<file-match-pattern match-pattern="src/.*.java" include-pattern="true"/>
<file-match-pattern match-pattern="resources/.*.properties" include-pattern="true"/>
</fileset>
- <filter name="NonSrcDirs" enabled="false"/>
</fileset-config>
<classpathentry kind="con" path="org.testng.TESTNG_CONTAINER"/>
<classpathentry kind="lib" path="lib/biojava-core-4.1.0.jar"/>
<classpathentry kind="lib" path="lib/biojava-ontology-4.1.0.jar"/>
- <classpathentry kind="lib" path="lib/groovy-all-2.4.6-indy.jar"/>
+ <classpathentry kind="lib" path="lib/groovy-all-2.4.12-indy.jar"/>
<classpathentry kind="output" path="classes"/>
</classpath>
.gitattributes
TESTNG
/jalviewApplet.jar
+/benchmarking/lib
+*.class
\ No newline at end of file
java -Djava.ext.dirs=JALVIEW_HOME/lib -cp JALVIEW_HOME/jalview.jar jalview.bin.Jalview
-Replace JALVIEW_HOME with the full path to Jalview Installation Directory.
+Replace JALVIEW_HOME with the full path to Jalview Installation Directory. If building from source:
+
+java -Djava.ext.dirs=JALVIEW_BUILD/dist -cp JALVIEW_BUILD/dist/jalview.jar jalview.bin.Jalview
+
##################
-jalview.release=releases/Release_2_10_2b1_Branch
-jalview.version=2.10.2b2
+jalview.release=releases/Release_2_10_3_Branch
+jalview.version=2.10.3
--- /dev/null
+<?xml version="1.0" encoding="UTF-8"?>
+<classpath>
+ <classpathentry kind="src" output="target/classes" path="src/main/java">
+ <attributes>
+ <attribute name="optional" value="true"/>
+ <attribute name="maven.pomderived" value="true"/>
+ </attributes>
+ </classpathentry>
+ <classpathentry kind="src" output="target/test-classes" path="src/test/java">
+ <attributes>
+ <attribute name="optional" value="true"/>
+ <attribute name="maven.pomderived" value="true"/>
+ </attributes>
+ </classpathentry>
+ <classpathentry kind="con" path="org.eclipse.jdt.launching.JRE_CONTAINER/org.eclipse.jdt.internal.debug.ui.launcher.StandardVMType/JavaSE-1.8">
+ <attributes>
+ <attribute name="maven.pomderived" value="true"/>
+ </attributes>
+ </classpathentry>
+ <classpathentry kind="con" path="org.eclipse.m2e.MAVEN2_CLASSPATH_CONTAINER">
+ <attributes>
+ <attribute name="maven.pomderived" value="true"/>
+ </attributes>
+ </classpathentry>
+ <classpathentry combineaccessrules="false" kind="src" path="/Jalview Release 2.7"/>
+ <classpathentry kind="lib" path="/Jalview Release 2.7/jalviewApplet.jar"/>
+ <classpathentry kind="output" path="target/classes"/>
+</classpath>
--- /dev/null
+/target/
+/bin
+/results
+*.log
+*.json
+*~
--- /dev/null
+eclipse.preferences.version=1
+encoding//src/main/java=UTF-8
+encoding/<project>=UTF-8
--- /dev/null
+eclipse.preferences.version=1
+org.eclipse.jdt.core.compiler.codegen.targetPlatform=1.8
+org.eclipse.jdt.core.compiler.compliance=1.8
+org.eclipse.jdt.core.compiler.problem.forbiddenReference=warning
+org.eclipse.jdt.core.compiler.source=1.8
--- /dev/null
+activeProfiles=
+eclipse.preferences.version=1
+resolveWorkspaceProjects=true
+version=1
--- /dev/null
+To set up benchmarking:
+
+You will need to install Maven: https://maven.apache.org/install.html
+
+1. Run the makedist target of build.xml in Eclipse, or in the jalview directory run
+ ant makedist
+
+This builds a jalview.jar file and puts it into dist/
+
+2. Make a lib directory in benchmarking/ if not already present and cd into this directory.
+
+3. Purge any previous maven dependencies:
+ mvn dependency:purge-local-repository -DactTransitively=false -DreResolve=false
+
+4. Run
+ mvn install:install-file -Dfile=../dist/jalview.jar -DgroupId=jalview.org -DartifactId=jalview -Dversion=1.0 -Dpackaging=jar -DlocalRepositoryPath=lib
+
+to install the jalview.jar file in the local maven repository. The pom.xml in the benchmarking references this installation, so if you change the names the pom.xml file will also need to be updated.
+
+5. Build and run jmh benchmarking. In the benchmarking directory:
+ mvn clean install
+ java -jar target/benchmarks.jar
+
+ To get JSON output instead use:
+ java -jar target/benchmarks.jar -rf json
+
+ JSON output can be viewed quickly by drag-dropping on http://jmh.morethan.io/
\ No newline at end of file
--- /dev/null
+<!--
+Copyright (c) 2014, Oracle America, Inc.
+All rights reserved.
+
+Redistribution and use in source and binary forms, with or without
+modification, are permitted provided that the following conditions are met:
+
+ * Redistributions of source code must retain the above copyright notice,
+ this list of conditions and the following disclaimer.
+
+ * Redistributions in binary form must reproduce the above copyright
+ notice, this list of conditions and the following disclaimer in the
+ documentation and/or other materials provided with the distribution.
+
+ * Neither the name of Oracle nor the names of its contributors may be used
+ to endorse or promote products derived from this software without
+ specific prior written permission.
+
+THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS "AS IS"
+AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE
+IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE
+ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT HOLDER OR CONTRIBUTORS BE
+LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR
+CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF
+SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS
+INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN
+CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE)
+ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF
+THE POSSIBILITY OF SUCH DAMAGE.
+-->
+
+<project xmlns="http://maven.apache.org/POM/4.0.0" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance"
+ xsi:schemaLocation="http://maven.apache.org/POM/4.0.0 http://maven.apache.org/xsd/maven-4.0.0.xsd">
+ <modelVersion>4.0.0</modelVersion>
+
+ <groupId>org.jalview</groupId>
+ <artifactId>benchmarking</artifactId>
+ <version>1.0-SNAPSHOT</version>
+ <packaging>jar</packaging>
+
+ <name>JMH benchmark sample: Java</name>
+
+ <!--
+ This is the demo/sample template build script for building Java benchmarks with JMH.
+ Edit as needed.
+ -->
+
+ <repositories>
+ <repository>
+ <id>lib</id>
+ <url>file://${project.basedir}/lib</url>
+ </repository>
+ </repositories>
+
+ <dependencies>
+ <dependency>
+ <groupId>org.openjdk.jmh</groupId>
+ <artifactId>jmh-core</artifactId>
+ <version>${jmh.version}</version>
+ </dependency>
+ <dependency>
+ <groupId>org.openjdk.jmh</groupId>
+ <artifactId>jmh-generator-annprocess</artifactId>
+ <version>${jmh.version}</version>
+ <scope>provided</scope>
+ </dependency>
+ <dependency>
+ <groupId>jalview.org</groupId>
+ <artifactId>jalview</artifactId>
+ <version>1.0</version>
+ </dependency>
+ </dependencies>
+
+ <properties>
+ <project.build.sourceEncoding>UTF-8</project.build.sourceEncoding>
+
+ <!--
+ JMH version to use with this project.
+ -->
+ <jmh.version>1.19</jmh.version>
+
+ <!--
+ Java source/target to use for compilation.
+ -->
+ <javac.target>1.8</javac.target>
+
+ <!--
+ Name of the benchmark Uber-JAR to generate.
+ -->
+ <uberjar.name>benchmarks</uberjar.name>
+ </properties>
+
+ <build>
+ <plugins>
+ <plugin>
+ <groupId>org.apache.maven.plugins</groupId>
+ <artifactId>maven-compiler-plugin</artifactId>
+ <version>3.1</version>
+ <configuration>
+ <compilerVersion>${javac.target}</compilerVersion>
+ <source>${javac.target}</source>
+ <target>${javac.target}</target>
+ </configuration>
+ </plugin>
+ <plugin>
+ <groupId>org.apache.maven.plugins</groupId>
+ <artifactId>maven-shade-plugin</artifactId>
+ <version>2.2</version>
+ <executions>
+ <execution>
+ <phase>package</phase>
+ <goals>
+ <goal>shade</goal>
+ </goals>
+ <configuration>
+ <finalName>${uberjar.name}</finalName>
+ <transformers>
+ <transformer implementation="org.apache.maven.plugins.shade.resource.ManifestResourceTransformer">
+ <mainClass>org.openjdk.jmh.Main</mainClass>
+ </transformer>
+ </transformers>
+ <filters>
+ <filter>
+ <!--
+ Shading signed JARs will fail without this.
+ http://stackoverflow.com/questions/999489/invalid-signature-file-when-attempting-to-run-a-jar
+ -->
+ <artifact>*:*</artifact>
+ <excludes>
+ <exclude>META-INF/*.SF</exclude>
+ <exclude>META-INF/*.DSA</exclude>
+ <exclude>META-INF/*.RSA</exclude>
+ </excludes>
+ </filter>
+ </filters>
+ </configuration>
+ </execution>
+ </executions>
+ </plugin>
+ </plugins>
+ <pluginManagement>
+ <plugins>
+ <plugin>
+ <artifactId>maven-clean-plugin</artifactId>
+ <version>2.5</version>
+ </plugin>
+ <plugin>
+ <artifactId>maven-deploy-plugin</artifactId>
+ <version>2.8.1</version>
+ </plugin>
+ <plugin>
+ <artifactId>maven-install-plugin</artifactId>
+ <version>2.5.1</version>
+ </plugin>
+ <plugin>
+ <artifactId>maven-jar-plugin</artifactId>
+ <version>2.4</version>
+ </plugin>
+ <plugin>
+ <artifactId>maven-javadoc-plugin</artifactId>
+ <version>2.9.1</version>
+ </plugin>
+ <plugin>
+ <artifactId>maven-resources-plugin</artifactId>
+ <version>2.6</version>
+ </plugin>
+ <plugin>
+ <artifactId>maven-site-plugin</artifactId>
+ <version>3.3</version>
+ </plugin>
+ <plugin>
+ <artifactId>maven-source-plugin</artifactId>
+ <version>2.2.1</version>
+ </plugin>
+ <plugin>
+ <artifactId>maven-surefire-plugin</artifactId>
+ <version>2.17</version>
+ </plugin>
+ </plugins>
+ </pluginManagement>
+ </build>
+
+</project>
--- /dev/null
+/*
+ * Jalview - A Sequence Alignment Editor and Viewer ($$Version-Rel$$)
+ * Copyright (C) $$Year-Rel$$ The Jalview Authors
+ *
+ * This file is part of Jalview.
+ *
+ * Jalview is free software: you can redistribute it and/or
+ * modify it under the terms of the GNU General Public License
+ * as published by the Free Software Foundation, either version 3
+ * of the License, or (at your option) any later version.
+ *
+ * Jalview is distributed in the hope that it will be useful, but
+ * WITHOUT ANY WARRANTY; without even the implied warranty
+ * of MERCHANTABILITY or FITNESS FOR A PARTICULAR
+ * PURPOSE. See the GNU General Public License for more details.
+ *
+ * You should have received a copy of the GNU General Public License
+ * along with Jalview. If not, see <http://www.gnu.org/licenses/>.
+ * The Jalview Authors are detailed in the 'AUTHORS' file.
+ */
+
+package org.jalview;
+
+import org.openjdk.jmh.annotations.Benchmark;
+import org.openjdk.jmh.annotations.BenchmarkMode;
+import org.openjdk.jmh.annotations.Fork;
+import org.openjdk.jmh.annotations.Measurement;
+import org.openjdk.jmh.annotations.Mode;
+import org.openjdk.jmh.annotations.Setup;
+import org.openjdk.jmh.annotations.State;
+import org.openjdk.jmh.annotations.Warmup;
+import org.openjdk.jmh.annotations.Scope;
+import org.openjdk.jmh.annotations.Param;
+
+import java.util.ArrayList;
+import java.util.List;
+import java.util.Random;
+import java.util.concurrent.TimeUnit;
+
+import jalview.datamodel.ColumnSelection;
+import jalview.datamodel.HiddenColumns;
+
+/*
+ * A class to benchmark hidden columns performance
+ */
+@Warmup(iterations = 10, time = 500, timeUnit = TimeUnit.MILLISECONDS)
+@Measurement(iterations = 10, time = 500, timeUnit = TimeUnit.MILLISECONDS)
+@Fork(1)
+public class HiddenColumnsBenchmark
+{
+ /*
+ * State with multiple hidden columns and a start position set
+ */
+ @State(Scope.Thread)
+ public static class HiddenColsAndStartState
+ {
+ @Param({ "300", "10000", "100000" })
+ public int maxcols;
+
+ @Param({ "1", "50", "90" })
+ public int startpcnt; // position as percentage of maxcols
+
+ @Param({ "1", "15", "100" })
+ public int hide;
+
+ HiddenColumns h = new HiddenColumns();
+
+ Random rand = new Random();
+
+ public int hiddenColumn;
+
+ public int visibleColumn;
+
+ @Setup
+ public void setup()
+ {
+ rand.setSeed(1234);
+ int lastcol = 0;
+ while (lastcol < maxcols)
+ {
+ int count = rand.nextInt(100);
+ lastcol += count;
+ h.hideColumns(lastcol, lastcol + hide);
+ lastcol += hide;
+ }
+
+ // make sure column at start is hidden
+ hiddenColumn = (int) (maxcols * startpcnt / 100.0);
+ h.hideColumns(hiddenColumn, hiddenColumn);
+
+ // and column <hide> after start is visible
+ ColumnSelection sel = new ColumnSelection();
+ h.revealHiddenColumns(hiddenColumn + hide, sel);
+ visibleColumn = hiddenColumn + hide;
+
+ System.out.println("Maxcols: " + maxcols + " HiddenCol: "
+ + hiddenColumn + " Hide: " + hide);
+ System.out.println("Number of hidden columns: " + h.getSize());
+ }
+ }
+
+ /* Convention: functions in alphabetical order */
+
+ @Benchmark
+ @BenchmarkMode({ Mode.Throughput })
+ public int benchAdjustForHiddenColumns(HiddenColsAndStartState tstate)
+ {
+ return tstate.h.adjustForHiddenColumns(tstate.visibleColumn);
+ }
+
+ @Benchmark
+ @BenchmarkMode({ Mode.Throughput })
+ public int benchFindColumnPosition(HiddenColsAndStartState tstate)
+ {
+ return tstate.h.findColumnPosition(tstate.visibleColumn);
+ }
+
+ @Benchmark
+ @BenchmarkMode({ Mode.Throughput })
+ public List<Integer> benchFindHiddenRegionPositions(
+ HiddenColsAndStartState tstate)
+ {
+ return tstate.h.findHiddenRegionPositions();
+ }
+
+ @Benchmark
+ @BenchmarkMode({ Mode.Throughput })
+ public ArrayList<int[]> benchGetHiddenColumnsCopy(
+ HiddenColsAndStartState tstate)
+ {
+ return tstate.h.getHiddenColumnsCopy();
+ }
+
+ @Benchmark
+ @BenchmarkMode({ Mode.Throughput })
+ public int benchGetSize(HiddenColsAndStartState tstate)
+ {
+ return tstate.h.getSize();
+ }
+
+ @Benchmark
+ @BenchmarkMode({ Mode.Throughput })
+ public HiddenColumns benchHideCols(HiddenColsAndStartState tstate)
+ {
+ tstate.h.hideColumns(tstate.visibleColumn, tstate.visibleColumn + 2000);
+ return tstate.h;
+ }
+
+ @Benchmark
+ @BenchmarkMode({ Mode.Throughput })
+ public boolean benchIsVisible(HiddenColsAndStartState tstate)
+ {
+ return tstate.h.isVisible(tstate.hiddenColumn);
+ }
+
+ @Benchmark
+ @BenchmarkMode({ Mode.Throughput })
+ public HiddenColumns benchReveal(HiddenColsAndStartState tstate)
+ {
+ ColumnSelection sel = new ColumnSelection();
+ tstate.h.revealHiddenColumns(tstate.hiddenColumn, sel);
+ return tstate.h;
+ }
+
+ @Benchmark
+ @BenchmarkMode({ Mode.Throughput })
+ public HiddenColumns benchRevealAll(HiddenColsAndStartState tstate)
+ {
+ ColumnSelection sel = new ColumnSelection();
+ tstate.h.revealAllHiddenColumns(sel);
+ return tstate.h;
+ }
+
+}
\ No newline at end of file
<offline_allowed />
</information>
<resources>
- <j2se version="9+" />
+ <j2se version="1.7+" />
<jar main="true" href="jalview.jar"/>
<fileset dir="${packageDir}">
<exclude name="jalview.jar" />
</presetdef>
<jnlpf toFile="${jnlpFile}" />
- <!-- add a j2se entry for java 9 -->
- <replace file="${jnlpFile}" value="j2se version="1.7+" initial-heap-size="${inih}" max-heap-size="${maxh}" java-vm-args="--add-modules=java.se.ee"">
- <replacetoken>j2se version="1.9+"</replacetoken>
+ <!-- add the add-modules j2se attribute for java 9 -->
+ <replace file="${jnlpFile}" value="j2se version="1.7+" initial-heap-size="${inih}" max-heap-size="${maxh}" java-vm-args="--add-modules=java.se.ee --illegal-access=warn"">
+ <replacetoken>j2se version="1.7+"</replacetoken>
</replace>
</target>
-{"seqs":[{"name":"FER_CAPAN/3-34","start":3,"svid":"1.0","end":34,"id":"1665704504","seq":"SVSATMISTSFMPRKPAVTSL-KPIPNVGE--ALF","order":1},{"name":"FER1_SOLLC/3-34","start":3,"svid":"1.0","end":34,"id":"1003594867","seq":"SISGTMISTSFLPRKPAVTSL-KAISNVGE--ALF","order":2},{"name":"Q93XJ9_SOLTU/3-34","start":3,"svid":"1.0","end":34,"id":"1332961135","seq":"SISGTMISTSFLPRKPVVTSL-KAISNVGE--ALF","order":3},{"name":"FER1_PEA/6-37","start":6,"svid":"1.0","end":37,"id":"1335040546","seq":"ALYGTAVSTSFLRTQPMPMSV-TTTKAFSN--GFL","order":4},{"name":"Q7XA98_TRIPR/6-39","start":6,"svid":"1.0","end":39,"id":"1777084554","seq":"ALYGTAVSTSFMRRQPVPMSV-ATTTTTKAFPSGF","order":5},{"name":"FER_TOCH/3-34","start":3,"svid":"1.0","end":34,"id":"823528539","seq":"FILGTMISKSFLFRKPAVTSL-KAISNVGE--ALF","order":6}],"appSettings":{"globalColorScheme":"zappo","webStartUrl":"www.jalview.org/services/launchApp","application":"Jalview","hiddenSeqs":"823528539","showSeqFeatures":"true","version":"2.9","hiddenCols":"32-33;34-34"},"seqGroups":[{"displayText":true,"startRes":21,"groupName":"JGroup:1883305585","endRes":29,"colourText":false,"sequenceRefs":["1003594867","1332961135","1335040546","1777084554"],"svid":"1.0","showNonconserved":false,"colourScheme":"Zappo","displayBoxes":true}],"alignAnnotation":[{"svid":"1.0","annotations":[{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"α","value":0,"secondaryStructure":"H"},{"displayCharacter":"α","value":0,"secondaryStructure":"H"},{"displayCharacter":"α","value":0,"secondaryStructure":"H"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"β","value":0,"secondaryStructure":"E"},{"displayCharacter":"β","value":0,"secondaryStructure":"E"},{"displayCharacter":"β","value":0,"secondaryStructure":"E"},{"displayCharacter":"β","value":0,"secondaryStructure":"E"},{"displayCharacter":"β","value":0,"secondaryStructure":"E"},{"displayCharacter":"β","value":0,"secondaryStructure":"E"},{"displayCharacter":"β","value":0,"secondaryStructure":"E"},{"displayCharacter":"β","value":0,"secondaryStructure":"E"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"α","value":0,"secondaryStructure":"H"},{"displayCharacter":"α","value":0,"secondaryStructure":"H"},{"displayCharacter":"α","value":0,"secondaryStructure":"H"},{"displayCharacter":"α","value":0,"secondaryStructure":"H"},{"displayCharacter":"α","value":0,"secondaryStructure":"H"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"}],"description":"New description","label":"Secondary Structure"}],"svid":"1.0","seqFeatures":[{"fillColor":"#7d1633","score":0,"sequenceRef":"1332961135","featureGroup":"Jalview","svid":"1.0","description":"desciption","xStart":3,"xEnd":13,"type":"feature_x"},{"fillColor":"#7d1633","score":0,"sequenceRef":"1335040546","featureGroup":"Jalview","svid":"1.0","description":"desciption","xStart":3,"xEnd":13,"type":"feature_x"},{"fillColor":"#7d1633","score":0,"sequenceRef":"1777084554","featureGroup":"Jalview","svid":"1.0","description":"desciption","xStart":3,"xEnd":13,"type":"feature_x"}]}
\ No newline at end of file
+{"seqs":[{"name":"FER_CAPAN/3-34","start":3,"svid":"1.0","end":34,"id":"1665704504","seq":"SVSATMISTSFMPRKPAVTSL-KPIPNVGE--ALF","order":1},{"name":"FER1_SOLLC/3-34","start":3,"svid":"1.0","end":34,"id":"1003594867","seq":"SISGTMISTSFLPRKPAVTSL-KAISNVGE--ALF","order":2},{"name":"Q93XJ9_SOLTU/3-34","start":3,"svid":"1.0","end":34,"id":"1332961135","seq":"SISGTMISTSFLPRKPVVTSL-KAISNVGE--ALF","order":3},{"name":"FER1_PEA/6-37","start":6,"svid":"1.0","end":37,"id":"1335040546","seq":"ALYGTAVSTSFLRTQPMPMSV-TTTKAFSN--GFL","order":4},{"name":"Q7XA98_TRIPR/6-39","start":6,"svid":"1.0","end":39,"id":"1777084554","seq":"ALYGTAVSTSFMRRQPVPMSV-ATTTTTKAFPSGF","order":5},{"name":"FER_TOCH/3-34","start":3,"svid":"1.0","end":34,"id":"823528539","seq":"FILGTMISKSFLFRKPAVTSL-KAISNVGE--ALF","order":6}],"appSettings":{"globalColorScheme":"zappo","webStartUrl":"www.jalview.org/services/launchApp","application":"Jalview","hiddenSeqs":"823528539","showSeqFeatures":"true","version":"2.9","hiddenCols":"32-33;34-34"},"seqGroups":[{"displayText":true,"startRes":21,"groupName":"JGroup:1883305585","endRes":29,"colourText":false,"sequenceRefs":["1003594867","1332961135","1335040546","1777084554"],"svid":"1.0","showNonconserved":false,"colourScheme":"Zappo","displayBoxes":true}],"alignAnnotation":[{"svid":"1.0","annotations":[{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"α","value":0,"secondaryStructure":"H"},{"displayCharacter":"α","value":0,"secondaryStructure":"H"},{"displayCharacter":"α","value":0,"secondaryStructure":"H"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"β","value":0,"secondaryStructure":"E"},{"displayCharacter":"β","value":0,"secondaryStructure":"E"},{"displayCharacter":"β","value":0,"secondaryStructure":"E"},{"displayCharacter":"β","value":0,"secondaryStructure":"E"},{"displayCharacter":"β","value":0,"secondaryStructure":"E"},{"displayCharacter":"β","value":0,"secondaryStructure":"E"},{"displayCharacter":"β","value":0,"secondaryStructure":"E"},{"displayCharacter":"β","value":0,"secondaryStructure":"E"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"α","value":0,"secondaryStructure":"H"},{"displayCharacter":"α","value":0,"secondaryStructure":"H"},{"displayCharacter":"α","value":0,"secondaryStructure":"H"},{"displayCharacter":"α","value":0,"secondaryStructure":"H"},{"displayCharacter":"α","value":0,"secondaryStructure":"H"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"},{"displayCharacter":"","value":0,"secondaryStructure":"\u0000"}],"description":"New description","label":"Secondary Structure"}],"svid":"1.0","seqFeatures":[{"fillColor":"#7d1633","score":0,"otherDetails":{"status":"+"},"sequenceRef":"1332961135","featureGroup":"Pfam","svid":"1.0","description":"My description","xStart":0,"xEnd":0,"type":"Domain"},{"fillColor":"#7d1633","score":0,"sequenceRef":"1332961135","featureGroup":"Jalview","svid":"1.0","description":"theDesc","xStart":3,"xEnd":13,"type":"feature_x"},{"fillColor":"#7d1633","score":0,"sequenceRef":"1335040546","featureGroup":"Jalview","svid":"1.0","description":"theDesc","xStart":3,"xEnd":13,"type":"feature_x"},{"fillColor":"#7d1633","score":0,"sequenceRef":"1777084554","featureGroup":"Jalview","svid":"1.0","description":"theDesc","xStart":3,"xEnd":13,"type":"feature_x"}]}
\ No newline at end of file
--- /dev/null
+/*
+ * Jalview - A Sequence Alignment Editor and Viewer ($$Version-Rel$$)
+ * Copyright (C) $$Year-Rel$$ The Jalview Authors
+ *
+ * This file is part of Jalview.
