Improve JSP pages

[proteocache.git] / website / Sequence.jsp

diff --git a/website/Sequence.jsp b/website/Sequence.jsp
index 5ff90b6..1cccbb2 100644 (file)
--- a/website/Sequence.jsp
+++ b/website/Sequence.jsp
@@ -11,11 +11,12 @@
        <br/>
        <form method="get" action="ProtServlet">
                <h3>Enter protein sequence</h3> 
-               <p><textarea rows="2" cols="100" name="prot">MPIDYSKWKDIEVSDDEDDTHPNIDTPSLFRWRHQARLERMAEKKMEQEKIDKEKGTTSKKMEELEKKLAAADVTDKSDIQKQIDEVKAQEEAWRKKEAELEEKERLEPWNVDTIGHEAFSTSRINKI</textarea></p>
-               <input type="radio" name="protein" value="whole"  Checked>search by the whole sequence
-               <input type="radio" name="protein" value="part">search by a part of sequence<br/>
-               <input type="submit" name="Search" value="Search"/><br/><br/>
-               <input type="checkbox" name="option" value="AllProtein">Sequence with more then 3 jobs<br>
+               <p><textarea rows="14" cols="80" name="prot">ABCDE</textarea></p>
+               <input type="radio" name="protein" value="part" Checked>search<br/>
+               <input type="submit" name="Search" value="Search sequence"/><br/><br/>
+               <h3>Enter minimum number of jobs per protein</h3>
+               <input type="text" name="counterJob" value = 3><br/>
+               <input type="submit" name="Search" value="Search counter"/><br/><br/>
        </form>
 </body>
-</html>
\ No newline at end of file
+</html>