cases where first position is shifted in second sequence.
+ */
+ assertPrecedes("A-AA", "-GGG"); // 2 and 3 match
+ assertPrecedes("A-A-A", "-GGG"); // 2 matches, 3 shifted seq1
+ assertPrecedes("A-AA", "-GG-G"); // 2 matches, 3 shifted seq2
+ assertPrecedes("A--AA", "-GG-G"); // 2 shifted seq1, 3 matches
+ // 'enclosing' case with middle base deciding:
+ assertFollows("A--AA", "-GGG"); // 2 shifted seq1, 3 shifted seq1
+ assertPrecedes("A--AA", "-GG--G"); // 2 shifted seq1, 3 shifted seq2
+ assertPrecedes("AA-A", "-GGG"); // 2 shifted seq2, 3 matches
+ assertPrecedes("AA--A", "-GGG"); // 2 shifted seq2, 3 shifted seq1
+ assertPrecedes("AAA", "-GGG"); // 2 shifted seq2, 3 shifted seq2
+ }
+
+ /**
+ * This test generates a random cDNA alignment and its translation, then
+ * reorders the cDNA and retranslates, and verifies that the translations are
+ * the same (apart from ordering).
+ */
+ @Test
+ public void testTranslateCdna_sequenceOrderIndependent()
+ {
+ /*
+ * Generate cDNA - 8 sequences of 12 bases each.
+ */
+ AlignmentI cdna = new DnaAlignmentGenerator().generate(12, 8, 97, 5, 5);
+ ColumnSelection cs = new ColumnSelection();
+ AlignViewportI av = new AlignViewport(cdna, cs);
+ Dna dna = new Dna(av, new int[]
+ { 0, cdna.getWidth() - 1 });
+ AlignmentI translated = dna.translateCdna();
+
+ /*
+ * Jumble the cDNA sequences and translate.
+ */
+ SequenceI[] sorted = new SequenceI[cdna.getHeight()];
+ final int[] jumbler = new int[]
+ { 6, 7, 3, 4, 2, 0, 1, 5 };
+ int seqNo = 0;
+ for (int i : jumbler)
+ {
+ sorted[seqNo++] = cdna.getSequenceAt(i);
+ }
+ AlignmentI cdnaReordered = new Alignment(sorted);
+ av = new AlignViewport(cdnaReordered, cs);
+ dna = new Dna(av, new int[]
+ { 0, cdna.getWidth() - 1 });
+ AlignmentI translated2 = dna.translateCdna();
+
+ /*
+ * Check translated sequences are the same in both alignments.
+ */
+ System.out.println("Original");
+ System.out.println(translated.toString());
+ System.out.println("Sorted");
+ System.out.println(translated2.toString());
+
+ int sortedSequenceIndex = 0;
+ for (int originalSequenceIndex : jumbler)
+ {
+ final String translation1 = translated.getSequenceAt(
+ originalSequenceIndex).getSequenceAsString();
+ final String translation2 = translated2.getSequenceAt(sortedSequenceIndex)
+ .getSequenceAsString();
+ assertEquals(translation2, translation1);
+ sortedSequenceIndex++;
+ }
+ }
+
+ /**
+ * Test that all the cases in testCompareCodonPos have a 'symmetric'
+ * comparison (without checking the actual comparison result).