+ *
+ * Jalview is free software: you can redistribute it and/or
+ * modify it under the terms of the GNU General Public License
+ * as published by the Free Software Foundation, either version 3
+ * of the License, or (at your option) any later version.
+ *
+ * Jalview is distributed in the hope that it will be useful, but
+ * WITHOUT ANY WARRANTY; without even the implied warranty
+ * of MERCHANTABILITY or FITNESS FOR A PARTICULAR
+ * PURPOSE. See the GNU General Public License for more details.
+ *
+ * You should have received a copy of the GNU General Public License
+ * along with Jalview. If not, see <http://www.gnu.org/licenses/>.
+ * The Jalview Authors are detailed in the 'AUTHORS' file.
+ */
+
+import jalview.analysis.scoremodels.ScoreModels
+import jalview.analysis.scoremodels.SimilarityParams
+
+// generate matrix for current selection using standard Jalview PID
+
+printSimilarityMatrix(true,true,SimilarityParams.Jalview)
+
+/**
+ * this function prints a sequence similarity matrix in PHYLIP format.
+ * printSimilarityMatrix(selected-only, include-ids, pidMethod)
+ *
+ * Allowed values for pidMethod:
+ *
+ * Jalview's Comparison.PID method includes matching gaps
+ * and counts over the length of the shorter gapped sequence
+ * SimilarityParams.Jalview;
+ *
+ * 'SeqSpace' mode PCA calculation does not count matching
+ * gaps but uses longest gapped sequence length
+ * SimilarityParams.SeqSpace;
+ *
+ * PID calcs from the Raghava-Barton paper
+ * SimilarityParams.PID1: ignores gap-gap, does not score gap-residue,
+ * includes gap-residue in lengths, matches on longer of two sequences.
+ *
+ * SimilarityParams.PID2: ignores gap-gap,ignores gap-residue,
+ * matches on longer of two sequences
+ *
+ * SimilarityParams.PID3: ignores gap-gap,ignores gap-residue,
+ * matches on shorter of sequences only
+ *
+ * SimilarityParams.PID4: ignores gap-gap,does not score gap-residue,
+ * includes gap-residue in lengths,matches on shorter of sequences only.
+ */
+
+void printSimilarityMatrix(boolean selview=false, boolean includeids=true, SimilarityParams pidMethod) {
+
+ def currentAlignFrame = jalview.bin.Jalview.getCurrentAlignFrame()
+
+ jalview.gui.AlignViewport av = currentAlignFrame.getCurrentView()
+
+ jalview.datamodel.AlignmentView seqStrings = av.getAlignmentView(selview)
+
+ if (!selview || av.getSelectionGroup()==null) {
+ start = 0
+ end = av.getAlignment().getWidth()
+ seqs = av.getAlignment().getSequencesArray()
+ } else {
+ start = av.getSelectionGroup().getStartRes()
+ end = av.getSelectionGroup().getEndRes() + 1
+ seqs = av.getSelectionGroup().getSequencesInOrder(av.getAlignment())
+ }
+
+ distanceCalc = ScoreModels.getInstance().getScoreModel("PID",
+ (jalview.api.AlignmentViewPanel) currentAlignFrame.alignPanel)
+
+ def distance=distanceCalc.findSimilarities(
+ seqStrings.getSequenceStrings(jalview.util.Comparison.GAP_DASH),pidMethod)
+
+ // output the PHYLIP Matrix
+
+ print distance.width()+" "+distance.height()+"\n"
+
+ p = 0
+
+ for (v in 1..distance.height()) {
+
+ if (includeids) {
+ print seqs[p++].getDisplayId(false)+" "
+ }
+
+ for (r in 1..distance.width()) {
+ print distance.getValue(v-1,r-1)+" "
+ }
+
+ print "\n"
+ }
+}
\ No newline at end of file
<mapID target="home" url="html/index.html" />
<mapID target="new" url="html/whatsNew.html"/>
- <mapID target="release" url="html/releases.html#Jalview.2.10.2b1"/>
+ <mapID target="release" url="html/releases.html#Jalview.2.10.3"/>
<mapID target="alannotation" url="html/features/annotation.html"/>
<mapID target="keys" url="html/keys.html"/>
<mapID target="newkeys" url="html/features/newkeystrokes.html"/>
<tocitem text="Jalview Documentation" target="home" expand="true">
<tocitem text="What's new" target="new" expand="true">
<tocitem text="Latest Release Notes" target="release"/>
- <tocitem text="Calculations Dialog" target="calcs.dialog"/>
- <tocitem text="Groovy Features Counter example" target="groovy.featurescounter"/>
- <tocitem text="Custom Colourschemes in Groovy" target="groovy.colours"/>
- <tocitem text="Omit hidden regions in Overview" target="overview"/>
- <tocitem text="Show gaps as grey in overview" target="overviewprefs"/>
- <tocitem text="identifers.org for URL Links" target="linksprefs" />
- <tocitem text="New features in Split Frame View" target="splitframe.mirrorfonts" />
</tocitem>
<tocitem text="Editing Alignments" target="edit" />
<p>
Gap open : 12 <br> Gap extend : 2
</p>
- <p>When you select the pairwise alignment option a new window will
- come up which will display the alignments in a text format as they
- are calculated. Also displayed is information about the alignment
- such as alignment score, length and percentage identity between the
+ <p>When you select the pairwise alignment option, a new window
+ will come up which displays the alignments in a text format, for
+ example:</p>
+ <p>
+ <pre>
+ FER1_SPIOL/5-13 TTMMGMAT<br />
+ |. .. ||<br />
+ FER1_MESCR/5-15 TAALSGAT
+ </pre>
+ shows the aligned sequences, where '|' links identical residues, and
+ (for peptide) '.' links residues that have a positive PAM250 score.
+ <p>The window also shows information about the alignment such as
+ alignment score, length and percentage identity between the
sequences.</p>
- <p> </p>
+ <p>A button is also provided to allow you to view the sequences as
+ an alignment.</p>
</body>
</html>
<li><p>
<strong>Sort by Pairwise Identity</strong>
</p>
- <p>Places pairs of sequences together that align with the
- greatest fraction of conserved residues.</p>
+ <p>Sorts sequences in the selection or alignment according to percent identity with respect to the first sequence in the view.</p>
<p></li>
<li><p>
<strong>Sort by Tree Order</strong>
<p>
To open the PDB Sequence Fetcher, select PDB as the database from
any <a href="seqfetch.html">Sequence Fetcher</a> dialog (opened <em>via</em>
- <strong>"File →Fetch Sequences"</strong>).
+ <strong>"File →Fetch Sequences"</strong>).
</p>
<img src="pdbseqfetcher.png" align="left"
alt="PDB sequence fetcher (introduced in Jalview 2.9)" />
<p>
<strong>Searching the PDB Database</strong>
</p>
+ <p>To search the PDB, begin typing in the text box. If the
+ 'autosearch' checkbox is enabled, then the results of your query
+ will be automatically updated and shown in the search results tab;
+ otherwise, press return to update the results. To access previous
+ searches, press the down-arrow or click the drop down menu icon at
+ the side of the search box. If you just want to paste in a list of
+ IDs, the 'Retrieve IDs' tab provides a batch-retrieval interface.</p>
<p>
- To search the PDB, begin typing in the text box. The results of your
- query are shown in the search results tab, which updates every time
- you type in the search text box. You can sort results according to
- the displayed columns, and select entries with the mouse and
- keyboard. Once you have selected one or more entries, hit the <strong>OK</strong>
- button to retrieve and view them in Jalview.
+ You can sort results according to the displayed columns, and select
+ entries with the mouse and keyboard. Once you have selected one or
+ more entries, hit the <strong>OK</strong> button to retrieve and
+ view them in Jalview.
</p>
<p>
<ul>
1xyz:A</li>
<li><strong>Bulk PDB retrieval</strong><br>Multiple PDB
- IDs can be specified by separating them with a semi-colon.<br />
- e.g. 1xyz;2xyz;3xyz<br />Hitting Return or OK will automatically
- fetch those IDs, like the default Sequence Fetcher interface.</li>
+ IDs can be specified for retrieval via the
+ <strong>Retrieve IDs</strong> tab.</li>
<li><strong>Wild card searching</strong><br>The following
wild cards are supported by the EMBL-EBI PDBe query service:
<p>
<strong>Searching the UniProt Database</strong>
</p>
- <p>
- To search UniProt, simply begin typing in the text box. After a
- short delay (about 1.5 seconds), results will be shown in the table
- below. You can sort results by clicking on the displayed columns,
+ <p>To search UniProt, simply begin typing in the text box. If the
+ 'autosearch' check box is enabled, then after a short delay (about
+ 1.5 seconds), results will be shown in the table below. Results are
+ also updated whenever you press Enter, and you can access previous
+ searches by pressing the 'Down' arrow or clicking the drop-down menu
+ icon at the side of the search box.</p>
+ <p>You can sort results by clicking on the displayed columns,
and select entries with the mouse or keyboard. Once you have
selected one or more entries, hit the <strong>OK</strong> button to
retrieve the sequences.
<li><strong>Bulk UniProt record retrieval</strong><br> To
- retrieve several uniprot accessions at once, first select <strong>UniProt
- ID</strong> from the dropdown menu, then paste in the accession IDs as a
- semi-colon separated list. (e.g. fila_human; mnt_human;
- mnt_mouse).<br />Hitting Return or OK will automatically fetch
- those IDs, like the default Sequence Fetcher interface.</li>
+ retrieve sequences for a list of Uniprot accessions, please enter
+ them via the 'Retrieve IDs' tab.</li>
<li><strong><a name="text-search">Complex queries
with the UniProt query Syntax</a></strong> The text box also allows complex
<li><strong>Viewing Cached Structures</strong><br />If
previously downloaded structures are available for your
sequences, the structure chooser will automatically offer them
- via the <strong>Cached PDB Entries</strong> view. If you wish
+ via the <strong>Cached Structures</strong> view. If you wish
to download new structures, select one of the PDBe selection
criteria from the drop-down menu.</li>
</ul></li>
<tr>
<td width="60" nowrap>
<div align="center">
- <strong><a name="Jalview.2.10.2b2">2.10.2b2</a><br />
- <em>2/10/2017</em></strong>
+ <strong><a name="Jalview.2.10.3">2.10.3</a><br /> <em>17/11/2017</em></strong>
</div>
</td>
<td><div align="left">
- <em>New features in Jalview Desktop</em>
+ <em></em>
<ul>
<li>
- <!-- JAL-2748 -->Uniprot Sequence Fetcher now uses web API at uniprot.org
- <!-- JAL-2745 -->HTTPS used for all connections to ebi.ac.uk
+ <!-- JAL-2446 -->Faster and more efficient management and
+ rendering of sequence features
+ </li>
+ <li>
+ <!-- JAL 2523-->More reliable Ensembl fetching with HTTP
+ 429 rate limit request hander
+ </li>
+ <li>
+ <!-- JAL-2773 -->Structure views don't get updated unless
+ their colours have changed
+ </li>
+ <li>
+ <!-- JAL-2495 -->All linked sequences are highlighted for
+ a structure mousover (Jmol) or selection (Chimera)
+ </li>
+ <li>
+ <!-- JAL-2790 -->'Cancel' button in progress bar for
+ JABAWS AACon, RNAAliFold and Disorder prediction jobs
+ </li>
+ <li>
+ <!-- JAL-2617 -->Stop codons are excluded in CDS/Protein
+ view from Ensembl locus cross-references
+ </li>
+ <li>
+ <!-- JAL-2685 -->Start/End limits are shown in Pairwise
+ Alignment report
+ </li>
+ <li>
+ <!-- JAL-2810 -->Sequence fetcher's Free text 'autosearch'
+ feature can be disabled
+ </li>
+ <li>
+ <!-- JAL-2810 -->Retrieve IDs tab added for UniProt and
+ PDB easier retrieval of sequences for lists of IDs
+ </li>
+ <li>
+ <!-- JAL-2758 -->Short names for sequences retrieved from
+ Uniprot
+ </li>
+ </ul>
+ <em>Scripting</em>
+ <ul>
+ <li>Groovy interpreter updated to 2.4.12</li>
+ <li>Example groovy script for generating a matrix of
+ percent identity scores for current alignment.</li>
+ </ul>
+ <em>Testing and Deployment</em>
+ <ul>
+ <li>
+ <!-- JAL-2727 -->Test to catch memory leaks in Jalview UI
</li>
-
</ul>
</div></td>
<td><div align="left">
- <em></em>
+ <em>General</em>
+ <ul>
+ <li>
+ <!-- JAL-2643 -->Pressing tab after updating the colour
+ threshold text field doesn't trigger an update to the
+ alignment view
+ </li>
+ <li>
+ <!-- JAL-2682 -->Race condition when parsing sequence ID
+ strings in parallel
+ </li>
+ <li>
+ <!-- JAL-2608 -->Overview windows are also closed when
+ alignment window is closed
+ </li>
+ <li>
+ <!-- JAL-2548 -->Export of features doesn't always respect
+ group visibility
+ </li>
+ <li>
+ <!-- JAL-2831 -->Jumping from column 1 to column 100,000
+ takes a long time in Cursor mode
+ </li>
+ </ul>
+ <em>Desktop</em>
+ <ul>
+ <li>
+ <!-- JAL-2777 -->Structures with whitespace chainCode
+ cannot be viewed in Chimera
+ </li>
+ <li>
+ <!-- JAL-2728 -->Protein annotation panel too high in
+ CDS/Protein view
+ </li>
+ <li>
+ <!-- JAL-2757 -->Can't edit the query after the server
+ error warning icon is shown in Uniprot and PDB Free Text
+ Search Dialogs
+ </li>
+ <li>
+ <!-- JAL-2253 -->Slow EnsemblGenome ID lookup
+ </li>
+ <li>
+ <!-- JAL-2529 -->Revised Ensembl REST API CDNA query
+ </li>
+ <li>
+ <!-- JAL-2739 -->Hidden column marker in last column not
+ rendered when switching back from Wrapped to normal view
+ </li>
+ <li>
+ <!-- JAL-2768 -->Annotation display corrupted when
+ scrolling right in unwapped alignment view
+ </li>
+ <li>
+ <!-- JAL-2542 -->Existing features on subsequence
+ incorrectly relocated when full sequence retrieved from
+ database
+ </li>
+ <li>
+ <!-- JAL-2733 -->Last reported memory still shown when
+ Desktop->Show Memory is unticked (OSX only)
+ </li>
+ <li>
+ <!-- JAL-2658 -->Amend Features dialog doesn't allow
+ features of same type and group to be selected for
+ amending
+ </li>
+ <li>
+ <!-- JAL-2524 -->Jalview becomes sluggish in wide
+ alignments when hidden columns are present
+ </li>
+ <li>
+ <!-- JAL-2392 -->Jalview freezes when loading and
+ displaying several structures
+ </li>
+ <li>
+ <!-- JAL-2732 -->Black outlines left after resizing or
+ moving a window
+ </li>
+ <li>
+ <!-- JAL-1900,JAL-1625 -->Unable to minimise windows
+ within the Jalview desktop on OSX
+ </li>
+ <li>
+ <!-- JAL-2667 -->Mouse wheel doesn't scroll vertically
+ when in wrapped alignment mode
+ </li>
+ <li>
+ <!-- JAL-2636 -->Scale mark not shown when close to right
+ hand end of alignment
+ </li>
+ <li>
+ <!-- JAL-2684 -->Pairwise alignment of selected regions of
+ each selected sequence do not have correct start/end
+ positions
+ </li>
+ <li>
+ <!-- JAL-2793 -->Alignment ruler height set incorrectly
+ after canceling the Alignment Window's Font dialog
+ </li>
+ <li>
+ <!-- JAL-2036 -->Show cross-references not enabled after
+ restoring project until a new view is created
+ </li>
+ <li>
+ <!-- JAL-2756 -->Warning popup about use of SEQUENCE_ID in
+ URL links appears when only default EMBL-EBI link is
+ configured (since 2.10.2b2)
+ </li>
+ <li>
+ <!-- JAL-2775 -->Overview redraws whole window when box
+ position is adjusted
+ </li>
+ <li>
+ <!-- JAL-2225 -->Structure viewer doesn't map all chains
+ in a multi-chain structure when viewing alignment
+ involving more than one chain (since 2.10)
+ </li>
+ <li>
+ <!-- JAL-2811 -->Double residue highlights in cursor mode
+ if new selection moves alignment window
+ </li>
+ <li>
+ <!-- JAL-2837,JAL-2840 -->Alignment vanishes when using
+ arrow key in cursor mode to pass hidden column marker
+ </li>
+ <li>
+ <!-- JAL-2679 -->Ensembl Genomes example ID changed to one
+ that produces correctly annotated transcripts and products
+ </li>
+ <li>
+ <!-- JAL-2776 -->Toggling a feature group after first time
+ doesn't update associated structure view
+ </li>
+ </ul>
+ <em>Applet</em><br />
+ <ul>
+ <li>
+ <!-- JAL-2687 -->Concurrent modification exception when
+ closing alignment panel
+ </li>
+ </ul>
+ <em>BioJSON</em><br />
+ <ul>
+ <li>
+ <!-- JAL-2546 -->BioJSON export does not preserve
+ non-positional features
+ </li>
+ </ul>
+ <em>New Known Issues</em>
+ <ul>
+ <li>
+ <!-- JAL-2541 -->Delete/Cut selection doesn't relocate
+ sequence features correctly (for many previous versions of
+ Jalview)
+ </li>
+ <li>
+ <!-- JAL-2841 -->Cursor mode unexpectedly scrolls when
+ using cursor in wrapped panel other than top
+ </li>
+ <li>
+ <!-- JAL-2791 -->Select columns containing feature ignores
+ graduated colour threshold
+ </li>
+ <li>
+ <!-- JAL-2822,JAL-2823 -->Edit sequence operation doesn't
+ always preserve numbering and sequence features
+ </li>
+ </ul>
+ <em>Known Java 9 Issues</em>
<ul>
<li>
- <!-- -->
+ <!-- JAL-2902 -->Groovy Console very slow to open and is
+ not responsive when entering characters (Webstart, Java
+ 9.01, OSX 10.10)
</li>
</ul>
</div></td>
<tr>
<td width="60" nowrap>
<div align="center">
+ <strong><a name="Jalview.2.10.2b2">2.10.2b2</a><br />
+ <em>2/10/2017</em></strong>
+ </div>
+ </td>
+ <td><div align="left">
+ <em>New features in Jalview Desktop</em>
+ <ul>
+ <li>
+ <!-- JAL-2748 -->Uniprot Sequence Fetcher now uses web API at uniprot.org
+ </li>
+ <li> <!-- JAL-2745 -->HTTPS used for all connections to ebi.ac.uk
+ </li>
+ </ul>
+ </div></td>
+ <td><div align="left">
+ </div></td>
+ </tr>
+ <tr>
+ <td width="60" nowrap>
+ <div align="center">
<strong><a name="Jalview.2.10.2b1">2.10.2b1</a><br />
<em>7/9/2017</em></strong>
</div>
</li>
</ul>
</div></td>
- </tr>
+ </tr>
<tr>
<td width="60" nowrap>
<div align="center">
after clicking on it to create new annotation for a
column.
</li>
+ <li>
+ <!-- JAL-1980 -->Null Pointer Exception raised when
+ pressing Add on an orphaned cut'n'paste window.
+ </li>
<!-- may exclude, this is an external service stability issue JAL-1941
-- > RNA 3D structure not added via DSSR service</li> -->
</ul>
</head>
<body>
<p>
- <strong>Jalview 2.10.2b2 bugfix release</strong>
+ <strong>What's new in Jalview 2.10.3 ?</strong>
</p>
<p>
- This is patch release for 2.10.2. See the
- <a href="releases.html#Jalview.2.10.2b2">release notes</a> for full
- details about the bugs addressed. This second patch release fixes
- problems with the Uniprot sequence fetcher and introduces secure SSL
- connections for access to EMBL-EBI resources. The previous patch
- release introduced additional improvements to the overview panel,
- and patches for several minor issues including the ability to
- correctly recover cross-references for Uniprot protein sequences
- from Ensembl.
- </p>
- <p>
- <strong>What's new in Jalview 2.10.2 ?</strong>
- </p>
- <p>
- Version 2.10.2 was released in August 2017, and introduced new user
- interface features, improved and more extensible tree and PCA
- analysis, more robust 3D structure viewing with UCSF Chimera and an
- updated service client for JABAWS. The full list of bug fixes and
- new features can be found in the <a
- href="releases.html#Jalview.2.10.2"> 2.10.2 Release Notes</a>, but
- the highlights are below.
+ Version 2.10.3 was released in November 2017. The major focus was to
+ improve Jalview's sequence features datamodel and the scalability of
+ the alignment rendering system. The full list of bug fixes and new
+ features can be found in the <a href="releases.html#Jalview.2.10.3">2.10.3
+ Release Notes</a>. Key improvements include:
</p>
<ul>
- <li><strong>New dialog and faster and more
- configurable Tree and PCA calculations</strong><br> Menu entries for
- calculating PCA and different types of tree have been replaced by
- a single <a href="calculations/calculations.html"><em>Calculations</em>
- dialog box</a>. The underlying implementation for the PCA and tree
- calculations have been made faster and more memory efficient.</li>
- <li><strong>Extensible score models</strong><br />A new
- framework has also been created for the score models used to
- calculate distances between sequences and shade alignments. This
- framework allows import of substitution matrices in NCBI and
- AAIndex format.<br /> <strong>PCA Bug Fixes</strong>. Jalview's
- implementation of PCA differed in its treatment of gaps and
- non-standard residues. The BLOSUM62 matrix also included a typo
- that affected results. See the <a
- href="releases.html#2102scoremodelbugs">2.10.2 release note
- about score model bugs</a> for details and how to reinstate legacy
- behaviour.</li>
- <li><strong>Update to JABAWS 2.2</strong><br />Jalview's
- alignment, protein conservation analysis, and protein disorder and
- RNA secondary structure prediction services are now provided by <a
- href="http://www.compbio.dundee.ac.uk/jabaws">JABAWS 2.2</a>.
- Several of the programs provided as JABAWS 2.2 services have been
- updated, so their options and parameters have changed.</li>
- <li><strong>URL linkouts to other bioinformatics
- databases</strong><br />New preferences for <a
- href="webServices/urllinks.html">opening web pages for
- database cross-references</a> via the UK Elixir's EMBL-EBI's MIRIAM
- database and identifiers.org services.</li>
- <li><strong>Showing and hiding regions</strong> <br /> <a
- href="menus/popupMenu.html#hideinserts">Hide insertions</a> in the
- PopUp menu has changed its behaviour. Prior to 2.10.2, columns
- were only shown or hidden according to gaps in the sequence under
- the popup menu. Now, only columns that are gapped in all selected
- sequences as well as the sequence under the popup menu are hidden,
- and column visibility outside the selected region is left as is.
- This makes it easy to filter insertions from the alignment view
- (just select the region containing insertions to remove) without
- affecting the rest of the hidden columns.</li>
- <li><strong>Gap count - a.k.a. the Occupancy
- Annotation Row</strong><br /> Another way to filter columns according to
- the presence of gaps is to enable the <strong>Occupancy
- Annotation</strong> row via Jalview's Preferences. This annotation row
- shows a histogram of the number of aligned residues at each
- column. The <a href="features/columnFilterByAnnotation.html">Select
- By Annotation</a> dialog now also includes a percentage threshold
- mode, to make it easy to filter alignments to show only those
- columns with a particular fraction of aligned sequences.</li>
- <li><strong>Recent search history for Find, PDBe and
- Uniprot</strong><br />Easily repeat a previous search for <a
- href="features/search.html#queryhistory">Find</a> and the free
- text search system (for querying Uniprot and the PDBe).</li>
- <li><strong>Improved Overview Window</strong><br />The <a
- href="features/overview.html">alignment overview</a> is now easier
- to use when working with alignments of more than 5000 rows and
- columns, and features a new pop-up menu that allows hidden regions
- to be excluded from the overview. It also works with CDS/Protein
- alignments and MSA views in wrapped mode.</li>
- <li><strong>3D Structure</strong><br />Jalview's communication
- with UCSF Chimera has been made more robust, particularly when
- working with many structures and long sequences. Regions in
- structures that correspond to hidden regions in an alignment view
- are now left un-coloured, making it easier to highlight specific
- features in 3D. See below for <a href="#experimental">experimental
- features for exchanging annotation between Chimera and Jalview.</a></li>
+ <li>Faster and more responsive UI when importing and working
+ with wide alignments and handling hundreds and thousands of
+ sequence features</li>
+ <li>Improved usability with <a
+ href="features/pdbsequencefetcher.html">PDB</a> and <a
+ href="features/uniprotsequencefetcher.html">UniProt</a> Free Text
+ Search dialog, and new tab for retrieval of sequences for lists of
+ IDs.
+ </li>
+ <li>Short names assigned to sequences retrieved from UniProt</li>
+ <li>Groovy console upgraded to 2.4.12 (improved support for Java 9)</li>
</ul>
<p>
- <strong>Scripting</strong><br />New <a
- href="http://www.jalview.org/examples/groovy">groovy examples</a>
- demonstrate Jalview 2.10.2 APIs for creation of data-driven
- colourschemes, and custom alignment file handlers. The <a
- href="groovy/featuresCounter.html">FeatureAnnotationWorker</a>
- introduced in Jalview 2.10 has also been refactored to allow
- efficient counting across multiple feature types. Please be aware
- that feature counter scripts created for earlier versions will not
- execute in Jalview 2.10.2.
- </p>
- <p>
<strong><a name="experimental">Experimental Features</a></strong>
</p>
<p>
- This release of Jalview introduces an <em>Experimental Features</em>
- option in the Jalview Desktop's <em>Tools</em> menu that allows you
- to try out features that are still in development. To access the
- experimental features below - first enable the <strong>Tools→Enable
- Experimental Features</strong> option, and then restart Jalview.
+ Remember, please enable the <em>Experimental Features</em> option in
+ the Jalview Desktop's <em>Tools</em> menu, and then restart Jalview
+ if you want to try out features below:
</p>
<ul>
<li><em>Annotation transfer between Chimera and Jalview</em><br />Two
the Chimera viewer's Chimera menu</a> allow positional annotation to
be exchanged between Chimera and Jalview.</li>
</ul>
-
+
</body>
</html>
error.not_implemented = Not implemented
error.no_such_method_as_clone1_for = No such method as clone1 for {0}
error.null_from_clone1 = Null from clone1!
-error.implementation_error_sortbyfeature = Implementation Error - sortByFeature method must be one of FEATURE_SCORE, FEATURE_LABEL or FEATURE_DENSITY.
error.not_yet_implemented = Not yet implemented
error.unknown_type_dna_or_pep = Unknown Type {0} - dna or pep are the only allowed values.
error.implementation_error_dont_know_threshold_annotationcolourgradient = Implementation error: don't know about threshold setting for current AnnotationColourGradient.
label.urltooltip = Only one url, which must use a sequence id, can be selected for the 'On Click' option
label.edit_sequence_url_link = Edit sequence URL link
warn.name_cannot_be_duplicate = User-defined URL names must be unique and cannot be MIRIAM ids
-label.invalid_name = Invalid Name !
label.output_seq_details = Output Sequence Details to list all database references
label.urllinks = Links
label.default_cache_size = Default Cache Size
label.overview = Overview
label.reset_to_defaults = Reset to defaults
label.oview_calc = Recalculating overview...
+option.enable_disable_autosearch = When ticked, search is performed automatically.
+option.autosearch = Autosearch
+label.retrieve_ids = Retrieve IDs
\ No newline at end of file
error.not_implemented = No implementado
error.no_such_method_as_clone1_for = No existe ese método como un clone1 de {0}
error.null_from_clone1 = Nulo de clone1!
-error.implementation_error_sortbyfeature = Error de implementación - sortByFeature debe ser uno de FEATURE_SCORE, FEATURE_LABEL o FEATURE_DENSITY.
error.not_yet_implemented = No se ha implementado todavÃa
error.unknown_type_dna_or_pep = Tipo desconocido {0} - dna o pep son los únicos valores permitidos
error.implementation_error_dont_know_threshold_annotationcolourgradient = Error de implementación: no se conoce el valor umbral para el AnnotationColourGradient actual.
label.urltooltip = Sólo una url, que debe usar una id de secuencia, puede ser seleccionada en la opción 'On Click'
label.edit_sequence_url_link = Editar link de secuencia URL
warn.name_cannot_be_duplicate = Los nombres URL definidos por el usuario deben ser únicos y no pueden ser ids de MIRIAM
-label.invalid_name = Nombre inválido !
label.output_seq_details = Seleccionar Detalles de la secuencia para ver todas
label.urllinks = Enlaces
label.default_cache_size = Tamaño del caché por defecto
* The Jalview Authors are detailed in the 'AUTHORS' file.
-->
<mapping>
- <class name="jalview.datamodel.UniprotFile">
+ <class name="jalview.datamodel.xdb.uniprot.UniprotFile">
<map-to xml="uniprot"/>
- <field name="UniprotEntries" type="jalview.datamodel.UniprotEntry" collection="vector">
+ <field name="UniprotEntries" type="jalview.datamodel.xdb.uniprot.UniprotEntry" collection="vector">
<bind-xml name="entry"/>
</field>
</class>
- <class name="jalview.datamodel.UniprotEntry">
+ <class name="jalview.datamodel.xdb.uniprot.UniprotEntry">
<field name="name" type="string" collection="vector"/>
<field name="accession" type="string" collection="vector"/>
- <field name="protein" type="jalview.datamodel.UniprotProteinName"/>
- <field name="UniprotSequence" type="jalview.datamodel.UniprotSequence">
+ <field name="protein" type="jalview.datamodel.xdb.uniprot.UniprotProteinName"/>
+ <field name="UniprotSequence" type="jalview.datamodel.xdb.uniprot.UniprotSequence">
<bind-xml name="sequence"/>
</field>
- <field name="feature" type="jalview.datamodel.SequenceFeature" collection="vector"/>
+ <field name="feature" type="jalview.datamodel.xdb.uniprot.UniprotFeature" collection="vector"/>
<field name="dbReference" type="jalview.datamodel.PDBEntry" collection="vector"/>
</class>
- <class name="jalview.datamodel.UniprotProteinName">
+ <class name="jalview.datamodel.xdb.uniprot.UniprotProteinName">
<field name="name" collection="vector" type="string">
<bind-xml name="fullName" location="recommendedName" node="element"/>
</field>
</class>
<!-- uniprot protein name is now a collection of collections - the INCLUDES and CONTAINS entries of the uniprot
record. This means this doesn't exist anymore...
- <class name="jalview.datamodel.UniprotProteinName">
+ <class name="jalview.datamodel.xdb.uniprot.UniprotProteinName">
<field name="name" type="string" collection="vector">
<bind-xml name="name"/>
</field>
</class>
-->
- <class name="jalview.datamodel.SequenceFeature">
+ <class name="jalview.datamodel.xdb.uniprot.UniprotFeature">
<field name="type">
<bind-xml node="attribute"/>
</field>
</field>
</class>
- <class name="jalview.datamodel.UniprotSequence">
+ <class name="jalview.datamodel.xdb.uniprot.UniprotSequence">
<field name="content" type="string">
<bind-xml name="sequence" node="text"/>
</field>
try
{
- pdb = ssm.setMapping(seq, chains, pdbentry.getFile(), protocol);
+ pdb = ssm.setMapping(seq, chains, pdbentry.getFile(), protocol, null);
if (protocol == DataSourceType.PASTE)
{
try
{
- pdb = ssm.setMapping(seq, chains, pdbentry.getFile(), protocol);
+ pdb = ssm.setMapping(seq, chains, pdbentry.getFile(), protocol,
+ ap.alignFrame);
if (protocol.equals(jalview.io.DataSourceType.PASTE))
{
{
public static final String RESNUM_FEATURE = "RESNUM";
- /**
- * SequenceFeature group for PDB File features added to sequences
- */
- private static final String PDBFILEFEATURE = "PDBFile";
-
private static final String IEASTATUS = "IEA:jalview";
public String id;
public String pdbid = "";
- public PDBChain(String pdbid, String id)
+ public PDBChain(String thePdbid, String theId)
{
- this.pdbid = pdbid == null ? pdbid : pdbid.toLowerCase();
- this.id = id;
+ this.pdbid = thePdbid == null ? thePdbid : thePdbid.toLowerCase();
+ this.id = theId;
}
/**
}
/**
- * copy over the RESNUM seqfeatures from the internal chain sequence to the
+ * Copies over the RESNUM seqfeatures from the internal chain sequence to the
* mapped sequence
*
* @param seq
* @param status
* The Status of the transferred annotation
- * @return the features added to sq (or its dataset)
*/
- public SequenceFeature[] transferRESNUMFeatures(SequenceI seq,
+ public void transferRESNUMFeatures(SequenceI seq,
String status)
{
SequenceI sq = seq;
sq = sq.getDatasetSequence();
if (sq == sequence)
{
- return null;
+ return;
}
}
- /**
+
+ /*
* Remove any existing features for this chain if they exist ?
* SequenceFeature[] seqsfeatures=seq.getSequenceFeatures(); int
* totfeat=seqsfeatures.length; // Remove any features for this exact chain
{
status = PDBChain.IEASTATUS;
}
- SequenceFeature[] features = sequence.getSequenceFeatures();
- if (features == null)
- {
- return null;
- }
- for (int i = 0; i < features.length; i++)
+
+ List<SequenceFeature> features = sequence.getSequenceFeatures();
+ for (SequenceFeature feature : features)
{
- if (features[i].getFeatureGroup() != null
- && features[i].getFeatureGroup().equals(pdbid))
+ if (feature.getFeatureGroup() != null
+ && feature.getFeatureGroup().equals(pdbid))
{
- SequenceFeature tx = new SequenceFeature(features[i]);
- tx.setBegin(1 + residues.elementAt(tx.getBegin() - offset).atoms
- .elementAt(0).alignmentMapping);
- tx.setEnd(1 + residues.elementAt(tx.getEnd() - offset).atoms
- .elementAt(0).alignmentMapping);
+ int newBegin = 1 + residues.elementAt(feature.getBegin() - offset).atoms
+ .elementAt(0).alignmentMapping;
+ int newEnd = 1 + residues.elementAt(feature.getEnd() - offset).atoms
+ .elementAt(0).alignmentMapping;
+ SequenceFeature tx = new SequenceFeature(feature, newBegin, newEnd,
+ feature.getFeatureGroup(), feature.getScore());
tx.setStatus(status
+ ((tx.getStatus() == null || tx.getStatus().length() == 0)
? ""
}
}
}
- return features;
}
/**
&& residues.lastElement().atoms
.get(0).resNumber == currAtom.resNumber)
{
- SequenceFeature sf = new SequenceFeature("INSERTION",
- currAtom.resName + ":" + currAtom.resNumIns + " " + pdbid
- + id,
- "", offset + count - 1, offset + count - 1, "PDB_INS");
+ String desc = currAtom.resName + ":" + currAtom.resNumIns + " "
+ + pdbid + id;
+ SequenceFeature sf = new SequenceFeature("INSERTION", desc, offset
+ + count - 1, offset + count - 1, "PDB_INS");
resFeatures.addElement(sf);
residues.lastElement().atoms.addAll(resAtoms);
}
else
{
-
// Make a new Residue object with the new atoms vector
residues.addElement(new Residue(resAtoms, resNumber - 1, count));
Residue tmpres = residues.lastElement();
Atom tmpat = tmpres.atoms.get(0);
// Make A new SequenceFeature for the current residue numbering
- SequenceFeature sf = new SequenceFeature(RESNUM_FEATURE,
- tmpat.resName + ":" + tmpat.resNumIns + " " + pdbid + id,
- "", offset + count, offset + count, pdbid);
+ String desc = tmpat.resName
+ + ":" + tmpat.resNumIns + " " + pdbid + id;
+ SequenceFeature sf = new SequenceFeature(RESNUM_FEATURE, desc,
+ offset + count, offset + count, pdbid);
resFeatures.addElement(sf);
resAnnotation.addElement(new Annotation(tmpat.tfactor));
// Keep totting up the sequence
public void splitInsertionCode(String residue)
{
// OK, split the index into number and insertion code
+ // JBPNote - m.matches() can be true even if there is no resnum - this can
+ // cause NumberFormatExceptions below
Pattern p = Pattern.compile("(\\d*)([A-Z]?)");
Matcher m = p.matcher(residue);
if (m.matches())
"WARNING: Consensus skipping null sequence - possible race condition.");
continue;
}
- char[] seq = sequences[row].getSequence();
- if (seq.length > column)
+ if (sequences[row].getLength() > column)
{
- char c = seq[column];
+ char c = sequences[row].getCharAt(column);
residueCounts.add(c);
if (Comparison.isNucleotide(c))
{
import java.awt.Color;
import java.awt.Graphics;
+import java.io.PrintStream;
import java.util.ArrayList;
import java.util.Arrays;
import java.util.List;
*/
public class AlignSeq
{
+ private static final int MAX_NAME_LENGTH = 30;
+
+ private static final int GAP_OPEN_COST = 120;
+
+ private static final int GAP_EXTEND_COST = 20;
+
+ private static final int GAP_INDEX = -1;
+
public static final String PEP = "pep";
public static final String DNA = "dna";
float[][] F;
- int[][] traceback;
+ int[][] traceback; // todo is this actually used?
int[] seq1;
/** DOCUMENT ME!! */
public int seq2start;
- /** DOCUMENT ME!! */
public int seq2end;
int count;
- /** DOCUMENT ME!! */
public float maxscore;
- float pid;
-
int prev = 0;
- int gapOpen = 120;
-
- int gapExtend = 20;
-
StringBuffer output = new StringBuffer();
String type; // AlignSeq.PEP or AlignSeq.DNA
private ScoreMatrix scoreMatrix;
- private static final int GAP_INDEX = -1;
-
/**
* Creates a new AlignSeq object.
*
}
}
- // System.out.println(maxi + " " + maxj + " " + score[maxi][maxj]);
int i = maxi;
int j = maxj;
int trace;
- maxscore = score[i][j] / 10;
+ maxscore = score[i][j] / 10f;
seq1end = maxi + 1;
seq2end = maxj + 1;
/**
* DOCUMENT ME!
*/
- public void printAlignment(java.io.PrintStream os)
+ public void printAlignment(PrintStream os)
{
// TODO: Use original sequence characters rather than re-translated
// characters in output
// Find the biggest id length for formatting purposes
- String s1id = s1.getName(), s2id = s2.getName();
- int maxid = s1.getName().length();
- if (s2.getName().length() > maxid)
- {
- maxid = s2.getName().length();
- }
- if (maxid > 30)
+ String s1id = getAlignedSeq1().getDisplayId(true);
+ String s2id = getAlignedSeq2().getDisplayId(true);
+ int nameLength = Math.max(s1id.length(), s2id.length());
+ if (nameLength > MAX_NAME_LENGTH)
{
- maxid = 30;
+ int truncateBy = nameLength - MAX_NAME_LENGTH;
+ nameLength = MAX_NAME_LENGTH;
// JAL-527 - truncate the sequence ids
- if (s1.getName().length() > maxid)
+ if (s1id.length() > nameLength)
{
- s1id = s1.getName().substring(0, 30);
+ int slashPos = s1id.lastIndexOf('/');
+ s1id = s1id.substring(0, slashPos - truncateBy)
+ + s1id.substring(slashPos);
}
- if (s2.getName().length() > maxid)
+ if (s2id.length() > nameLength)
{
- s2id = s2.getName().substring(0, 30);
+ int slashPos = s2id.lastIndexOf('/');
+ s2id = s2id.substring(0, slashPos - truncateBy)
+ + s2id.substring(slashPos);
}
}
- int len = 72 - maxid - 1;
+ int len = 72 - nameLength - 1;
int nochunks = ((aseq1.length - count) / len)
+ ((aseq1.length - count) % len > 0 ? 1 : 0);
- pid = 0;
+ float pid = 0f;
output.append("Score = ").append(score[maxi][maxj]).append(NEWLINE);
output.append("Length of alignment = ")
.append(String.valueOf(aseq1.length - count)).append(NEWLINE);
output.append("Sequence ");
- output.append(new Format("%" + maxid + "s").form(s1.getName()));
- output.append(" : ").append(String.valueOf(s1.getStart()))
- .append(" - ").append(String.valueOf(s1.getEnd()));
+ Format nameFormat = new Format("%" + nameLength + "s");
+ output.append(nameFormat.form(s1id));
output.append(" (Sequence length = ")
.append(String.valueOf(s1str.length())).append(")")
.append(NEWLINE);
output.append("Sequence ");
- output.append(new Format("%" + maxid + "s").form(s2.getName()));
- output.append(" : ").append(String.valueOf(s2.getStart()))
- .append(" - ").append(String.valueOf(s2.getEnd()));
+ output.append(nameFormat.form(s2id));
output.append(" (Sequence length = ")
.append(String.valueOf(s2str.length())).append(")")
.append(NEWLINE).append(NEWLINE);
for (int j = 0; j < nochunks; j++)
{
// Print the first aligned sequence
- output.append(new Format("%" + (maxid) + "s").form(s1id)).append(" ");
+ output.append(nameFormat.form(s1id)).append(" ");
for (int i = 0; i < len; i++)
{
}
output.append(NEWLINE);
- output.append(new Format("%" + (maxid) + "s").form(" ")).append(" ");
+ output.append(nameFormat.form(" ")).append(" ");
/*
* Print out the match symbols:
pid++;
output.append("|");
}
- else if (type.equals("pep"))
+ else if (PEP.equals(type))
{
if (pam250.getPairwiseScore(c1, c2) > 0)
{
// Now print the second aligned sequence
output = output.append(NEWLINE);
- output = output.append(new Format("%" + (maxid) + "s").form(s2id))
- .append(" ");
+ output = output.append(nameFormat.form(s2id)).append(" ");
for (int i = 0; i < len; i++)
{
}
pid = pid / (aseq1.length - count) * 100;
- output = output.append(new Format("Percentage ID = %2.2f\n").form(pid));
+ output.append(new Format("Percentage ID = %3.2f\n").form(pid));
+ output.append(NEWLINE);
try
{
os.print(output.toString());
public int findTrace(int i, int j)
{
int t = 0;
- // float pairwiseScore = lookup[seq1[i]][seq2[j]];
float pairwiseScore = scoreMatrix.getPairwiseScore(s1str.charAt(i),
s2str.charAt(j));
float max = score[i - 1][j - 1] + (pairwiseScore * 10);
// top left hand element
score[0][0] = scoreMatrix.getPairwiseScore(s1str.charAt(0),
s2str.charAt(0)) * 10;
- E[0][0] = -gapExtend;
+ E[0][0] = -GAP_EXTEND_COST;
F[0][0] = 0;
// Calculate the top row first
for (int j = 1; j < m; j++)
{
// What should these values be? 0 maybe
- E[0][j] = max(score[0][j - 1] - gapOpen, E[0][j - 1] - gapExtend);
- F[0][j] = -gapExtend;
+ E[0][j] = max(score[0][j - 1] - GAP_OPEN_COST, E[0][j - 1] - GAP_EXTEND_COST);
+ F[0][j] = -GAP_EXTEND_COST;
float pairwiseScore = scoreMatrix.getPairwiseScore(s1str.charAt(0),
s2str.charAt(j));
- score[0][j] = max(pairwiseScore * 10, -gapOpen, -gapExtend);
+ score[0][j] = max(pairwiseScore * 10, -GAP_OPEN_COST, -GAP_EXTEND_COST);
traceback[0][j] = 1;
}
// Now do the left hand column
for (int i = 1; i < n; i++)
{
- E[i][0] = -gapOpen;
- F[i][0] = max(score[i - 1][0] - gapOpen, F[i - 1][0] - gapExtend);
+ E[i][0] = -GAP_OPEN_COST;
+ F[i][0] = max(score[i - 1][0] - GAP_OPEN_COST, F[i - 1][0] - GAP_EXTEND_COST);
float pairwiseScore = scoreMatrix.getPairwiseScore(s1str.charAt(i),
s2str.charAt(0));
{
for (int j = 1; j < m; j++)
{
- E[i][j] = max(score[i][j - 1] - gapOpen, E[i][j - 1] - gapExtend);
- F[i][j] = max(score[i - 1][j] - gapOpen, F[i - 1][j] - gapExtend);
+ E[i][j] = max(score[i][j - 1] - GAP_OPEN_COST, E[i][j - 1] - GAP_EXTEND_COST);
+ F[i][j] = max(score[i - 1][j] - GAP_OPEN_COST, F[i - 1][j] - GAP_EXTEND_COST);
float pairwiseScore = scoreMatrix.getPairwiseScore(s1str.charAt(i),
s2str.charAt(j));
import jalview.datamodel.SequenceGroup;
import jalview.datamodel.SequenceI;
import jalview.datamodel.SequenceNode;
-import jalview.util.MessageManager;
import jalview.util.QuickSort;
import java.util.ArrayList;
-import java.util.Arrays;
+import java.util.Collections;
+import java.util.Iterator;
import java.util.List;
/**
*/
public class AlignmentSorter
{
- /**
+ /*
* todo: refactor searches to follow a basic pattern: (search property, last
* search state, current sort direction)
*/
static boolean sortTreeAscending = true;
- /**
- * last Annotation Label used by sortByScore
+ /*
+ * last Annotation Label used for sort by Annotation score
*/
- private static String lastSortByScore;
-
- private static boolean sortByScoreAscending = true;
+ private static String lastSortByAnnotation;
- /**
- * compact representation of last arguments to SortByFeatureScore
+ /*
+ * string hash of last arguments to sortByFeature
+ * (sort order toggles if this is unchanged between sorts)
*/
- private static String lastSortByFeatureScore;
+ private static String sortByFeatureCriteria;
- private static boolean sortByFeatureScoreAscending = true;
+ private static boolean sortByFeatureAscending = true;
private static boolean sortLengthAscending;
}
jalview.util.QuickSort.sort(scores, seqs);
- if (lastSortByScore != scoreLabel)
+ if (lastSortByAnnotation != scoreLabel)
{
- lastSortByScore = scoreLabel;
+ lastSortByAnnotation = scoreLabel;
setOrder(alignment, seqs);
}
else
public static String FEATURE_DENSITY = "density";
/**
- * sort the alignment using the features on each sequence found between start
- * and stop with the given featureLabel (and optional group qualifier)
+ * Sort sequences by feature score or density, optionally restricted by
+ * feature types, feature groups, or alignment start/end positions.