+ */
+ @Test
+ public void testCompareCodonPos_isSymmetric()
+ {
+ assertSymmetric("AAA", "GGG");
+ assertSymmetric("AA-A", "GGG");
+ assertSymmetric("AAA", "GG-G");
+ assertSymmetric("A-AA", "GG-G");
+ assertSymmetric("A-A-A", "GG-G");
+ assertSymmetric("A-AA", "GG--G");
+ assertSymmetric("AA-A", "G-GG");
+ assertSymmetric("AA--A", "G-GG");
+ assertSymmetric("AAA", "G-GG");
+ assertSymmetric("-AAA", "G-GG");
+ assertSymmetric("-AA-A", "G-GG");
+ assertSymmetric("-AAA", "G-G-G");
+ assertSymmetric("-A-AA", "G-G-G");
+ assertSymmetric("-A-A-A", "G-G-G");
+ assertSymmetric("-A-AA", "G-G--G");
+ assertSymmetric("-AA-A", "G--GG");
+ assertSymmetric("-AA--A", "G--GG");
+ assertSymmetric("-AAA", "G--GG");
+ assertSymmetric("A-AA", "-GGG");
+ assertSymmetric("A-A-A", "-GGG");
+ assertSymmetric("A-AA", "-GG-G");
+ assertSymmetric("A--AA", "-GG-G");
+ assertSymmetric("A--AA", "-GGG");
+ assertSymmetric("A--AA", "-GG--G");
+ assertSymmetric("AA-A", "-GGG");
+ assertSymmetric("AA--A", "-GGG");
+ assertSymmetric("AAA", "-GGG");
+ }
+
+ private void assertSymmetric(String codon1, String codon2)
+ {
+ assertEquals("Comparison of '" + codon1 + "' and '" + codon2
+ + " not symmetric", Integer.signum(compare(codon1, codon2)),
+ -Integer.signum(compare(codon2, codon1)));
+ }
+
+ /**
+ * Assert that the first sequence should map to the same position as the
+ * second in a translated alignment. Also checks that this is true if the
+ * order of the codons is reversed.
+ *
+ * @param codon1
+ * @param codon2
+ */
+ private void assertMatches(String codon1, String codon2)
+ {
+ assertEquals("Expected '" + codon1 + "' matches '" + codon2 + "'", 0,
+ compare(codon1, codon2));
+ assertEquals("Expected '" + codon2 + "' matches '" + codon1 + "'", 0,
+ compare(codon2, codon1));
+ }
+
+ /**
+ * Assert that the first sequence should precede the second in a translated
+ * alignment
+ *
+ * @param codon1
+ * @param codon2
+ */
+ private void assertPrecedes(String codon1, String codon2)
+ {
+ assertEquals("Expected '" + codon1 + "' precedes '" + codon2 + "'",
+ -1, compare(codon1, codon2));
+ }
+
+ /**
+ * Assert that the first sequence should follow the second in a translated
+ * alignment
+ *
+ * @param codon1
+ * @param codon2
+ */
+ private void assertFollows(String codon1, String codon2)
+ {
+ assertEquals("Expected '" + codon1 + "' follows '" + codon2 + "'", 1,
+ compare(codon1, codon2));
+ }
+
+ /**
+ * Convert two nucleotide strings to base positions and pass to
+ * Dna.compareCodonPos, return the result.
+ *
+ * @param s1
+ * @param s2
+ * @return
+ */
+ private int compare(String s1, String s2)
+ {
+ final AlignedCodon cd1 = convertCodon(s1);
+ final AlignedCodon cd2 = convertCodon(s2);
+ System.out.println("K: " + s1 + " " + cd1.toString());
+ System.out.println("G: " + s2 + " " + cd2.toString());
+ System.out.println();
+ return Dna.compareCodonPos(cd1, cd2);
+ }
+
+ /**
+ * Convert a string e.g. "-GC-T" to base positions e.g. [1, 2, 4]. The string
+ * should have exactly 3 non-gap characters, and use '-' for gaps.
+ *
+ * @param s
+ * @return
+ */
+ private AlignedCodon convertCodon(String s)
+ {
+ int[] codon = new int[3];
+ int i = 0;
+ for (int j = 0; j < s.length(); j++)
+ {
+ if (s.charAt(j) != '-')
+ {
+ codon[i++] = j;
+ }
+ }
+ return new AlignedCodon(codon[0], codon[1], codon[2]);
+ }
+
+ /**
+ * Weirdly, maybe worth a test to prove the helper method of this test class.
+ */
+ @Test
+ public void testConvertCodon()
+ {
+ assertEquals("[0, 1, 2]", convertCodon("AAA").toString());
+ assertEquals("[0, 2, 5]", convertCodon("A-A--A").toString());
+ assertEquals("[1, 3, 4]", convertCodon("-A-AA-").toString());
+ }
+}