+ * <p>
+ * If the sort is repeated for the same combination of types and groups, sort
+ * order is reversed.
*
- * @param featureLabel
- * (may not be null)
- * @param groupLabel
- * (may be null)
- * @param start
- * (-1 to include non-positional features)
- * @param stop
- * (-1 to only sort on non-positional features)
+ * @param featureTypes
+ * a list of feature types to include (or null for all)
+ * @param groups
+ * a list of feature groups to include (or null for all)
+ * @param startCol
+ * start column position to include (base zero)
+ * @param endCol
+ * end column position to include (base zero)
* @param alignment
- * - aligned sequences containing features
+ * the alignment to be sorted
* @param method
- * - one of the string constants FEATURE_SCORE, FEATURE_LABEL,
- * FEATURE_DENSITY
+ * either "average_score" or "density" ("text" not yet implemented)
*/
- public static void sortByFeature(String featureLabel, String groupLabel,
- int start, int stop, AlignmentI alignment, String method)
- {
- sortByFeature(
- featureLabel == null ? null : Arrays.asList(new String[]
- { featureLabel }),
- groupLabel == null ? null : Arrays.asList(new String[]
- { groupLabel }), start, stop, alignment, method);
- }
-
- private static boolean containsIgnoreCase(final String lab,
- final List<String> labs)
- {
- if (labs == null)
- {
- return true;
- }
- if (lab == null)
- {
- return false;
- }
- for (String label : labs)
- {
- if (lab.equalsIgnoreCase(label))
- {
- return true;
- }
- }
- return false;
- }
-
- public static void sortByFeature(List<String> featureLabels,
- List<String> groupLabels, int start, int stop,
+ public static void sortByFeature(List<String> featureTypes,
+ List<String> groups, final int startCol, final int endCol,
AlignmentI alignment, String method)
{
if (method != FEATURE_SCORE && method != FEATURE_LABEL
&& method != FEATURE_DENSITY)
{
- throw new Error(MessageManager
- .getString("error.implementation_error_sortbyfeature"));
+ String msg = String
+ .format("Implementation Error - sortByFeature method must be either '%s' or '%s'",
+ FEATURE_SCORE, FEATURE_DENSITY);
+ System.err.println(msg);
+ return;
}
- boolean ignoreScore = method != FEATURE_SCORE;
- StringBuffer scoreLabel = new StringBuffer();
- scoreLabel.append(start + stop + method);
- // This doesn't quite work yet - we'd like to have a canonical ordering that
- // can be preserved from call to call
- if (featureLabels != null)
- {
- for (String label : featureLabels)
- {
- scoreLabel.append(label);
- }
- }
- if (groupLabels != null)
- {
- for (String label : groupLabels)
- {
- scoreLabel.append(label);
- }
- }
-
- /*
- * if resorting the same feature, toggle sort order
- */
- if (lastSortByFeatureScore == null
- || !scoreLabel.toString().equals(lastSortByFeatureScore))
- {
- sortByFeatureScoreAscending = true;
- }
- else
- {
- sortByFeatureScoreAscending = !sortByFeatureScoreAscending;
- }
- lastSortByFeatureScore = scoreLabel.toString();
+ flipFeatureSortIfUnchanged(method, featureTypes, groups, startCol, endCol);
SequenceI[] seqs = alignment.getSequencesArray();
int hasScores = 0; // number of scores present on set
double[] scores = new double[seqs.length];
int[] seqScores = new int[seqs.length];
- Object[] feats = new Object[seqs.length];
- double min = 0, max = 0;
+ Object[][] feats = new Object[seqs.length][];
+ double min = 0d;
+ double max = 0d;
+
for (int i = 0; i < seqs.length; i++)
{
- SequenceFeature[] sf = seqs[i].getSequenceFeatures();
- if (sf == null)
- {
- sf = new SequenceFeature[0];
- }
- else
- {
- SequenceFeature[] tmp = new SequenceFeature[sf.length];
- for (int s = 0; s < tmp.length; s++)
- {
- tmp[s] = sf[s];
- }
- sf = tmp;
- }
- int sstart = (start == -1) ? start : seqs[i].findPosition(start);
- int sstop = (stop == -1) ? stop : seqs[i].findPosition(stop);
+ /*
+ * get sequence residues overlapping column region
+ * and features for residue positions and specified types
+ */
+ String[] types = featureTypes == null ? null : featureTypes
+ .toArray(new String[featureTypes.size()]);
+ List<SequenceFeature> sfs = seqs[i].findFeatures(startCol + 1,
+ endCol + 1, types);
+
seqScores[i] = 0;
scores[i] = 0.0;
- int n = sf.length;
- for (int f = 0; f < sf.length; f++)
+
+ Iterator<SequenceFeature> it = sfs.listIterator();
+ while (it.hasNext())
{
- // filter for selection criteria
- SequenceFeature feature = sf[f];
+ SequenceFeature sf = it.next();
/*
- * double-check feature overlaps columns (JAL-2544)
- * (could avoid this with a findPositions(fromCol, toCol) method)
- * findIndex returns base 1 column values, startCol/endCol are base 0
+ * accept all features with null or empty group, otherwise
+ * check group is one of the currently visible groups
*/
- boolean noOverlap = seqs[i].findIndex(feature.getBegin()) > stop + 1
- || seqs[i].findIndex(feature.getEnd()) < start + 1;
- boolean skipFeatureType = featureLabels != null && !AlignmentSorter
- .containsIgnoreCase(feature.type, featureLabels);
- boolean skipFeatureGroup = groupLabels != null
- && (feature.getFeatureGroup() != null
- && !AlignmentSorter.containsIgnoreCase(
- feature.getFeatureGroup(), groupLabels));
- if (noOverlap || skipFeatureType || skipFeatureGroup)
+ String featureGroup = sf.getFeatureGroup();
+ if (groups != null && featureGroup != null
+ && !"".equals(featureGroup)
+ && !groups.contains(featureGroup))
{
- // forget about this feature
- sf[f] = null;
- n--;
+ it.remove();
}
else
{
- // or, also take a look at the scores if necessary.
- if (!ignoreScore && !Float.isNaN(feature.getScore()))
+ float score = sf.getScore();
+ if (FEATURE_SCORE.equals(method) && !Float.isNaN(score))
{
if (seqScores[i] == 0)
{
}
seqScores[i]++;
hasScore[i] = true;
- scores[i] += feature.getScore(); // take the first instance of this
- // score.
+ scores[i] += score;
+ // take the first instance of this score // ??
}
}
}
- SequenceFeature[] fs;
- feats[i] = fs = new SequenceFeature[n];
- if (n > 0)
+
+ feats[i] = sfs.toArray(new SequenceFeature[sfs.size()]);
+ if (!sfs.isEmpty())
{
- n = 0;
- for (int f = 0; f < sf.length; f++)
- {
- if (sf[f] != null)
- {
- ((SequenceFeature[]) feats[i])[n++] = sf[f];
- }
- }
if (method == FEATURE_LABEL)
{
- // order the labels by alphabet
- String[] labs = new String[fs.length];
- for (int l = 0; l < labs.length; l++)
+ // order the labels by alphabet (not yet implemented)
+ String[] labs = new String[sfs.size()];
+ for (int l = 0; l < sfs.size(); l++)
{
- labs[l] = (fs[l].getDescription() != null
- ? fs[l].getDescription()
- : fs[l].getType());
+ SequenceFeature sf = sfs.get(l);
+ String description = sf.getDescription();
+ labs[l] = (description != null ? description : sf.getType());
}
- QuickSort.sort(labs, ((Object[]) feats[i]));
+ QuickSort.sort(labs, feats[i]);
}
}
if (hasScore[i])
// update the score bounds.
if (hasScores == 1)
{
- max = min = scores[i];
+ min = scores[i];
+ max = min;
}
else
{
- if (max < scores[i])
- {
- max = scores[i];
- }
- if (min > scores[i])
- {
- min = scores[i];
- }
+ max = Math.max(max, scores[i]);
+ min = Math.min(min, scores[i]);
}
}
}
- if (method == FEATURE_SCORE)
+ if (FEATURE_SCORE.equals(method))
{
if (hasScores == 0)
{
}
}
}
- QuickSort.sortByDouble(scores, seqs, sortByFeatureScoreAscending);
+ QuickSort.sortByDouble(scores, seqs, sortByFeatureAscending);
}
- else if (method == FEATURE_DENSITY)
+ else if (FEATURE_DENSITY.equals(method))
{
for (int i = 0; i < seqs.length; i++)
{
// System.err.println("Sorting on Density: seq "+seqs[i].getName()+
// " Feats: "+featureCount+" Score : "+scores[i]);
}
- QuickSort.sortByDouble(scores, seqs, sortByFeatureScoreAscending);
+ QuickSort.sortByDouble(scores, seqs, sortByFeatureAscending);
}
- else
+
+ setOrder(alignment, seqs);
+ }
+
+ /**
+ * Builds a string hash of criteria for sorting, and if unchanged from last
+ * time, reverse the sort order
+ *
+ * @param method
+ * @param featureTypes
+ * @param groups
+ * @param startCol
+ * @param endCol
+ */
+ protected static void flipFeatureSortIfUnchanged(String method,
+ List<String> featureTypes, List<String> groups,
+ final int startCol, final int endCol)
+ {
+ StringBuilder sb = new StringBuilder(64);
+ sb.append(startCol).append(method).append(endCol);
+ if (featureTypes != null)
{
- if (method == FEATURE_LABEL)
- {
- throw new Error(
- MessageManager.getString("error.not_yet_implemented"));
- }
+ Collections.sort(featureTypes);
+ sb.append(featureTypes.toString());
}
+ if (groups != null)
+ {
+ Collections.sort(groups);
+ sb.append(groups.toString());
+ }
+ String scoreCriteria = sb.toString();
- setOrder(alignment, seqs);
+ /*
+ * if resorting on the same criteria, toggle sort order
+ */
+ if (sortByFeatureCriteria == null
+ || !scoreCriteria.equals(sortByFeatureCriteria))
+ {
+ sortByFeatureAscending = true;
+ }
+ else
+ {
+ sortByFeatureAscending = !sortByFeatureAscending;
+ }
+ sortByFeatureCriteria = scoreCriteria;
}
}
import jalview.datamodel.SequenceFeature;
import jalview.datamodel.SequenceGroup;
import jalview.datamodel.SequenceI;
-import jalview.io.gff.SequenceOntologyFactory;
+import jalview.datamodel.features.SequenceFeatures;
import jalview.io.gff.SequenceOntologyI;
import jalview.schemes.ResidueProperties;
import jalview.util.Comparison;
import jalview.util.DBRefUtils;
+import jalview.util.IntRangeComparator;
import jalview.util.MapList;
import jalview.util.MappingUtils;
-import jalview.util.RangeComparator;
import jalview.util.StringUtils;
import java.io.UnsupportedEncodingException;
import java.util.Arrays;
import java.util.Collection;
import java.util.Collections;
-import java.util.Comparator;
import java.util.HashMap;
import java.util.HashSet;
import java.util.Iterator;
int toOffset = alignTo.getStart() - 1;
int sourceGapMappedLength = 0;
boolean inExon = false;
- final char[] thisSeq = alignTo.getSequence();
- final char[] thatAligned = alignFrom.getSequence();
- StringBuilder thisAligned = new StringBuilder(2 * thisSeq.length);
+ final int toLength = alignTo.getLength();
+ final int fromLength = alignFrom.getLength();
+ StringBuilder thisAligned = new StringBuilder(2 * toLength);
/*
* Traverse the 'model' aligned sequence
*/
- for (char sourceChar : thatAligned)
+ for (int i = 0; i < fromLength; i++)
{
+ char sourceChar = alignFrom.getCharAt(i);
if (sourceChar == sourceGap)
{
sourceGapMappedLength += ratio;
*/
int intronLength = 0;
while (basesWritten + toOffset < mappedCodonEnd
- && thisSeqPos < thisSeq.length)
+ && thisSeqPos < toLength)
{
- final char c = thisSeq[thisSeqPos++];
+ final char c = alignTo.getCharAt(thisSeqPos++);
if (c != myGapChar)
{
basesWritten++;
int gapsToAdd = calculateGapsToInsert(preserveMappedGaps,
preserveUnmappedGaps, sourceGapMappedLength, inExon,
trailingCopiedGap.length(), intronLength, startOfCodon);
- for (int i = 0; i < gapsToAdd; i++)
+ for (int k = 0; k < gapsToAdd; k++)
{
thisAligned.append(myGapChar);
}
* At end of model aligned sequence. Copy any remaining target sequence, optionally
* including (intron) gaps.
*/
- while (thisSeqPos < thisSeq.length)
+ while (thisSeqPos < toLength)
{
- final char c = thisSeq[thisSeqPos++];
+ final char c = alignTo.getCharAt(thisSeqPos++);
if (c != myGapChar || preserveUnmappedGaps)
{
thisAligned.append(c);
SequenceI peptide = mapping.findAlignedSequence(cdsSeq, protein);
if (peptide != null)
{
- int peptideLength = peptide.getLength();
+ final int peptideLength = peptide.getLength();
Mapping map = mapping.getMappingBetween(cdsSeq, peptide);
if (map != null)
{
{
mapList = mapList.getInverse();
}
- int cdsLength = cdsDss.getLength();
- int mappedFromLength = MappingUtils
- .getLength(mapList.getFromRanges());
+ final int cdsLength = cdsDss.getLength();
+ int mappedFromLength = MappingUtils.getLength(mapList
+ .getFromRanges());
int mappedToLength = MappingUtils
.getLength(mapList.getToRanges());
boolean addStopCodon = (cdsLength == mappedFromLength
* walk over the aligned peptide sequence and insert mapped
* codons for residues in the aligned cds sequence
*/
- char[] alignedPeptide = peptide.getSequence();
- char[] nucleotides = cdsDss.getSequence();
int copiedBases = 0;
int cdsStart = cdsDss.getStart();
int proteinPos = peptide.getStart() - 1;
int cdsCol = 0;
- for (char residue : alignedPeptide)
+
+ for (int col = 0; col < peptideLength; col++)
{
+ char residue = peptide.getCharAt(col);
+
if (Comparison.isGap(residue))
{
cdsCol += CODON_LENGTH;
{
for (int j = codon[0]; j <= codon[1]; j++)
{
- char mappedBase = nucleotides[j - cdsStart];
+ char mappedBase = cdsDss.getCharAt(j - cdsStart);
alignedCds[cdsCol++] = mappedBase;
copiedBases++;
}
* append stop codon if not mapped from protein,
* closing it up to the end of the mapped sequence
*/
- if (copiedBases == nucleotides.length - CODON_LENGTH)
+ if (copiedBases == cdsLength - CODON_LENGTH)
{
for (int i = alignedCds.length - 1; i >= 0; i--)
{
break;
}
}
- for (int i = nucleotides.length
- - CODON_LENGTH; i < nucleotides.length; i++)
+ for (int i = cdsLength - CODON_LENGTH; i < cdsLength; i++)
{
- alignedCds[cdsCol++] = nucleotides[i];
+ alignedCds[cdsCol++] = cdsDss.getCharAt(i);
}
}
cdsSeq.setSequence(new String(alignedCds));
List<SequenceI> unmappedProtein)
{
/*
- * Prefill aligned sequences with gaps before inserting aligned protein
- * residues.
+ * prefill peptide sequences with gaps
*/
int alignedWidth = alignedCodons.size();
char[] gaps = new char[alignedWidth];
Arrays.fill(gaps, protein.getGapCharacter());
- String allGaps = String.valueOf(gaps);
+ Map<SequenceI, char[]> peptides = new HashMap<>();
for (SequenceI seq : protein.getSequences())
{
if (!unmappedProtein.contains(seq))
{
- seq.setSequence(allGaps);
+ peptides.put(seq, Arrays.copyOf(gaps, gaps.length));
}
}
+ /*
+ * Traverse the codons left to right (as defined by CodonComparator)
+ * and insert peptides in each column where the sequence is mapped.
+ * This gives a peptide 'alignment' where residues are aligned if their
+ * corresponding codons occupy the same columns in the cdna alignment.
+ */
int column = 0;
for (AlignedCodon codon : alignedCodons.keySet())
{
.get(codon);
for (Entry<SequenceI, AlignedCodon> entry : columnResidues.entrySet())
{
- // place translated codon at its column position in sequence
- entry.getKey().getSequence()[column] = entry.getValue().product
- .charAt(0);
+ char residue = entry.getValue().product.charAt(0);
+ peptides.get(entry.getKey())[column] = residue;
}
column++;
}
+
+ /*
+ * and finally set the constructed sequences
+ */
+ for (Entry<SequenceI, char[]> entry : peptides.entrySet())
+ {
+ entry.getKey().setSequence(new String(entry.getValue()));
+ }
+
return 0;
}
*
* @param fromSeq
* @param toSeq
+ * @param mapping
+ * the mapping from 'fromSeq' to 'toSeq'
* @param select
* if not null, only features of this type are copied (including
* subtypes in the Sequence Ontology)
- * @param mapping
- * the mapping from 'fromSeq' to 'toSeq'
* @param omitting
*/
public static int transferFeatures(SequenceI fromSeq, SequenceI toSeq,
copyTo = copyTo.getDatasetSequence();
}
- SequenceOntologyI so = SequenceOntologyFactory.getInstance();
+ /*
+ * get features, optionally restricted by an ontology term
+ */
+ List<SequenceFeature> sfs = select == null ? fromSeq.getFeatures()
+ .getPositionalFeatures() : fromSeq.getFeatures()
+ .getFeaturesByOntology(select);
+
int count = 0;
- SequenceFeature[] sfs = fromSeq.getSequenceFeatures();
- if (sfs != null)
+ for (SequenceFeature sf : sfs)
{
- for (SequenceFeature sf : sfs)
+ String type = sf.getType();
+ boolean omit = false;
+ for (String toOmit : omitting)
{
- String type = sf.getType();
- if (select != null && !so.isA(type, select))
+ if (type.equals(toOmit))
{
- continue;
- }
- boolean omit = false;
- for (String toOmit : omitting)
- {
- if (type.equals(toOmit))
- {
- omit = true;
- }
- }
- if (omit)
- {
- continue;
+ omit = true;
}
+ }
+ if (omit)
+ {
+ continue;
+ }
- /*
- * locate the mapped range - null if either start or end is
- * not mapped (no partial overlaps are calculated)
- */
- int start = sf.getBegin();
- int end = sf.getEnd();
- int[] mappedTo = mapping.locateInTo(start, end);
- /*
- * if whole exon range doesn't map, try interpreting it
- * as 5' or 3' exon overlapping the CDS range
- */
- if (mappedTo == null)
- {
- mappedTo = mapping.locateInTo(end, end);
- if (mappedTo != null)
- {
- /*
- * end of exon is in CDS range - 5' overlap
- * to a range from the start of the peptide
- */
- mappedTo[0] = 1;
- }
- }
- if (mappedTo == null)
+ /*
+ * locate the mapped range - null if either start or end is
+ * not mapped (no partial overlaps are calculated)
+ */
+ int start = sf.getBegin();
+ int end = sf.getEnd();
+ int[] mappedTo = mapping.locateInTo(start, end);
+ /*
+ * if whole exon range doesn't map, try interpreting it
+ * as 5' or 3' exon overlapping the CDS range
+ */
+ if (mappedTo == null)
+ {
+ mappedTo = mapping.locateInTo(end, end);
+ if (mappedTo != null)
{
- mappedTo = mapping.locateInTo(start, start);
- if (mappedTo != null)
- {
- /*
- * start of exon is in CDS range - 3' overlap
- * to a range up to the end of the peptide
- */
- mappedTo[1] = toSeq.getLength();
- }
+ /*
+ * end of exon is in CDS range - 5' overlap
+ * to a range from the start of the peptide
+ */
+ mappedTo[0] = 1;
}
+ }
+ if (mappedTo == null)
+ {
+ mappedTo = mapping.locateInTo(start, start);
if (mappedTo != null)
{
- SequenceFeature copy = new SequenceFeature(sf);
- copy.setBegin(Math.min(mappedTo[0], mappedTo[1]));
- copy.setEnd(Math.max(mappedTo[0], mappedTo[1]));
- copyTo.addSequenceFeature(copy);
- count++;
+ /*
+ * start of exon is in CDS range - 3' overlap
+ * to a range up to the end of the peptide
+ */
+ mappedTo[1] = toSeq.getLength();
}
}
+ if (mappedTo != null)
+ {
+ int newBegin = Math.min(mappedTo[0], mappedTo[1]);
+ int newEnd = Math.max(mappedTo[0], mappedTo[1]);
+ SequenceFeature copy = new SequenceFeature(sf, newBegin, newEnd,
+ sf.getFeatureGroup(), sf.getScore());
+ copyTo.addSequenceFeature(copy);
+ count++;
+ }
}
return count;
}
/**
* Returns a mapping from dna to protein by inspecting sequence features of
- * type "CDS" on the dna.
+ * type "CDS" on the dna. A mapping is constructed if the total CDS feature
+ * length is 3 times the peptide length (optionally after dropping a trailing
+ * stop codon). This method does not check whether the CDS nucleotide sequence
+ * translates to the peptide sequence.
*
* @param dnaSeq
* @param proteinSeq
List<int[]> ranges = findCdsPositions(dnaSeq);
int mappedDnaLength = MappingUtils.getLength(ranges);
+ /*
+ * if not a whole number of codons, something is wrong,
+ * abort mapping
+ */
+ if (mappedDnaLength % CODON_LENGTH > 0)
+ {
+ return null;
+ }
+
int proteinLength = proteinSeq.getLength();
int proteinStart = proteinSeq.getStart();
int proteinEnd = proteinSeq.getEnd();
if (codesForResidues == (proteinLength + 1))
{
// assuming extra codon is for STOP and not in peptide
+ // todo: check trailing codon is indeed a STOP codon
codesForResidues--;
+ mappedDnaLength -= CODON_LENGTH;
+ MappingUtils.removeEndPositions(CODON_LENGTH, ranges);
}
+
if (codesForResidues == proteinLength)
{
proteinRange.add(new int[] { proteinStart, proteinEnd });
/**
* Returns a list of CDS ranges found (as sequence positions base 1), i.e. of
- * start/end positions of sequence features of type "CDS" (or a sub-type of
+ * [start, end] positions of sequence features of type "CDS" (or a sub-type of
* CDS in the Sequence Ontology). The ranges are sorted into ascending start
* position order, so this method is only valid for linear CDS in the same
* sense as the protein product.
public static List<int[]> findCdsPositions(SequenceI dnaSeq)
{
List<int[]> result = new ArrayList<int[]>();
- SequenceFeature[] sfs = dnaSeq.getSequenceFeatures();
- if (sfs == null)
+
+ List<SequenceFeature> sfs = dnaSeq.getFeatures().getFeaturesByOntology(
+ SequenceOntologyI.CDS);
+ if (sfs.isEmpty())
{
return result;
}
-
- SequenceOntologyI so = SequenceOntologyFactory.getInstance();
- int startPhase = 0;
+ SequenceFeatures.sortFeatures(sfs, true);
for (SequenceFeature sf : sfs)
{
+ int phase = 0;
+ try
+ {
+ phase = Integer.parseInt(sf.getPhase());
+ } catch (NumberFormatException e)
+ {
+ // ignore
+ }
/*
- * process a CDS feature (or a sub-type of CDS)
+ * phase > 0 on first codon means 5' incomplete - skip to the start
+ * of the next codon; example ENST00000496384
*/
- if (so.isA(sf.getType(), SequenceOntologyI.CDS))
+ int begin = sf.getBegin();
+ int end = sf.getEnd();
+ if (result.isEmpty() && phase > 0)
{
- int phase = 0;
- try
- {
- phase = Integer.parseInt(sf.getPhase());
- } catch (NumberFormatException e)
+ begin += phase;
+ if (begin > end)
{
- // ignore
+ // shouldn't happen!
+ System.err
+ .println("Error: start phase extends beyond start CDS in "
+ + dnaSeq.getName());
}
- /*
- * phase > 0 on first codon means 5' incomplete - skip to the start
- * of the next codon; example ENST00000496384
- */
- int begin = sf.getBegin();
- int end = sf.getEnd();
- if (result.isEmpty())
- {
- begin += phase;
- if (begin > end)
- {
- // shouldn't happen!
- System.err.println(
- "Error: start phase extends beyond start CDS in "
- + dnaSeq.getName());
- }
- }
- result.add(new int[] { begin, end });
}
- }
-
- /*
- * remove 'startPhase' positions (usually 0) from the first range
- * so we begin at the start of a complete codon
- */
- if (!result.isEmpty())
- {
- // TODO JAL-2022 correctly model start phase > 0
- result.get(0)[0] += startPhase;
+ result.add(new int[] { begin, end });
}
/*
* ranges are assembled in order. Other cases should not use this method,
* but instead construct an explicit mapping for CDS (e.g. EMBL parsing).
*/
- Collections.sort(result, new RangeComparator(true));
+ Collections.sort(result, IntRangeComparator.ASCENDING);
return result;
}
count += computePeptideVariants(peptide, peptidePos, codonVariants);
}
- /*
- * sort to get sequence features in start position order
- * - would be better to store in Sequence as a TreeSet or NCList?
- */
- if (peptide.getSequenceFeatures() != null)
- {
- Arrays.sort(peptide.getSequenceFeatures(),
- new Comparator<SequenceFeature>()
- {
- @Override
- public int compare(SequenceFeature o1, SequenceFeature o2)
- {
- int c = Integer.compare(o1.getBegin(), o2.getBegin());
- return c == 0 ? Integer.compare(o1.getEnd(), o2.getEnd())
- : c;
- }
- });
- }
return count;
}
String trans3Char = StringUtils
.toSentenceCase(ResidueProperties.aa2Triplet.get(trans));
String desc = "p." + residue3Char + peptidePos + trans3Char;
- // set score to 0f so 'graduated colour' option is offered! JAL-2060
SequenceFeature sf = new SequenceFeature(
SequenceOntologyI.SEQUENCE_VARIANT, desc, peptidePos,
- peptidePos, 0f, var.getSource());
+ peptidePos, var.getSource());
StringBuilder attributes = new StringBuilder(32);
String id = (String) var.variant.getValue(ID);
if (id != null)
* LinkedHashMap ensures we keep the peptide features in sequence order
*/
LinkedHashMap<Integer, List<DnaVariant>[]> variants = new LinkedHashMap<Integer, List<DnaVariant>[]>();
- SequenceOntologyI so = SequenceOntologyFactory.getInstance();
- SequenceFeature[] dnaFeatures = dnaSeq.getSequenceFeatures();
- if (dnaFeatures == null)
+ List<SequenceFeature> dnaFeatures = dnaSeq.getFeatures()
+ .getFeaturesByOntology(SequenceOntologyI.SEQUENCE_VARIANT);
+ if (dnaFeatures.isEmpty())
{
return variants;
}
// not handling multi-locus variant features
continue;
}
- if (so.isA(sf.getType(), SequenceOntologyI.SEQUENCE_VARIANT))
+ int[] mapsTo = dnaToProtein.locateInTo(dnaCol, dnaCol);
+ if (mapsTo == null)
{
- int[] mapsTo = dnaToProtein.locateInTo(dnaCol, dnaCol);
- if (mapsTo == null)
- {
- // feature doesn't lie within coding region
- continue;
- }
- int peptidePosition = mapsTo[0];
- List<DnaVariant>[] codonVariants = variants.get(peptidePosition);
- if (codonVariants == null)
- {
- codonVariants = new ArrayList[CODON_LENGTH];
- codonVariants[0] = new ArrayList<DnaVariant>();
- codonVariants[1] = new ArrayList<DnaVariant>();
- codonVariants[2] = new ArrayList<DnaVariant>();
- variants.put(peptidePosition, codonVariants);
- }
+ // feature doesn't lie within coding region
+ continue;
+ }
+ int peptidePosition = mapsTo[0];
+ List<DnaVariant>[] codonVariants = variants.get(peptidePosition);
+ if (codonVariants == null)
+ {
+ codonVariants = new ArrayList[CODON_LENGTH];
+ codonVariants[0] = new ArrayList<DnaVariant>();
+ codonVariants[1] = new ArrayList<DnaVariant>();
+ codonVariants[2] = new ArrayList<DnaVariant>();
+ variants.put(peptidePosition, codonVariants);
+ }
- /*
- * extract dna variants to a string array
- */
- String alls = (String) sf.getValue("alleles");
- if (alls == null)
- {
- continue;
- }
- String[] alleles = alls.toUpperCase().split(",");
- int i = 0;
- for (String allele : alleles)
- {
- alleles[i++] = allele.trim(); // lose any space characters "A, G"
- }
+ /*
+ * extract dna variants to a string array
+ */
+ String alls = (String) sf.getValue("alleles");
+ if (alls == null)
+ {
+ continue;
+ }
+ String[] alleles = alls.toUpperCase().split(",");
+ int i = 0;
+ for (String allele : alleles)
+ {
+ alleles[i++] = allele.trim(); // lose any space characters "A, G"
+ }
- /*
- * get this peptide's codon positions e.g. [3, 4, 5] or [4, 7, 10]
- */
- int[] codon = peptidePosition == lastPeptidePostion ? lastCodon
- : MappingUtils.flattenRanges(dnaToProtein
- .locateInFrom(peptidePosition, peptidePosition));
- lastPeptidePostion = peptidePosition;
- lastCodon = codon;
+ /*
+ * get this peptide's codon positions e.g. [3, 4, 5] or [4, 7, 10]
+ */
+ int[] codon = peptidePosition == lastPeptidePostion ? lastCodon
+ : MappingUtils.flattenRanges(dnaToProtein.locateInFrom(
+ peptidePosition, peptidePosition));
+ lastPeptidePostion = peptidePosition;
+ lastCodon = codon;
- /*
- * save nucleotide (and any variant) for each codon position
- */
- for (int codonPos = 0; codonPos < CODON_LENGTH; codonPos++)
+ /*
+ * save nucleotide (and any variant) for each codon position
+ */
+ for (int codonPos = 0; codonPos < CODON_LENGTH; codonPos++)
+ {
+ String nucleotide = String.valueOf(
+ dnaSeq.getCharAt(codon[codonPos] - dnaStart)).toUpperCase();
+ List<DnaVariant> codonVariant = codonVariants[codonPos];
+ if (codon[codonPos] == dnaCol)
{
- String nucleotide = String
- .valueOf(dnaSeq.getCharAt(codon[codonPos] - dnaStart))
- .toUpperCase();
- List<DnaVariant> codonVariant = codonVariants[codonPos];
- if (codon[codonPos] == dnaCol)
+ if (!codonVariant.isEmpty()
+ && codonVariant.get(0).variant == null)
{
- if (!codonVariant.isEmpty()
- && codonVariant.get(0).variant == null)
- {
- /*
- * already recorded base value, add this variant
- */
- codonVariant.get(0).variant = sf;
- }
- else
- {
- /*
- * add variant with base value
- */
- codonVariant.add(new DnaVariant(nucleotide, sf));
- }
+ /*
+ * already recorded base value, add this variant
+ */
+ codonVariant.get(0).variant = sf;
}
- else if (codonVariant.isEmpty())
+ else
{
/*
- * record (possibly non-varying) base value
+ * add variant with base value
*/
- codonVariant.add(new DnaVariant(nucleotide));
+ codonVariant.add(new DnaVariant(nucleotide, sf));
}
}
+ else if (codonVariant.isEmpty())
+ {
+ /*
+ * record (possibly non-varying) base value
+ */
+ codonVariant.add(new DnaVariant(nucleotide));
+ }
}
}
return variants;
seqMap.getMap().getInverse());
}
- char[] fromChars = fromSeq.getSequence();
int toStart = seq.getStart();
- char[] toChars = seq.getSequence();
/*
* traverse [start, end, start, end...] ranges in fromSeq
* of the next character of the mapped-to sequence; stop when all
* the characters of the range have been counted
*/
- while (mappedCharPos <= range[1] && fromCol <= fromChars.length
+ while (mappedCharPos <= range[1] && fromCol <= fromSeq.getLength()
&& fromCol >= 0)
{
- if (!Comparison.isGap(fromChars[fromCol - 1]))
+ if (!Comparison.isGap(fromSeq.getCharAt(fromCol - 1)))
{
/*
* mapped from sequence has a character in this column
seqsMap = new HashMap<SequenceI, Character>();
map.put(fromCol, seqsMap);
}
- seqsMap.put(seq, toChars[mappedCharPos - toStart]);
+ seqsMap.put(seq, seq.getCharAt(mappedCharPos - toStart));
mappedCharPos++;
}
fromCol += (forward ? 1 : -1);
public void completeAnnotations(AlignmentAnnotation conservation,
AlignmentAnnotation quality2, int istart, int alWidth)
{
- char[] sequence = getConsSequence().getSequence();
- float minR;
- float minG;
- float minB;
- float maxR;
- float maxG;
- float maxB;
- minR = 0.3f;
- minG = 0.0f;
- minB = 0f;
- maxR = 1.0f - minR;
- maxG = 0.9f - minG;
- maxB = 0f - minB; // scalable range for colouring both Conservation and
- // Quality
+ SequenceI cons = getConsSequence();
+
+ /*
+ * colour scale for Conservation and Quality;
+ */
+ float minR = 0.3f;
+ float minG = 0.0f;
+ float minB = 0f;
+ float maxR = 1.0f - minR;
+ float maxG = 0.9f - minG;
+ float maxB = 0f - minB;
float min = 0f;
float max = 11f;
float qmin = 0f;
float qmax = 0f;
- char c;
-
if (conservation != null && conservation.annotations != null
&& conservation.annotations.length < alWidth)
{
{
float value = 0;
- c = sequence[i];
+ char c = cons.getCharAt(i);
if (Character.isDigit(c))
{
*/
String getTooltip(int column)
{
- char[] sequence = getConsSequence().getSequence();
- char val = column < sequence.length ? sequence[column] : '-';
+ SequenceI cons = getConsSequence();
+ char val = column < cons.getLength() ? cons.getCharAt(column) : '-';
boolean hasConservation = val != '-' && val != '0';
int consp = column - start;
String tip = (hasConservation && consp > -1 && consp < consSymbs.length)
* duplication (e.g. same variation from two
* transcripts)
*/
- SequenceFeature[] sfs = ms.getSequenceFeatures();
- if (sfs != null)
+ List<SequenceFeature> sfs = ms.getFeatures()
+ .getAllFeatures();
+ for (SequenceFeature feat : sfs)
{
- for (SequenceFeature feat : sfs)
+ /*
+ * make a flyweight feature object which ignores Parent
+ * attribute in equality test; this avoids creating many
+ * otherwise duplicate exon features on genomic sequence
+ */
+ SequenceFeature newFeature = new SequenceFeature(feat)
{
- /*
- * make a flyweight feature object which ignores Parent
- * attribute in equality test; this avoids creating many
- * otherwise duplicate exon features on genomic sequence
- */
- SequenceFeature newFeature = new SequenceFeature(feat)
+ @Override
+ public boolean equals(Object o)
{
- @Override
- public boolean equals(Object o)
- {
- return super.equals(o, true);
- }
- };
- matched.addSequenceFeature(newFeature);
- }
+ return super.equals(o, true);
+ }
+ };
+ matched.addSequenceFeature(newFeature);
}
-
}
cf.addMap(retrievedSequence, map.getTo(), map.getMap());
} catch (Exception e)
{
return false;
}
- char[] c1 = seq1.getSequence();
- char[] c2 = seq2.getSequence();
- if (c1.length != c2.length)
+
+ if (seq1.getLength() != seq2.getLength())
{
return false;
}
- for (int i = 0; i < c1.length; i++)
+ int length = seq1.getLength();
+ for (int i = 0; i < length; i++)
{
- int diff = c1[i] - c2[i];
+ int diff = seq1.getCharAt(i) - seq2.getCharAt(i);
/*
* same char or differ in case only ('a'-'A' == 32)
*/
import java.util.Arrays;
import java.util.Comparator;
import java.util.List;
-import java.util.Map;
public class Dna
{
* @param ac2
* @return
*/
- public static final int compareCodonPos(AlignedCodon ac1,
- AlignedCodon ac2)
+ public static final int compareCodonPos(AlignedCodon ac1, AlignedCodon ac2)
{
return comparator.compare(ac1, ac2);
// return jalview_2_8_2compare(ac1, ac2);
*/
MapList map = new MapList(scontigs, new int[] { 1, resSize }, 3, 1);
- transferCodedFeatures(selection, newseq, map, null, null);
+ transferCodedFeatures(selection, newseq, map);
/*
* Construct a dataset sequence for our new peptide.
/**
* Given a peptide newly translated from a dna sequence, copy over and set any
- * features on the peptide from the DNA. If featureTypes is null, all features
- * on the dna sequence are searched (rather than just the displayed ones), and
- * similarly for featureGroups.
+ * features on the peptide from the DNA.
*
* @param dna
* @param pep
* @param map
- * @param featureTypes
- * hash whose keys are the displayed feature type strings
- * @param featureGroups
- * hash where keys are feature groups and values are Boolean objects
- * indicating if they are displayed.
*/
private static void transferCodedFeatures(SequenceI dna, SequenceI pep,
- MapList map, Map<String, Object> featureTypes,
- Map<String, Boolean> featureGroups)
+ MapList map)
{
- SequenceFeature[] sfs = dna.getSequenceFeatures();
- Boolean fgstate;
DBRefEntry[] dnarefs = DBRefUtils.selectRefs(dna.getDBRefs(),
DBRefSource.DNACODINGDBS);
if (dnarefs != null)
}
}
}
- if (sfs != null)
+ for (SequenceFeature sf : dna.getFeatures().getAllFeatures())
{
- for (SequenceFeature sf : sfs)
- {
- fgstate = (featureGroups == null) ? null
- : featureGroups.get(sf.featureGroup);
- if ((featureTypes == null || featureTypes.containsKey(sf.getType()))
- && (fgstate == null || fgstate.booleanValue()))
+ if (FeatureProperties.isCodingFeature(null, sf.getType()))
{
- if (FeatureProperties.isCodingFeature(null, sf.getType()))
+ // if (map.intersectsFrom(sf[f].begin, sf[f].end))
{
- // if (map.intersectsFrom(sf[f].begin, sf[f].end))
- {
- }
}
}
- }
}
}
import jalview.util.MessageManager;
import java.util.ArrayList;
+import java.util.HashMap;
import java.util.Hashtable;
import java.util.List;
+import java.util.Map;
import java.util.Stack;
-import java.util.Vector;
public class Rna
{
* @return
* @throw {@link WUSSParseException}
*/
- public static Vector<SimpleBP> getSimpleBPs(CharSequence line)
+ protected static List<SimpleBP> getSimpleBPs(CharSequence line)
throws WUSSParseException
{
Hashtable<Character, Stack<Integer>> stacks = new Hashtable<Character, Stack<Integer>>();
- Vector<SimpleBP> pairs = new Vector<SimpleBP>();
+ List<SimpleBP> pairs = new ArrayList<SimpleBP>();
int i = 0;
while (i < line.length())
{
return pairs;
}
- public static SequenceFeature[] getBasePairs(List<SimpleBP> bps)
- throws WUSSParseException
- {
- SequenceFeature[] outPairs = new SequenceFeature[bps.size()];
- for (int p = 0; p < bps.size(); p++)
- {
- SimpleBP bp = bps.get(p);
- outPairs[p] = new SequenceFeature("RNA helix", "", "", bp.getBP5(),
- bp.getBP3(), "");
- }
- return outPairs;
- }
+
- public static List<SimpleBP> getModeleBP(CharSequence line)
- throws WUSSParseException
- {
- Vector<SimpleBP> bps = getSimpleBPs(line);
- return new ArrayList<SimpleBP>(bps);
- }
+
/**
* Function to get the end position corresponding to a given start position
*/
/**
- * Figures out which helix each position belongs to and stores the helix
- * number in the 'featureGroup' member of a SequenceFeature Based off of RALEE
- * code ralee-helix-map.
- *
- * @param pairs
- * Array of SequenceFeature (output from Rna.GetBasePairs)
- */
- public static void HelixMap(SequenceFeature[] pairs)
- {
-
- int helix = 0; // Number of helices/current helix
- int lastopen = 0; // Position of last open bracket reviewed
- int lastclose = 9999999; // Position of last close bracket reviewed
- int i = pairs.length; // Number of pairs
-
- int open; // Position of an open bracket under review
- int close; // Position of a close bracket under review
- int j; // Counter
-
- Hashtable<Integer, Integer> helices = new Hashtable<Integer, Integer>();
- // Keep track of helix number for each position
-
- // Go through each base pair and assign positions a helix
- for (i = 0; i < pairs.length; i++)
- {
-
- open = pairs[i].getBegin();
- close = pairs[i].getEnd();
-
- // System.out.println("open " + open + " close " + close);
- // System.out.println("lastclose " + lastclose + " lastopen " + lastopen);
-
- // we're moving from right to left based on closing pair
- /*
- * catch things like <<..>>..<<..>> |
- */
- if (open > lastclose)
- {
- helix++;
- }
-
- /*
- * catch things like <<..<<..>>..<<..>>>> |
- */
- j = pairs.length - 1;
- while (j >= 0)
- {
- int popen = pairs[j].getBegin();
-
- // System.out.println("j " + j + " popen " + popen + " lastopen "
- // +lastopen + " open " + open);
- if ((popen < lastopen) && (popen > open))
- {
- if (helices.containsValue(popen)
- && ((helices.get(popen)) == helix))
- {
- continue;
- }
- else
- {
- helix++;
- break;
- }
- }
-
- j -= 1;
- }
-
- // Put positions and helix information into the hashtable
- helices.put(open, helix);
- helices.put(close, helix);
-
- // Record helix as featuregroup
- pairs[i].setFeatureGroup(Integer.toString(helix));
-
- lastopen = open;
- lastclose = close;
-
- }
- }
-
- /**
* Answers true if the character is a recognised symbol for RNA secondary
* structure. Currently accepts a-z, A-Z, ()[]{}<>.
*
return c;
}
}
+
+ public static SequenceFeature[] getHelixMap(CharSequence rnaAnnotation)
+ throws WUSSParseException
+ {
+ List<SequenceFeature> result = new ArrayList<SequenceFeature>();
+
+ int helix = 0; // Number of helices/current helix
+ int lastopen = 0; // Position of last open bracket reviewed
+ int lastclose = 9999999; // Position of last close bracket reviewed
+
+ Map<Integer, Integer> helices = new HashMap<Integer, Integer>();
+ // Keep track of helix number for each position
+
+ // Go through each base pair and assign positions a helix
+ List<SimpleBP> bps = getSimpleBPs(rnaAnnotation);
+ for (SimpleBP basePair : bps)
+ {
+ final int open = basePair.getBP5();
+ final int close = basePair.getBP3();
+
+ // System.out.println("open " + open + " close " + close);
+ // System.out.println("lastclose " + lastclose + " lastopen " + lastopen);
+
+ // we're moving from right to left based on closing pair
+ /*
+ * catch things like <<..>>..<<..>> |
+ */
+ if (open > lastclose)
+ {
+ helix++;
+ }
+
+ /*
+ * catch things like <<..<<..>>..<<..>>>> |
+ */
+ int j = bps.size() - 1;
+ while (j >= 0)
+ {
+ int popen = bps.get(j).getBP5();
+
+ // System.out.println("j " + j + " popen " + popen + " lastopen "
+ // +lastopen + " open " + open);
+ if ((popen < lastopen) && (popen > open))
+ {
+ if (helices.containsValue(popen)
+ && ((helices.get(popen)) == helix))
+ {
+ continue;
+ }
+ else
+ {
+ helix++;
+ break;
+ }
+ }
+ j -= 1;
+ }
+
+ // Put positions and helix information into the hashtable
+ helices.put(open, helix);
+ helices.put(close, helix);
+
+ // Record helix as featuregroup
+ result.add(new SequenceFeature("RNA helix", "", open, close,
+ String.valueOf(helix)));
+
+ lastopen = open;
+ lastclose = close;
+ }
+
+ return result.toArray(new SequenceFeature[result.size()]);
+ }
}
import java.util.Enumeration;
import java.util.Hashtable;
+import java.util.List;
import java.util.Vector;
public class SeqsetUtils
{
sqinfo.put("Description", seq.getDescription());
}
- Vector sfeat = new Vector();
- jalview.datamodel.SequenceFeature[] sfarray = seq.getSequenceFeatures();
- if (sfarray != null && sfarray.length > 0)
- {
- for (int i = 0; i < sfarray.length; i++)
- {
- sfeat.addElement(sfarray[i]);
- }
- }
+
+ Vector<SequenceFeature> sfeat = new Vector<SequenceFeature>();
+ List<SequenceFeature> sfs = seq.getFeatures().getAllFeatures();
+ sfeat.addAll(sfs);
+
if (seq.getDatasetSequence() == null)
{
sqinfo.put("SeqFeatures", sfeat);
String oldname = (String) sqinfo.get("Name");
Integer start = (Integer) sqinfo.get("Start");
Integer end = (Integer) sqinfo.get("End");
- Vector sfeatures = (Vector) sqinfo.get("SeqFeatures");
+ Vector<SequenceFeature> sfeatures = (Vector<SequenceFeature>) sqinfo
+ .get("SeqFeatures");
Vector<PDBEntry> pdbid = (Vector<PDBEntry>) sqinfo.get("PdbId");
String description = (String) sqinfo.get("Description");
Sequence seqds = (Sequence) sqinfo.get("datasetSequence");
sq.setEnd(end.intValue());
}
- if ((sfeatures != null) && (sfeatures.size() > 0))
+ if (sfeatures != null && !sfeatures.isEmpty())
{
- SequenceFeature[] sfarray = new SequenceFeature[sfeatures.size()];
- for (int is = 0, isize = sfeatures.size(); is < isize; is++)
- {
- sfarray[is] = (SequenceFeature) sfeatures.elementAt(is);
- }
- sq.setSequenceFeatures(sfarray);
+ sq.setSequenceFeatures(sfeatures);
}
if (description != null)
{
/**
* Builds and returns a map containing a (possibly empty) list (one per
* SeqCigar) of visible feature types at the given column position. The map
- * has no entry for sequences which are gapped at the column position.
+ * does not include entries for features which straddle a gapped column
+ * positions.
*
* @param seqs
* @param columnPosition
+ * (0..)
* @return
*/
protected Map<SeqCigar, Set<String>> findFeatureTypesAtColumn(
int spos = seq.findPosition(columnPosition);
if (spos != -1)
{
+ /*
+ * position is not a gap
+ */
Set<String> types = new HashSet<String>();
- List<SequenceFeature> sfs = fr.findFeaturesAtRes(seq.getRefSeq(),
- spos);
+ List<SequenceFeature> sfs = fr.findFeaturesAtResidue(
+ seq.getRefSeq(), spos);
for (SequenceFeature sf : sfs)
{
types.add(sf.getType());
package jalview.api;
import jalview.analysis.Conservation;
+import jalview.analysis.TreeModel;
import jalview.datamodel.AlignmentAnnotation;
import jalview.datamodel.AlignmentI;
import jalview.datamodel.AlignmentView;
-import jalview.datamodel.CigarArray;
import jalview.datamodel.ColumnSelection;
import jalview.datamodel.ProfilesI;
import jalview.datamodel.SearchResultsI;
void clearSequenceColours();
/**
- * This method returns the visible alignment as text, as seen on the GUI, ie
- * if columns are hidden they will not be returned in the result. Use this for
- * calculating trees, PCA, redundancy etc on views which contain hidden
- * columns.
- *
- * @return String[]
- */
- CigarArray getViewAsCigars(boolean selectedRegionOnly);
-
- /**
* return a compact representation of the current alignment selection to pass
* to an analysis function
*
*
* @return
*/
+ @Override
boolean isProteinFontAsCdna();
/**
*
* @return
*/
+ @Override
void setProteinFontAsCdna(boolean b);
+
+ public abstract TreeModel getCurrentTree();
+
+ public abstract void setCurrentTree(TreeModel tree);
}
*
* @param updateOverview
* - if true, the overview panel will also be updated and repainted
+ * @param updateStructures
+ * - if true then any linked structure views will also be updated
*/
-
- void paintAlignment(boolean updateOverview);
+ void paintAlignment(boolean updateOverview, boolean updateStructures);
/**
* automatically adjust annotation panel height for new annotation whilst
boolean hasThreshold();
/**
- * Returns the computed colour for the given sequence feature
+ * Returns the computed colour for the given sequence feature. Answers null if
+ * the score of this feature instance is outside the range to render (if any),
+ * i.e. lies below or above a configured threshold.
*
* @param feature
* @return
Color getColor(SequenceFeature feature);
/**
- * Answers true if the feature has a simple colour, or is coloured by label,
- * or has a graduated colour and the score of this feature instance is within
- * the range to render (if any), i.e. does not lie below or above any
- * threshold set.
- *
- * @param feature
- * @return
- */
- boolean isColored(SequenceFeature feature);
-
- /**
* Update the min-max range for a graduated colour scheme
*
* @param min
*
* @param sequence
* @param column
+ * aligned column position (1..)
* @param g
* @return
*/
void setGroupVisibility(String group, boolean visible);
/**
- * Returns features at the specified position on the given sequence.
+ * Returns features at the specified aligned column on the given sequence.
+ * Non-positional features are not included. If the column has a gap, then
+ * enclosing features are included (but not contact features).
+ *
+ * @param sequence
+ * @param column
+ * aligned column position (1..)
+ * @return
+ */
+ List<SequenceFeature> findFeaturesAtColumn(SequenceI sequence, int column);
+
+ /**
+ * Returns features at the specified residue position on the given sequence.
* Non-positional features are not included.
*
* @param sequence
- * @param res
+ * @param resNo
+ * residue position (start..)
* @return
*/
- List<SequenceFeature> findFeaturesAtRes(SequenceI sequence, int res);
+ List<SequenceFeature> findFeaturesAtResidue(SequenceI sequence, int resNo);
/**
* get current displayed types, in ordering of rendering (on top last)
List<String> getDisplayedFeatureTypes();
/**
- * get current displayed groups
+ * Returns a (possibly empty) list of currently visible feature groups
*
- * @return a (possibly empty) list of feature groups
+ * @return
*/
List<String> getDisplayedFeatureGroups();
* @return
*/
float getTransparency();
+
}
package jalview.api;
import java.util.Collection;
-import java.util.Iterator;
+import java.util.Set;
public interface FeaturesDisplayedI
{
- Iterator<String> getVisibleFeatures();
+ /**
+ * answers an unmodifiable view of the set of visible feature types
+ */
+ Set<String> getVisibleFeatures();
boolean isVisible(String featureType);
void setVisible(String featureType);
+ /**
+ * Sets all the specified feature types to visible. Visibility of other
+ * feature types is not changed.
+ *
+ * @param featureTypes
+ */
void setAllVisible(Collection<String> featureTypes);
boolean isRegistered(String type);
void addFeatureLinks(final SequenceI seq, List<String> links)
{
Menu linkMenu = new Menu(MessageManager.getString("action.link"));
- Map<String, List<String>> linkset = new LinkedHashMap<String, List<String>>();
+ Map<String, List<String>> linkset = new LinkedHashMap<>();
for (String link : links)
{
* Temporary store to hold distinct calcId / type pairs for the tooltip.
* Using TreeMap means calcIds are shown in alphabetical order.
*/
- SortedMap<String, String> tipEntries = new TreeMap<String, String>();
- final Map<SequenceI, List<AlignmentAnnotation>> candidates = new LinkedHashMap<SequenceI, List<AlignmentAnnotation>>();
+ SortedMap<String, String> tipEntries = new TreeMap<>();
+ final Map<SequenceI, List<AlignmentAnnotation>> candidates = new LinkedHashMap<>();
AlignmentI al = this.ap.av.getAlignment();
AlignmentUtils.findAddableReferenceAnnotations(forSequences, tipEntries,
candidates, al);
}
int gSize = sg.getSize();
- List<SequenceI> seqs = new ArrayList<SequenceI>();
- List<SequenceFeature> features = new ArrayList<SequenceFeature>();
+ List<SequenceI> seqs = new ArrayList<>();
+ List<SequenceFeature> features = new ArrayList<>();
for (int i = 0; i < gSize; i++)
{
if (start <= end)
{
seqs.add(sg.getSequenceAt(i));
- features.add(new SequenceFeature(null, null, null, start, end,
+ features.add(new SequenceFeature(null, null, start, end,
"Jalview"));
}
}
{
ap.alignFrame.sequenceFeatures.setState(true);
ap.av.setShowSequenceFeatures(true);
- ap.highlightSearchResults(null);
+ ap.av.setSearchResults(null); // clear highlighting
+ ap.repaint(); // draw new/amended features
}
}
}
{
seq.setName(dialog.getName());
seq.setDescription(dialog.getDescription());
- ap.paintAlignment(false);
+ ap.paintAlignment(false, false);
}
}
void refresh()
{
- ap.paintAlignment(true);
+ ap.paintAlignment(true, true);
}
protected void clustalColour_actionPerformed()
SequenceGroup sg = ap.av.getSelectionGroup();
ap.av.getAlignment().deleteGroup(sg);
ap.av.setSelectionGroup(null);
- ap.paintAlignment(true);
+ ap.paintAlignment(true, true);
}
void createGroupMenuItem_actionPerformed()
* the insertion order, which is the order of the annotations on the
* alignment.
*/
- Map<String, List<List<String>>> shownTypes = new LinkedHashMap<String, List<List<String>>>();
- Map<String, List<List<String>>> hiddenTypes = new LinkedHashMap<String, List<List<String>>>();
+ Map<String, List<List<String>>> shownTypes = new LinkedHashMap<>();
+ Map<String, List<List<String>>> hiddenTypes = new LinkedHashMap<>();
AlignmentAnnotationUtils.getShownHiddenTypes(shownTypes, hiddenTypes,
AlignmentAnnotationUtils.asList(annotations), forSequences);
createAlignFrameWindow(embedded);
validate();
alignPanel.adjustAnnotationHeight();
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(true, true);
}
public AlignViewport getAlignViewport()
{
viewport.featureSettings.refreshTable();
}
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(true, true);
statusBar.setText(MessageManager
.getString("label.successfully_added_features_alignment"));
}
break;
}
- alignPanel.paintAlignment(true);
+ // TODO: repaint flags set only if the keystroke warrants it
+ alignPanel.paintAlignment(true, true);
}
/**
{
applyAutoAnnotationSettings_actionPerformed();
}
- alignPanel.paintAlignment(true);
+ // TODO: repaint flags set only if warranted
+ alignPanel.paintAlignment(true, true);
}
/**
else if (source == invertColSel)
{
viewport.invertColumnSelection();
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(false, false);
viewport.sendSelection();
}
else if (source == remove2LeftMenuItem)
else if (source == showColumns)
{
viewport.showAllHiddenColumns();
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(true, true);
viewport.sendSelection();
}
else if (source == showSeqs)
{
viewport.showAllHiddenSeqs();
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(true, true);
// uncomment if we want to slave sequence selections in split frame
// viewport.sendSelection();
}
else if (source == hideColumns)
{
viewport.hideSelectedColumns();
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(true, true);
viewport.sendSelection();
}
else if (source == hideSequences
&& viewport.getSelectionGroup() != null)
{
viewport.hideAllSelectedSeqs();
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(true, true);
// uncomment if we want to slave sequence selections in split frame
// viewport.sendSelection();
}
else if (source == hideAllButSelection)
{
toggleHiddenRegions(false, false);
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(true, true);
viewport.sendSelection();
}
else if (source == hideAllSelection)
viewport.expandColSelection(sg, false);
viewport.hideAllSelectedSeqs();
viewport.hideSelectedColumns();
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(true, true);
viewport.sendSelection();
}
else if (source == showAllHidden)
{
viewport.showAllHiddenColumns();
viewport.showAllHiddenSeqs();
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(true, true);
viewport.sendSelection();
}
else if (source == showGroupConsensus)
return null;
}
+ private List<String> getDisplayedFeatureGroups()
+ {
+ if (alignPanel.getFeatureRenderer() != null
+ && viewport.getFeaturesDisplayed() != null)
+ {
+ return alignPanel.getFeatureRenderer().getDisplayedFeatureGroups();
+
+ }
+ return null;
+ }
+
public String outputFeatures(boolean displayTextbox, String format)
{
String features;
FeaturesFile formatter = new FeaturesFile();
if (format.equalsIgnoreCase("Jalview"))
{
- features = formatter.printJalviewFormat(
- viewport.getAlignment().getSequencesArray(),
- getDisplayedFeatureCols());
+ features = formatter.printJalviewFormat(viewport.getAlignment()
+ .getSequencesArray(), getDisplayedFeatureCols(),
+ getDisplayedFeatureGroups(), true);
}
else
{
- features = formatter.printGffFormat(
- viewport.getAlignment().getSequencesArray(),
- getDisplayedFeatureCols());
+ features = formatter.printGffFormat(viewport.getAlignment()
+ .getSequencesArray(), getDisplayedFeatureCols(),
+ getDisplayedFeatureGroups(), true);
}
if (displayTextbox)
{
System.exit(0);
}
- else
+
+ viewport = null;
+ if (alignPanel != null && alignPanel.overviewPanel != null)
{
+ alignPanel.overviewPanel.dispose();
}
- viewport = null;
alignPanel = null;
this.dispose();
}
{
EditCommand editCommand = (EditCommand) command;
al = editCommand.getAlignment();
- Vector comps = (Vector) PaintRefresher.components
+ Vector comps = PaintRefresher.components
.get(viewport.getSequenceSetId());
for (int i = 0; i < comps.size(); i++)
{
}
viewport.getAlignment().moveSelectedSequencesByOne(sg,
up ? null : viewport.getHiddenRepSequences(), up);
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(true, false);
/*
* Also move cDNA/protein complement sequences
viewport, complement);
complement.getAlignment().moveSelectedSequencesByOne(mappedSelection,
up ? null : complement.getHiddenRepSequences(), up);
- getSplitFrame().getComplement(this).alignPanel.paintAlignment(true);
+ getSplitFrame().getComplement(this).alignPanel.paintAlignment(true,
+ false);
}
}
{
PaintRefresher.Refresh(this, viewport.getSequenceSetId());
alignPanel.updateAnnotation();
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(true, true);
}
}
// JAL-2034 - should delegate to
// alignPanel to decide if overview needs
// updating.
- alignPanel.paintAlignment(false);
+ alignPanel.paintAlignment(false, false);
PaintRefresher.Refresh(alignPanel, viewport.getSequenceSetId());
viewport.sendSelection();
}
// JAL-2034 - should delegate to
// alignPanel to decide if overview needs
// updating.
- alignPanel.paintAlignment(false);
+ alignPanel.paintAlignment(false, false);
PaintRefresher.Refresh(alignPanel, viewport.getSequenceSetId());
viewport.sendSelection();
}
public void invertColSel_actionPerformed()
{
viewport.invertColumnSelection();
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(true, false);
PaintRefresher.Refresh(alignPanel, viewport.getSequenceSetId());
viewport.sendSelection();
}
PaintRefresher.Register(newaf.alignPanel.seqPanel.seqCanvas,
newaf.alignPanel.av.getSequenceSetId());
- Vector comps = (Vector) PaintRefresher.components
+ Vector comps = PaintRefresher.components
.get(viewport.getSequenceSetId());
int viewSize = -1;
for (int i = 0; i < comps.size(); i++)
{
viewport.setShowJVSuffix(seqLimits.getState());
alignPanel.fontChanged();
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(true, false);
}
protected void colourTextMenuItem_actionPerformed()
{
viewport.setColourText(colourTextMenuItem.getState());
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(false, false);
}
protected void displayNonconservedMenuItem_actionPerformed()
{
viewport.setShowUnconserved(displayNonconservedMenuItem.getState());
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(false, false);
}
protected void wrapMenuItem_actionPerformed()
scaleAbove.setEnabled(wrapMenuItem.getState());
scaleLeft.setEnabled(wrapMenuItem.getState());
scaleRight.setEnabled(wrapMenuItem.getState());
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(true, false);
}
public void overviewMenuItem_actionPerformed()
{
viewport.setGlobalColourScheme(cs);
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(true, true);
}
protected void modifyPID_actionPerformed()
addHistoryItem(new OrderCommand("Pairwise Sort", oldOrder,
viewport.getAlignment()));
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(true, false);
}
public void sortIDMenuItem_actionPerformed()
AlignmentSorter.sortByID(viewport.getAlignment());
addHistoryItem(
new OrderCommand("ID Sort", oldOrder, viewport.getAlignment()));
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(true, false);
}
public void sortLengthMenuItem_actionPerformed()
AlignmentSorter.sortByLength(viewport.getAlignment());
addHistoryItem(new OrderCommand("Length Sort", oldOrder,
viewport.getAlignment()));
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(true, false);
}
public void sortGroupMenuItem_actionPerformed()
AlignmentSorter.sortByGroup(viewport.getAlignment());
addHistoryItem(new OrderCommand("Group Sort", oldOrder,
viewport.getAlignment()));
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(true, false);
}
current.insertCharAt(Width - 1, viewport.getGapCharacter());
}
}
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(false, false);
}
if ((viewport.getSelectionGroup() != null
current.insertCharAt(Width - 1, viewport.getGapCharacter());
}
}
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(false, false);
}
addHistoryItem(new OrderCommand(MessageManager
.formatMessage("label.order_by_params", new String[]
{ title }), oldOrder, viewport.getAlignment()));
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(true, false);
}
/**
addHistoryItem(new OrderCommand(undoname, oldOrder,
viewport.getAlignment()));
}
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(true, false);
return true;
}
{
// register the association(s) and quit, don't create any windows.
if (StructureSelectionManager.getStructureSelectionManager(applet)
- .setMapping(seqs, chains, pdb.getFile(), protocol) == null)
+ .setMapping(seqs, chains, pdb.getFile(), protocol, null) == null)
{
System.err.println("Failed to map " + pdb.getFile() + " ("
+ protocol + ") to any sequences");
*/
package jalview.appletgui;
-import jalview.analysis.TreeModel;
import jalview.api.AlignViewportI;
import jalview.api.FeatureSettingsModelI;
import jalview.bin.JalviewLite;
boolean validCharWidth = true;
- TreeModel currentTree = null;
-
public jalview.bin.JalviewLite applet;
boolean MAC = false;
private AnnotationColumnChooser annotationColumnSelectionState;
- @Override
- public void finalize()
- {
- applet = null;
- quality = null;
- alignment = null;
- colSel = null;
- }
-
public AlignViewport(AlignmentI al, JalviewLite applet)
{
super(al);
ranges.setEndSeq(height / getCharHeight());
}
- public void setCurrentTree(TreeModel tree)
- {
- currentTree = tree;
- }
-
- public TreeModel getCurrentTree()
- {
- return currentTree;
- }
-
boolean centreColumnLabels;
public boolean getCentreColumnLabels()
// this value is set false when selection area being dragged
boolean fastPaint = true;
- @Override
- public void finalize() throws Throwable
- {
- alignFrame = null;
- av = null;
- vpRanges = null;
- seqPanel = null;
- seqPanelHolder = null;
- sequenceHolderPanel = null;
- scalePanel = null;
- scalePanelHolder = null;
- annotationPanel = null;
- annotationPanelHolder = null;
- annotationSpaceFillerHolder = null;
- super.finalize();
- }
-
public AlignmentPanel(AlignFrame af, final AlignViewport av)
{
try
vpRanges.scrollToWrappedVisible(start);
}
- paintAlignment(redrawOverview);
+ paintAlignment(redrawOverview, false);
return true;
}
apvscroll.addNotify();
hscroll.addNotify();
validate();
- paintAlignment(true);
+ paintAlignment(true, false);
}
/**
* Repaint the alignment and annotations, and, optionally, any overview window
*/
@Override
- public void paintAlignment(boolean updateOverview)
+ public void paintAlignment(boolean updateOverview,
+ boolean updateStructures)
{
final AnnotationSorter sorter = new AnnotationSorter(getAlignment(),
av.isShowAutocalculatedAbove());
av.getSortAnnotationsBy());
repaint();
- if (updateOverview)
+ if (updateStructures)
{
- // TODO: determine if this paintAlignment changed structure colours
jalview.structure.StructureSelectionManager
.getStructureSelectionManager(av.applet)
.sequenceColoursChanged(this);
-
+ }
+ if (updateOverview)
+ {
if (overviewPanel != null)
{
overviewPanel.updateOverviewImage();
oldcs = av.getGlobalColourScheme();
if (av.getAlignment().getGroups() != null)
{
- oldgroupColours = new HashMap<SequenceGroup, ColourSchemeI>();
+ oldgroupColours = new HashMap<>();
for (SequenceGroup sg : ap.av.getAlignment().getGroups())
{
oldgroupColours.put(sg, sg.getColourScheme());
// TODO remove duplication with gui.AnnotationRowFilter
// TODO add 'per sequence only' option / parameter
- annotationLabels = new HashMap<AlignmentAnnotation, String>();
- Vector<String> list = new Vector<String>();
+ annotationLabels = new HashMap<>();
+ Vector<String> list = new Vector<>();
AlignmentAnnotation[] anns = av.getAlignment().getAlignmentAnnotation();
if (anns == null)
{
else if (evt.getSource() == cancel)
{
reset();
- ap.paintAlignment(true);
+ ap.paintAlignment(true, true);
frame.setVisible(false);
}
}
currentAnnotation.threshold.value = slider.getValue() / 1000f;
- ap.paintAlignment(false);
+ ap.paintAlignment(false, false);
}
}
// update colours in linked windows
ap.alignmentChanged();
- ap.paintAlignment(true);
+ ap.paintAlignment(true, true);
}
void reset()
sg.setColourScheme(oldgroupColours.get(sg));
}
}
- ap.paintAlignment(true);
+ ap.paintAlignment(true, true);
}
@Override
@Override
public void mouseReleased(MouseEvent evt)
{
- ap.paintAlignment(true);
+ ap.paintAlignment(true, true);
}
@Override
av.getAlignment().setHiddenColumns(oldHidden);
}
av.sendSelection();
- ap.paintAlignment(true);
+ ap.paintAlignment(true, true);
}
}
sliderDragging = false;
valueChanged(true);
}
- ap.paintAlignment(true);
+ ap.paintAlignment(true, true);
}
});
}
if (slider.isEnabled())
{
getCurrentAnnotation().threshold.value = slider.getValue() / 1000f;
- updateView();
- ap.paintAlignment(false);
+ updateView(); // this also calls paintAlignment(true,true)
}
}
filterParams = null;
av.setAnnotationColumnSelectionState(this);
av.sendSelection();
- ap.paintAlignment(true);
+ ap.paintAlignment(true, true);
}
public HiddenColumns getOldHiddenColumns()
ap.annotationPanel.adjustPanelHeight();
setSize(getSize().width, ap.annotationPanel.getSize().height);
ap.validate();
- ap.paintAlignment(true);
+ // TODO: only paint if we needed to
+ ap.paintAlignment(true, true);
}
boolean editLabelDescription(AlignmentAnnotation annotation)
{
ap.av.setIgnoreGapsConsensus(cbmi.getState(), ap);
}
- ap.paintAlignment(true);
+ ap.paintAlignment(true, true);
}
});
popup.add(cbmi);
}
}
}
- ap.paintAlignment(false);
+ ap.paintAlignment(false, false);
PaintRefresher.Refresh(ap, ap.av.getSequenceSetId());
ap.av.sendSelection();
}
sg.addSequence(aa[selectedRow].sequenceRef, false);
}
ap.av.setSelectionGroup(sg);
- ap.paintAlignment(false);
+ ap.paintAlignment(false, false);
PaintRefresher.Refresh(ap, ap.av.getSequenceSetId());
ap.av.sendSelection();
}
graphStretchY = evt.getY();
av.calcPanelHeight();
needValidating = true;
- ap.paintAlignment(true);
+ // TODO: only update overview visible geometry
+ ap.paintAlignment(true, false);
}
else
{
{
fastPaint((int) evt.getNewValue() - (int) evt.getOldValue());
}
+ else if (evt.getPropertyName().equals(ViewportRanges.STARTRESANDSEQ))
+ {
+ fastPaint(((int[]) evt.getNewValue())[0]
+ - ((int[]) evt.getOldValue())[0]);
+ }
+ else if (evt.getPropertyName().equals(ViewportRanges.MOVE_VIEWPORT))
+ {
+ repaint();
+ }
}
}
public void cancel_actionPerformed(ActionEvent e)
{
reset();
- ap.paintAlignment(true);
+ ap.paintAlignment(true, true);
frame.setVisible(false);
}
AlignmentPanel ap;
- List<AlignmentPanel> _aps = new ArrayList<AlignmentPanel>(); // remove? never
+ List<AlignmentPanel> _aps = new ArrayList<>(); // remove? never
// added to
String fileLoadingError;
{
reader = StructureSelectionManager
.getStructureSelectionManager(ap.av.applet)
- .setMapping(seq, chains, pdbentry.getFile(), protocol);
+ .setMapping(seq, chains, pdbentry.getFile(), protocol, null);
// PROMPT USER HERE TO ADD TO NEW OR EXISTING VIEW?
// FOR NOW, LETS JUST OPEN A NEW WINDOW
}
void centerViewer()
{
- Vector<String> toshow = new Vector<String>();
+ Vector<String> toshow = new Vector<>();
for (int i = 0; i < chainMenu.getItemCount(); i++)
{
if (chainMenu.getItem(i) instanceof CheckboxMenuItem)
import jalview.datamodel.PDBEntry;
import jalview.datamodel.SequenceI;
import jalview.ext.jmol.JalviewJmolBinding;
+import jalview.gui.IProgressIndicator;
import jalview.io.DataSourceType;
import jalview.structure.StructureSelectionManager;
// TODO Auto-generated method stub
return null;
}
+
+ @Override
+ protected IProgressIndicator getIProgressIndicator()
+ {
+ // no progress indicators on the applet
+ return null;
+ }
}
import jalview.datamodel.PDBEntry;
import jalview.datamodel.SequenceI;
import jalview.ext.jmol.JalviewJmolBinding;
+import jalview.gui.IProgressIndicator;
import jalview.io.DataSourceType;
import java.awt.Container;
}
@Override
+ protected IProgressIndicator getIProgressIndicator()
+ {
+ // no progress indicators on applet (could access javascript for this)
+ return null;
+ }
+
+ @Override
public void updateColours(Object source)
{
}
}
+
@Override
public SequenceRenderer getSequenceRenderer(AlignmentViewPanel alignment)
{
@Override
public void refreshPdbEntries()
{
- List<PDBEntry> pdbe = new ArrayList<PDBEntry>();
- List<String> fileids = new ArrayList<String>();
+ List<PDBEntry> pdbe = new ArrayList<>();
+ List<String> fileids = new ArrayList<>();
SequenceI[] sq = ap.av.getAlignment().getSequencesArray();
for (int s = 0; s < sq.length; s++)
{
import java.awt.event.ActionListener;
import java.awt.event.AdjustmentEvent;
import java.awt.event.AdjustmentListener;
+import java.awt.event.FocusAdapter;
+import java.awt.event.FocusEvent;
import java.awt.event.ItemEvent;
import java.awt.event.ItemListener;
import java.awt.event.MouseEvent;
threshold.addItem(MessageManager
.getString("label.threshold_feature_below_threshold"));
thresholdValue.addActionListener(this);
+ thresholdValue.addFocusListener(new FocusAdapter()
+ {
+ @Override
+ public void focusLost(FocusEvent e)
+ {
+ thresholdValue_actionPerformed();
+ }
+ });
slider.setBackground(Color.white);
slider.setEnabled(false);
slider.setSize(new Dimension(93, 21));
{
if (evt.getSource() == thresholdValue)
{
- try
- {
- float f = new Float(thresholdValue.getText()).floatValue();
- slider.setValue((int) (f * SCALE_FACTOR_1K));
- adjustmentValueChanged(null);
-
- /*
- * force repaint of any Overview window or structure
- */
- changeColour(true);
- } catch (NumberFormatException ex)
- {
- }
+ thresholdValue_actionPerformed();
}
else if (evt.getSource() == minColour)
{
}
}
+ /**
+ * Action on input of a value for colour score threshold
+ */
+ protected void thresholdValue_actionPerformed()
+ {
+ try
+ {
+ float f = new Float(thresholdValue.getText()).floatValue();
+ slider.setValue((int) (f * SCALE_FACTOR_1K));
+ adjustmentValueChanged(null);
+
+ /*
+ * force repaint of any Overview window or structure
+ */
+ changeColour(true);
+ } catch (NumberFormatException ex)
+ {
+ }
+ }
+
@Override
public void itemStateChanged(ItemEvent evt)
{
/*
* only update default type and group if we used defaults
*/
- String enteredType = name.getText().trim();
+ final String enteredType = name.getText().trim();
+ final String enteredGroup = group.getText().trim();
+ final String enteredDesc = description.getText().replace('\n', ' ');
+
if (dialog.accept && useLastDefaults)
{
lastFeatureAdded = enteredType;
- lastFeatureGroupAdded = group.getText().trim();
+ lastFeatureGroupAdded = enteredGroup;
}
if (!create)
SequenceFeature sf = features.get(featureIndex);
if (dialog.accept)
{
- sf.type = enteredType;
- sf.featureGroup = group.getText().trim();
- if (sf.featureGroup != null && sf.featureGroup.length() < 1)
- {
- sf.featureGroup = null;
- }
- sf.description = description.getText().replace('\n', ' ');
if (!colourPanel.isGcol)
{
// update colour - otherwise its already done.
- setColour(sf.type,
+ setColour(enteredType,
new FeatureColour(colourPanel.getBackground()));
}
+ int newBegin = sf.begin;
+ int newEnd = sf.end;
try
{
- sf.begin = Integer.parseInt(start.getText());
- sf.end = Integer.parseInt(end.getText());
+ newBegin = Integer.parseInt(start.getText());
+ newEnd = Integer.parseInt(end.getText());
} catch (NumberFormatException ex)
{
- //
+ //
}
- boolean typeOrGroupChanged = (!featureType.equals(sf.type)
- || !featureGroup.equals(sf.featureGroup));
+
+ /*
+ * replace the feature by deleting it and adding a new one
+ * (to ensure integrity of SequenceFeatures data store)
+ */
+ sequences.get(0).deleteFeature(sf);
+ SequenceFeature newSf = new SequenceFeature(sf, enteredType,
+ newBegin, newEnd, enteredGroup, sf.getScore());
+ newSf.setDescription(enteredDesc);
+ ffile.parseDescriptionHTML(newSf, false);
+ // amend features dialog only updates one sequence at a time
+ sequences.get(0).addSequenceFeature(newSf);
+ boolean typeOrGroupChanged = (!featureType.equals(newSf.getType()) || !featureGroup
+ .equals(newSf.getFeatureGroup()));
ffile.parseDescriptionHTML(sf, false);
if (typeOrGroupChanged)
{
for (int i = 0; i < sequences.size(); i++)
{
- features.get(i).type = enteredType;
- features.get(i).featureGroup = group.getText().trim();
- features.get(i).description = description.getText().replace('\n',
- ' ');
- sequences.get(i).addSequenceFeature(features.get(i));
- ffile.parseDescriptionHTML(features.get(i), false);
+ SequenceFeature sf = features.get(i);
+ SequenceFeature sf2 = new SequenceFeature(enteredType,
+ enteredDesc, sf.getBegin(), sf.getEnd(), enteredGroup);
+ ffile.parseDescriptionHTML(sf2, false);
+ sequences.get(i).addSequenceFeature(sf2);
}
Color newColour = colourPanel.getBackground();
}
// findAllFeatures();
- ap.paintAlignment(true);
+ ap.paintAlignment(true, true);
return true;
}
import jalview.api.FeatureColourI;
import jalview.api.FeatureSettingsControllerI;
import jalview.datamodel.AlignmentI;
-import jalview.datamodel.SequenceFeature;
+import jalview.datamodel.SequenceI;
import jalview.util.MessageManager;
import java.awt.BorderLayout;
import java.awt.event.MouseMotionListener;
import java.awt.event.WindowAdapter;
import java.awt.event.WindowEvent;
+import java.util.ArrayList;
import java.util.Arrays;
-import java.util.Enumeration;
import java.util.HashSet;
import java.util.List;
import java.util.Map;
import java.util.Set;
-import java.util.Vector;
public class FeatureSettings extends Panel
implements ItemListener, MouseListener, MouseMotionListener,
// Group selection states
void resetTable(boolean groupsChanged)
{
- SequenceFeature[] tmpfeatures;
- String group = null, type;
- Vector<String> visibleChecks = new Vector<String>();
- Set<String> foundGroups = new HashSet<String>();
+ List<String> displayableTypes = new ArrayList<>();
+ Set<String> foundGroups = new HashSet<>();
+
AlignmentI alignment = av.getAlignment();
for (int i = 0; i < alignment.getHeight(); i++)
{
- if (alignment.getSequenceAt(i).getSequenceFeatures() == null)
- {
- continue;
- }
+ SequenceI seq = alignment.getSequenceAt(i);
- tmpfeatures = alignment.getSequenceAt(i).getSequenceFeatures();
- int index = 0;
- while (index < tmpfeatures.length)
+ /*
+ * get the sequence's groups for positional features
+ * and keep track of which groups are visible
+ */
+ Set<String> groups = seq.getFeatures().getFeatureGroups(true);
+ Set<String> visibleGroups = new HashSet<>();
+ for (String group : groups)
{
- group = tmpfeatures[index].featureGroup;
- foundGroups.add(group);
-
+ // if (group == null || fr.checkGroupVisibility(group, true))
if (group == null || checkGroupState(group))
{
- type = tmpfeatures[index].getType();
- if (!visibleChecks.contains(type))
- {
- visibleChecks.addElement(type);
- }
+ visibleGroups.add(group);
}
- index++;
}
+ foundGroups.addAll(groups);
+
+ /*
+ * get distinct feature types for visible groups
+ * record distinct visible types
+ */
+ Set<String> types = seq.getFeatures().getFeatureTypesForGroups(true,
+ visibleGroups.toArray(new String[visibleGroups.size()]));
+ displayableTypes.addAll(types);
}
/*
{
comps = featurePanel.getComponents();
check = (MyCheckbox) comps[i];
- if (!visibleChecks.contains(check.type))
+ if (!displayableTypes.contains(check.type))
{
featurePanel.remove(i);
cSize--;
{
String item = rol.get(ro);
- if (!visibleChecks.contains(item))
+ if (!displayableTypes.contains(item))
{
continue;
}
- visibleChecks.removeElement(item);
+ displayableTypes.remove(item);
addCheck(false, item);
}
}
- // now add checkboxes which should be visible,
- // if they have not already been added
- Enumeration<String> en = visibleChecks.elements();
-
- while (en.hasMoreElements())
+ /*
+ * now add checkboxes which should be visible,
+ * if they have not already been added
+ */
+ for (String type : displayableTypes)
{
- addCheck(groupsChanged, en.nextElement().toString());
+ addCheck(groupsChanged, type);
}
featurePanel.setLayout(
fr.setFeaturePriority(data);
- ap.paintAlignment(updateOverview);
+ ap.paintAlignment(updateOverview, updateOverview);
}
MyCheckbox selectedCheck;
{
featurePanel.removeAll();
resetTable(false);
- ap.paintAlignment(true);
+ ap.paintAlignment(true, true);
}
@Override
public void adjustmentValueChanged(AdjustmentEvent evt)
{
fr.setTransparency((100 - transparency.getValue()) / 100f);
- ap.paintAlignment(true);
+ ap.paintAlignment(true, true);
}
class MyCheckbox extends Checkbox
for (SearchResultMatchI match : searchResults.getResults())
{
seqs.add(match.getSequence().getDatasetSequence());
- features.add(new SequenceFeature(searchString, "Search Results", null,
+ features.add(new SequenceFeature(searchString, "Search Results",
match.getStart(), match.getEnd(), "Search Results"));
}
{
ap.av.setCharWidth(oldCharWidth);
}
- ap.paintAlignment(true);
+ ap.paintAlignment(true, false);
}
else if (tp != null)
{
{
fastPaint((int) evt.getNewValue() - (int) evt.getOldValue());
}
+ else if (propertyName.equals(ViewportRanges.STARTRESANDSEQ))
+ {
+ fastPaint(((int[]) evt.getNewValue())[1]
+ - ((int[]) evt.getOldValue())[1]);
+ }
+ else if (propertyName.equals(ViewportRanges.MOVE_VIEWPORT))
+ {
+ repaint();
+ }
}
}
*/
package jalview.appletgui;
-import jalview.datamodel.Sequence;
import jalview.datamodel.SequenceFeature;
import jalview.datamodel.SequenceGroup;
import jalview.datamodel.SequenceI;
UrlProviderI urlProvider = null;
- public IdPanel(AlignViewport av, AlignmentPanel parent)
+ public IdPanel(AlignViewport viewport, AlignmentPanel parent)
{
- this.av = av;
+ this.av = viewport;
alignPanel = parent;
- idCanvas = new IdCanvas(av);
+ idCanvas = new IdCanvas(viewport);
setLayout(new BorderLayout());
add(idCanvas, BorderLayout.CENTER);
idCanvas.addMouseListener(this);
// TODO: add in group link parameter
// make a list of label,url pairs
- HashMap<String, String> urlList = new HashMap<String, String>();
- if (av.applet != null)
+ HashMap<String, String> urlList = new HashMap<>();
+ if (viewport.applet != null)
{
for (int i = 1; i < 10; i++)
{
- label = av.applet.getParameter("linkLabel_" + i);
- url = av.applet.getParameter("linkURL_" + i);
+ label = viewport.applet.getParameter("linkLabel_" + i);
+ url = viewport.applet.getParameter("linkURL_" + i);
// only add non-null parameters
if (label != null)
if (!urlList.isEmpty())
{
// set default as first entry in list
- String defaultUrl = av.applet.getParameter("linkLabel_1");
+ String defaultUrl = viewport.applet.getParameter("linkLabel_1");
UrlProviderFactoryI factory = new AppletUrlProviderFactory(
defaultUrl, urlList);
urlProvider = factory.createUrlProvider();
SequenceI sequence = av.getAlignment().getSequenceAt(seq);
- // look for non-pos features
StringBuffer tooltiptext = new StringBuffer();
- if (sequence != null)
+ if (sequence == null)
{
- if (sequence.getDescription() != null)
+ return;
+ }
+ if (sequence.getDescription() != null)
+ {
+ tooltiptext.append(sequence.getDescription());
+ tooltiptext.append("\n");
+ }
+
+ for (SequenceFeature sf : sequence.getFeatures()
+ .getNonPositionalFeatures())
+ {
+ boolean nl = false;
+ if (sf.getFeatureGroup() != null)
{
- tooltiptext.append(sequence.getDescription());
- tooltiptext.append("\n");
+ tooltiptext.append(sf.getFeatureGroup());
+ nl = true;
}
-
- SequenceFeature sf[] = sequence.getSequenceFeatures();
- for (int sl = 0; sf != null && sl < sf.length; sl++)
+ if (sf.getType() != null)
{
- if (sf[sl].begin == sf[sl].end && sf[sl].begin == 0)
- {
- boolean nl = false;
- if (sf[sl].getFeatureGroup() != null)
- {
- tooltiptext.append(sf[sl].getFeatureGroup());
- nl = true;
- }
- ;
- if (sf[sl].getType() != null)
- {
- tooltiptext.append(" ");
- tooltiptext.append(sf[sl].getType());
- nl = true;
- }
- ;
- if (sf[sl].getDescription() != null)
- {
- tooltiptext.append(" ");
- tooltiptext.append(sf[sl].getDescription());
- nl = true;
- }
- ;
- if (!Float.isNaN(sf[sl].getScore()) && sf[sl].getScore() != 0f)
- {
- tooltiptext.append(" Score = ");
- tooltiptext.append(sf[sl].getScore());
- nl = true;
- }
- ;
- if (sf[sl].getStatus() != null && sf[sl].getStatus().length() > 0)
- {
- tooltiptext.append(" (");
- tooltiptext.append(sf[sl].getStatus());
- tooltiptext.append(")");
- nl = true;
- }
- ;
- if (nl)
- {
- tooltiptext.append("\n");
- }
- }
+ tooltiptext.append(" ");
+ tooltiptext.append(sf.getType());
+ nl = true;
+ }
+ if (sf.getDescription() != null)
+ {
+ tooltiptext.append(" ");
+ tooltiptext.append(sf.getDescription());
+ nl = true;
+ }
+ if (!Float.isNaN(sf.getScore()) && sf.getScore() != 0f)
+ {
+ tooltiptext.append(" Score = ");
+ tooltiptext.append(sf.getScore());
+ nl = true;
+ }
+ if (sf.getStatus() != null && sf.getStatus().length() > 0)
+ {
+ tooltiptext.append(" (");
+ tooltiptext.append(sf.getStatus());
+ tooltiptext.append(")");
+ nl = true;
+ }
+ if (nl)
+ {
+ tooltiptext.append("\n");
}
}
+
if (tooltiptext.length() == 0)
{
// nothing to display - so clear tooltip if one is visible
}
lastid = seq;
- alignPanel.paintAlignment(false);
+ alignPanel.paintAlignment(false, false);
}
@Override
if ((e.getModifiers()
& InputEvent.BUTTON3_MASK) == InputEvent.BUTTON3_MASK)
{
- Sequence sq = (Sequence) av.getAlignment().getSequenceAt(seq);
+ SequenceI sq = av.getAlignment().getSequenceAt(seq);
- // build a new links menu based on the current links + any non-positional
- // features
+ /*
+ * build a new links menu based on the current links
+ * and any non-positional features
+ */
List<String> nlinks;
if (urlProvider != null)
{
}
else
{
- nlinks = new ArrayList<String>();
+ nlinks = new ArrayList<>();
}
- SequenceFeature sf[] = sq == null ? null : sq.getSequenceFeatures();
- for (int sl = 0; sf != null && sl < sf.length; sl++)
+
+ for (SequenceFeature sf : sq.getFeatures().getNonPositionalFeatures())
{
- if (sf[sl].begin == sf[sl].end && sf[sl].begin == 0)
+ if (sf.links != null)
{
- if (sf[sl].links != null && sf[sl].links.size() > 0)
+ for (String link : sf.links)
{
- for (int l = 0, lSize = sf[sl].links.size(); l < lSize; l++)
- {
- nlinks.add(sf[sl].links.elementAt(l));
- }
+ nlinks.add(link);
}
}
}
selectSeq(seq);
}
- alignPanel.paintAlignment(false);
+ alignPanel.paintAlignment(false, false);
}
void selectSeq(int seq)
boolean up = true;
- public ScrollThread(boolean up)
+ public ScrollThread(boolean isUp)
{
- this.up = up;
+ this.up = isUp;
start();
}
running = false;
}
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(true, false);
try
{
Thread.sleep(100);
import java.awt.CheckboxMenuItem;
import java.awt.Cursor;
import java.awt.Dimension;
+import java.awt.Frame;
import java.awt.Panel;
import java.awt.PopupMenu;
import java.awt.event.ComponentAdapter;
av.getAlignment().getHiddenSequences(),
av.getAlignment().getHiddenColumns());
}
- ap.paintAlignment(false);
+ ap.paintAlignment(false, false);
}
}
try
{
av.getRanges().removePropertyChangeListener(this);
+ Frame parent = (Frame) getParent();
+ parent.dispose();
+ parent.setVisible(false);
} finally
{
av = null;
import jalview.datamodel.SequenceI;
import java.awt.Component;
-import java.util.Enumeration;
import java.util.Hashtable;
+import java.util.Iterator;
import java.util.List;
import java.util.Map;
import java.util.Vector;
return;
}
- for (String id : components.keySet())
+ Iterator<String> it = components.keySet().iterator();
+ while (it.hasNext())
{
- Vector<Component> comps = components.get(id);
+ Vector<Component> comps = components.get(it.next());
comps.removeElement(comp);
- if (comps.size() == 0)
+ if (comps.isEmpty())
{
- components.remove(id);
+ it.remove();
}
}
}
return;
}
- Enumeration<Component> e = comps.elements();
- while (e.hasMoreElements())
+ Iterator<Component> it = comps.iterator();
+ while (it.hasNext())
{
- comp = e.nextElement();
+ comp = it.next();
if (comp == source)
{
if (!comp.isValid())
{
- comps.removeElement(comp);
+ it.remove();
}
else if (validateSequences && comp instanceof AlignmentPanel
&& source instanceof AlignmentPanel)
float value = slider.getValue();
- List<SequenceI> redundantSequences = new ArrayList<SequenceI>();
+ List<SequenceI> redundantSequences = new ArrayList<>();
for (int i = 0; i < redundancy.length; i++)
{
if (value <= redundancy[i])
ap.av.getAlignment().getSequences());
}
- ap.paintAlignment(true);
+ ap.paintAlignment(true, true);
if (historyList.size() == 0)
{
sg.setStartRes(min);
sg.setEndRes(max);
}
- ap.paintAlignment(false);
+ ap.paintAlignment(false, false);
av.sendSelection();
}
{
av.showColumn(reveal[0]);
reveal = null;
- ap.paintAlignment(true);
+ ap.paintAlignment(true, true);
av.sendSelection();
}
});
{
av.showAllHiddenColumns();
reveal = null;
- ap.paintAlignment(true);
+ ap.paintAlignment(true, true);
av.sendSelection();
}
});
av.setSelectionGroup(null);
}
- ap.paintAlignment(true);
+ ap.paintAlignment(true, true);
av.sendSelection();
}
});
if (!stretchingGroup)
{
- ap.paintAlignment(false);
+ ap.paintAlignment(false, false);
return;
}
}
stretchingGroup = false;
- ap.paintAlignment(false);
+ ap.paintAlignment(false, false);
av.sendSelection();
}
{
stretchingGroup = true;
cs.stretchGroup(res, sg, min, max);
- ap.paintAlignment(false);
+ ap.paintAlignment(false, false);
}
}
// Here we only want to fastpaint on a scroll, with resize using a normal
// paint, so scroll events are identified as changes to the horizontal or
// vertical start value.
- if (evt.getPropertyName().equals(ViewportRanges.STARTRES))
+ if (evt.getPropertyName().equals(ViewportRanges.STARTRES)
+ || evt.getPropertyName().equals(ViewportRanges.STARTRESANDSEQ)
+ || evt.getPropertyName().equals(ViewportRanges.MOVE_VIEWPORT))
{
// scroll event, repaint panel
repaint();
return annotations.adjustPanelHeight();
}
- private void drawPanel(Graphics g1, int startRes, int endRes,
- int startSeq, int endSeq, int offset)
+ private void drawPanel(Graphics g1, final int startRes, final int endRes,
+ final int startSeq, final int endSeq, final int offset)
{
if (!av.hasHiddenColumns())
}
else
{
-
int screenY = 0;
+ final int screenYMax = endRes - startRes;
int blockStart = startRes;
int blockEnd = endRes;
continue;
}
- blockEnd = hideStart - 1;
+ /*
+ * draw up to just before the next hidden region, or the end of
+ * the visible region, whichever comes first
+ */
+ blockEnd = Math.min(hideStart - 1, blockStart + screenYMax
+ - screenY);
g1.translate(screenY * avcharWidth, 0);
draw(g1, blockStart, blockEnd, startSeq, endSeq, offset);
- if (av.getShowHiddenMarkers())
+ /*
+ * draw the downline of the hidden column marker (ScalePanel draws the
+ * triangle on top) if we reached it
+ */
+ if (av.getShowHiddenMarkers() && blockEnd == hideStart - 1)
{
g1.setColor(Color.blue);
g1.drawLine((blockEnd - blockStart + 1) * avcharWidth - 1,
screenY += blockEnd - blockStart + 1;
blockStart = hideEnd + 1;
- if (screenY > (endRes - startRes))
+ if (screenY > screenYMax)
{
// already rendered last block
return;
}
}
}
- if (screenY <= (endRes - startRes))
+ if (screenY <= screenYMax)
{
// remaining visible region to render
blockEnd = blockStart + (endRes - startRes) - screenY;
{
String eventName = evt.getPropertyName();
+ if (eventName.equals(SequenceGroup.SEQ_GROUP_CHANGED))
+ {
+ fastPaint = true;
+ repaint();
+ return;
+ }
+ else if (eventName.equals(ViewportRanges.MOVE_VIEWPORT))
+ {
+ fastPaint = false;
+ repaint();
+ return;
+ }
+
if (!av.getWrapAlignment())
{
int scrollX = 0;
- if (eventName.equals(ViewportRanges.STARTRES))
+ if (eventName.equals(ViewportRanges.STARTRES)
+ || eventName.equals(ViewportRanges.STARTRESANDSEQ))
{
// Make sure we're not trying to draw a panel
// larger than the visible window
+ if (eventName.equals(ViewportRanges.STARTRES))
+ {
+ scrollX = (int) evt.getNewValue() - (int) evt.getOldValue();
+ }
+ else
+ {
+ scrollX = ((int[]) evt.getNewValue())[0]
+ - ((int[]) evt.getOldValue())[0];
+ }
ViewportRanges vpRanges = av.getRanges();
- scrollX = (int) evt.getNewValue() - (int) evt.getOldValue();
int range = vpRanges.getEndRes() - vpRanges.getStartRes();
if (scrollX > range)
{
// scroll
fastPaint(0, (int) evt.getNewValue() - (int) evt.getOldValue());
}
+ else if (eventName.equals(ViewportRanges.STARTRESANDSEQ))
+ {
+ fastPaint(scrollX, 0);
+ }
}
}
import jalview.util.MappingUtils;
import jalview.util.MessageManager;
import jalview.viewmodel.AlignmentViewport;
-import jalview.viewmodel.ViewportRanges;
import java.awt.BorderLayout;
import java.awt.Font;
import java.awt.event.MouseEvent;
import java.awt.event.MouseListener;
import java.awt.event.MouseMotionListener;
-import java.util.ArrayList;
import java.util.Collections;
import java.util.List;
-import java.util.ListIterator;
import java.util.Vector;
public class SeqPanel extends Panel implements MouseMotionListener,
void setCursorRow()
{
seqCanvas.cursorY = getKeyboardNo1() - 1;
- scrollToVisible();
+ scrollToVisible(true);
}
void setCursorColumn()
{
seqCanvas.cursorX = getKeyboardNo1() - 1;
- scrollToVisible();
+ scrollToVisible(true);
}
void setCursorRowAndColumn()
{
seqCanvas.cursorX = getKeyboardNo1() - 1;
seqCanvas.cursorY = getKeyboardNo2() - 1;
- scrollToVisible();
+ scrollToVisible(true);
}
}
SequenceI sequence = av.getAlignment().getSequenceAt(seqCanvas.cursorY);
seqCanvas.cursorX = sequence.findIndex(getKeyboardNo1()) - 1;
- scrollToVisible();
+ scrollToVisible(true);
}
void moveCursor(int dx, int dy)
seqCanvas.cursorX = original;
}
}
- scrollToVisible();
+ scrollToVisible(false);
}
- void scrollToVisible()
+ /**
+ * Scroll to make the cursor visible in the viewport.
+ *
+ * @param jump
+ * just jump to the location rather than scrolling
+ */
+ void scrollToVisible(boolean jump)
{
if (seqCanvas.cursorX < 0)
{
}
endEditing();
- if (av.getWrapAlignment())
+
+ boolean repaintNeeded = true;
+ if (jump)
{
- av.getRanges().scrollToWrappedVisible(seqCanvas.cursorX);
+ // only need to repaint if the viewport did not move, as otherwise it will
+ // get a repaint
+ repaintNeeded = !av.getRanges().setViewportLocation(seqCanvas.cursorX,
+ seqCanvas.cursorY);
}
else
{
- ViewportRanges ranges = av.getRanges();
- HiddenColumns hidden = av.getAlignment().getHiddenColumns();
- while (seqCanvas.cursorY < ranges.getStartSeq())
- {
- ranges.scrollUp(true);
- }
- while (seqCanvas.cursorY > ranges.getEndSeq())
+ if (av.getWrapAlignment())
{
- ranges.scrollUp(false);
+ av.getRanges().scrollToWrappedVisible(seqCanvas.cursorX);
}
- while (seqCanvas.cursorX < hidden
- .adjustForHiddenColumns(ranges.getStartRes()))
+ else
{
-
- if (!ranges.scrollRight(false))
- {
- break;
- }
- }
- while (seqCanvas.cursorX > hidden
- .adjustForHiddenColumns(ranges.getEndRes()))
- {
- if (!ranges.scrollRight(true))
- {
- break;
- }
+ av.getRanges().scrollToVisible(seqCanvas.cursorX,
+ seqCanvas.cursorY);
}
}
setStatusMessage(av.getAlignment().getSequenceAt(seqCanvas.cursorY),
seqCanvas.cursorX, seqCanvas.cursorY);
- seqCanvas.repaint();
+ if (repaintNeeded)
+ {
+ seqCanvas.repaint();
+ }
}
void setSelectionAreaAtCursor(boolean topLeft)
sg.addSequence(sequence, false);
av.setSelectionGroup(sg);
}
- ap.paintAlignment(false);
+ ap.paintAlignment(false, false);
av.sendSelection();
}
* alignment column
* @param seq
* index of sequence in alignment
- * @return position of column in sequence or -1 if at gap
*/
void setStatusMessage(SequenceI sequence, int column, int seq)
{
}
int seq = findSeq(evt);
- int res = findRes(evt);
+ int res = findColumn(evt);
if (seq < 0 || res < 0)
{
av.setSelectionGroup(null);
}
- int column = findRes(evt);
- boolean isGapped = Comparison.isGap(sequence.getCharAt(column));
- List<SequenceFeature> features = findFeaturesAtRes(sequence,
- sequence.findPosition(column));
- if (isGapped)
- {
- removeAdjacentFeatures(features, column + 1, sequence);
- }
+ int column = findColumn(evt);
+ List<SequenceFeature> features = findFeaturesAtColumn(sequence,
+ column + 1);
if (!features.isEmpty())
{
seqCanvas.highlightSearchResults(highlight);
seqCanvas.getFeatureRenderer().amendFeatures(
Collections.singletonList(sequence), features, false, ap);
-
- seqCanvas.highlightSearchResults(null);
+ av.setSearchResults(null); // clear highlighting
+ seqCanvas.repaint(); // draw new/amended features
}
}
}
int wrappedBlock = -1;
- int findRes(MouseEvent evt)
+ /**
+ * Returns the aligned sequence position (base 0) at the mouse position, or
+ * the closest visible one
+ *
+ * @param evt
+ * @return
+ */
+ int findColumn(MouseEvent evt)
{
int res = 0;
int x = evt.getX();
{
int seq = findSeq(evt);
- int res = findRes(evt);
+ int res = findColumn(evt);
if (seq < av.getAlignment().getHeight()
&& res < av.getAlignment().getSequenceAt(seq).getLength())
@Override
public void mouseMoved(MouseEvent evt)
{
- final int column = findRes(evt);
+ final int column = findColumn(evt);
int seq = findSeq(evt);
if (seq >= av.getAlignment().getHeight() || seq < 0 || column < 0)
*/
if (av.isShowSequenceFeatures())
{
- List<SequenceFeature> allFeatures = findFeaturesAtRes(sequence,
- sequence.findPosition(column));
- if (isGapped)
- {
- removeAdjacentFeatures(allFeatures, column + 1, sequence);
- }
+ List<SequenceFeature> allFeatures = findFeaturesAtColumn(sequence,
+ column + 1);
for (SequenceFeature sf : allFeatures)
{
tooltipText.append(sf.getType() + " " + sf.begin + ":" + sf.end);
}
/**
- * Removes from the list of features any that start after, or end before, the
- * given column position. This allows us to retain only those features
- * adjacent to a gapped position that straddle the position. Contact features
- * that 'straddle' the position are also removed, since they are not 'at' the
- * position.
+ * Returns features at the specified aligned column on the given sequence.
+ * Non-positional features are not included. If the column has a gap, then
+ * enclosing features are included (but not contact features).
*
- * @param features
- * @param column
- * alignment column (1..)
* @param sequence
+ * @param column
+ * (1..)
+ * @return
*/
- protected void removeAdjacentFeatures(List<SequenceFeature> features,
- int column, SequenceI sequence)
+ List<SequenceFeature> findFeaturesAtColumn(SequenceI sequence, int column)
{
- // TODO should this be an AlignViewController method (shared by gui)?
- ListIterator<SequenceFeature> it = features.listIterator();
- while (it.hasNext())
- {
- SequenceFeature sf = it.next();
- if (sf.isContactFeature()
- || sequence.findIndex(sf.getBegin()) > column
- || sequence.findIndex(sf.getEnd()) < column)
- {
- it.remove();
- }
- }
- }
-
- List<SequenceFeature> findFeaturesAtRes(SequenceI sequence, int res)
- {
- List<SequenceFeature> result = new ArrayList<>();
- SequenceFeature[] features = sequence.getSequenceFeatures();
- if (features != null)
- {
- for (int i = 0; i < features.length; i++)
- {
- if (av.getFeaturesDisplayed() == null || !av.getFeaturesDisplayed()
- .isVisible(features[i].getType()))
- {
- continue;
- }
-
- if (features[i].featureGroup != null && !seqCanvas.fr
- .checkGroupVisibility(features[i].featureGroup, false))
- {
- continue;
- }
-
- if ((features[i].getBegin() <= res)
- && (features[i].getEnd() >= res))
- {
- result.add(features[i]);
- }
- }
- }
-
- return result;
+ return seqCanvas.getFeatureRenderer().findFeaturesAtColumn(sequence, column);
}
Tooltip tooltip;
lastMousePress = evt.getPoint();
- ap.paintAlignment(false);
+ ap.paintAlignment(false, false);
ap.annotationPanel.image = null;
return;
}
return;
}
- int res = findRes(evt);
+ int res = findColumn(evt);
if (res < 0)
{
// Find the next gap before the end
// of the visible region boundary
boolean blank = false;
- for (fixedRight = fixedRight; fixedRight > lastres; fixedRight--)
+ for (; fixedRight > lastres; fixedRight--)
{
blank = true;
scrollThread = null;
}
- int res = findRes(evt);
+ int column = findColumn(evt);
int seq = findSeq(evt);
oldSeq = seq;
startWrapBlock = wrappedBlock;
SequenceI sequence = av.getAlignment().getSequenceAt(seq);
- if (sequence == null || res > sequence.getLength())
+ if (sequence == null || column > sequence.getLength())
{
return;
}
stretchGroup = av.getSelectionGroup();
- if (stretchGroup == null || !stretchGroup.contains(sequence, res))
+ if (stretchGroup == null || !stretchGroup.contains(sequence, column))
{
- stretchGroup = av.getAlignment().findGroup(sequence, res);
+ stretchGroup = av.getAlignment().findGroup(sequence, column);
if (stretchGroup != null)
{
// only update the current selection if the popup menu has a group to
if ((evt.getModifiers()
& InputEvent.BUTTON3_MASK) == InputEvent.BUTTON3_MASK)
{
- List<SequenceFeature> allFeatures = findFeaturesAtRes(sequence,
- sequence.findPosition(res));
+ List<SequenceFeature> allFeatures = findFeaturesAtColumn(sequence,
+ sequence.findPosition(column + 1));
Vector<String> links = null;
for (SequenceFeature sf : allFeatures)
{
links = new Vector<>();
}
- for (int j = 0; j < sf.links.size(); j++)
- {
- links.addElement(sf.links.elementAt(j));
- }
+ links.addAll(sf.links);
}
}
APopupMenu popup = new APopupMenu(ap, null, links);
if (av.cursorMode)
{
- seqCanvas.cursorX = findRes(evt);
+ seqCanvas.cursorX = findColumn(evt);
seqCanvas.cursorY = findSeq(evt);
seqCanvas.repaint();
return;
{
// define a new group here
SequenceGroup sg = new SequenceGroup();
- sg.setStartRes(res);
- sg.setEndRes(res);
+ sg.setStartRes(column);
+ sg.setEndRes(column);
sg.addSequence(sequence, false);
av.setSelectionGroup(sg);
stretchGroup = sg;
}
}
PaintRefresher.Refresh(ap, av.getSequenceSetId());
- ap.paintAlignment(needOverviewUpdate);
+ ap.paintAlignment(needOverviewUpdate, needOverviewUpdate);
needOverviewUpdate = false;
changeEndRes = false;
changeStartRes = false;
public void doMouseDraggedDefineMode(MouseEvent evt)
{
- int res = findRes(evt);
+ int res = findColumn(evt);
int y = findSeq(evt);
if (wrappedBlock != startWrapBlock)
@Override
public void mouseReleased(MouseEvent evt)
{
- ap.paintAlignment(true);
+ ap.paintAlignment(true, true);
}
@Override
createSplitFrameWindow(embedded, applet);
validate();
topFrame.alignPanel.adjustAnnotationHeight();
- topFrame.alignPanel.paintAlignment(true);
+ topFrame.alignPanel.paintAlignment(true, true);
bottomFrame.alignPanel.adjustAnnotationHeight();
- bottomFrame.alignPanel.paintAlignment(true);
+ bottomFrame.alignPanel.paintAlignment(true, true);
}
/**
Button selectedButton;
- Vector<Color> oldColours = new Vector<Color>();
+ Vector<Color> oldColours = new Vector<>();
ColourSchemeI oldColourScheme;
ap.av.isIgnoreGapsConsensus());
}
ap.seqPanel.seqCanvas.img = null;
- ap.paintAlignment(true);
+ ap.paintAlignment(true, true);
}
else if (jmol != null)
{
{
ap.av.setGlobalColourScheme(oldColourScheme);
}
- ap.paintAlignment(true);
+ ap.paintAlignment(true, true);
}
frame.setVisible(false);
{
}
- public EditCommand(String description)
+ public EditCommand(String desc)
{
- this.description = description;
+ this.description = desc;
}
- public EditCommand(String description, Action command, SequenceI[] seqs,
+ public EditCommand(String desc, Action command, SequenceI[] seqs,
int position, int number, AlignmentI al)
{
- this.description = description;
+ this.description = desc;
if (command == Action.CUT || command == Action.PASTE)
{
setEdit(new Edit(command, seqs, position, number, al));
performEdit(0, null);
}
- public EditCommand(String description, Action command, String replace,
+ public EditCommand(String desc, Action command, String replace,
SequenceI[] seqs, int position, int number, AlignmentI al)
{
- this.description = description;
+ this.description = desc;
if (command == Action.REPLACE)
{
setEdit(new Edit(command, seqs, position, number, al, replace));
{
// modify the oldds if necessary
if (oldds != sequence.getDatasetSequence()
- || sequence.getSequenceFeatures() != null)
+ || sequence.getFeatures().hasFeatures())
{
if (command.oldds == null)
{
command.oldds = new SequenceI[command.seqs.length];
}
command.oldds[i] = oldds;
- adjustFeatures(command, i,
+ // FIXME JAL-2541 JAL-2526 get correct positions if on a gap
+ adjustFeatures(
+ command,
+ i,
sequence.findPosition(command.position),
- sequence.findPosition(
- command.position + command.number),
+ sequence.findPosition(command.position + command.number),
false);
}
}
AlignmentAnnotation[] tmp;
for (int s = 0; s < command.seqs.length; s++)
{
+ command.seqs[s].sequenceChanged();
+
if (modifyVisibility)
{
// Rows are only removed or added to sequence object.
}
}
- final static void adjustFeatures(Edit command, int index, int i, int j,
- boolean insert)
+ final static void adjustFeatures(Edit command, int index, final int i,
+ final int j, boolean insert)
{
SequenceI seq = command.seqs[index];
SequenceI sequence = seq.getDatasetSequence();
return;
}
- SequenceFeature[] sf = sequence.getSequenceFeatures();
+ List<SequenceFeature> sf = sequence.getFeatures()
+ .getPositionalFeatures();
- if (sf == null)
+ if (sf.isEmpty())
{
return;
}
- SequenceFeature[] oldsf = new SequenceFeature[sf.length];
+ List<SequenceFeature> oldsf = new ArrayList<SequenceFeature>();
int cSize = j - i;
- for (int s = 0; s < sf.length; s++)
+ for (SequenceFeature feature : sf)
{
- SequenceFeature copy = new SequenceFeature(sf[s]);
+ SequenceFeature copy = new SequenceFeature(feature);
- oldsf[s] = copy;
+ oldsf.add(copy);
- if (sf[s].getEnd() < i)
+ if (feature.getEnd() < i)
{
continue;
}
- if (sf[s].getBegin() > j)
+ if (feature.getBegin() > j)
{
- sf[s].setBegin(copy.getBegin() - cSize);
- sf[s].setEnd(copy.getEnd() - cSize);
+ int newBegin = copy.getBegin() - cSize;
+ int newEnd = copy.getEnd() - cSize;
+ SequenceFeature newSf = new SequenceFeature(feature, newBegin,
+ newEnd, feature.getFeatureGroup(), feature.getScore());
+ sequence.deleteFeature(feature);
+ sequence.addSequenceFeature(newSf);
+ // feature.setBegin(newBegin);
+ // feature.setEnd(newEnd);
continue;
}
- if (sf[s].getBegin() >= i)
+ int newBegin = feature.getBegin();
+ int newEnd = feature.getEnd();
+ if (newBegin >= i)
{
- sf[s].setBegin(i);
+ newBegin = i;
+ // feature.setBegin(i);
}
- if (sf[s].getEnd() < j)
+ if (newEnd < j)
{
- sf[s].setEnd(j - 1);
+ newEnd = j - 1;
+ // feature.setEnd(j - 1);
}
+ newEnd = newEnd - cSize;
+ // feature.setEnd(feature.getEnd() - (cSize));
- sf[s].setEnd(sf[s].getEnd() - (cSize));
-
- if (sf[s].getBegin() > sf[s].getEnd())
+ sequence.deleteFeature(feature);
+ if (newEnd >= newBegin)
{
- sequence.deleteFeature(sf[s]);
+ sequence.addSequenceFeature(new SequenceFeature(feature, newBegin,
+ newEnd, feature.getFeatureGroup(), feature.getScore()));
}
+ // if (feature.getBegin() > feature.getEnd())
+ // {
+ // sequence.deleteFeature(feature);
+ // }
}
if (command.editedFeatures == null)
{
- command.editedFeatures = new Hashtable<SequenceI, SequenceFeature[]>();
+ command.editedFeatures = new Hashtable<SequenceI, List<SequenceFeature>>();
}
command.editedFeatures.put(seq, oldsf);
Hashtable<String, Annotation[]> deletedAnnotations;
- Hashtable<SequenceI, SequenceFeature[]> editedFeatures;
+ Hashtable<SequenceI, List<SequenceFeature>> editedFeatures;
AlignmentI al;
char gapChar;
- public Edit(Action command, SequenceI[] seqs, int position, int number,
- char gapChar)
+ public Edit(Action cmd, SequenceI[] sqs, int pos, int count,
+ char gap)
{
- this.command = command;
- this.seqs = seqs;
- this.position = position;
- this.number = number;
- this.gapChar = gapChar;
+ this.command = cmd;
+ this.seqs = sqs;
+ this.position = pos;
+ this.number = count;
+ this.gapChar = gap;
}
- Edit(Action command, SequenceI[] seqs, int position, int number,
- AlignmentI al)
+ Edit(Action cmd, SequenceI[] sqs, int pos, int count,
+ AlignmentI align)
{
- this.gapChar = al.getGapCharacter();
- this.command = command;
- this.seqs = seqs;
- this.position = position;
- this.number = number;
- this.al = al;
-
- alIndex = new int[seqs.length];
- for (int i = 0; i < seqs.length; i++)
+ this.gapChar = align.getGapCharacter();
+ this.command = cmd;
+ this.seqs = sqs;
+ this.position = pos;
+ this.number = count;
+ this.al = align;
+
+ alIndex = new int[sqs.length];
+ for (int i = 0; i < sqs.length; i++)
{
- alIndex[i] = al.findIndex(seqs[i]);
+ alIndex[i] = align.findIndex(sqs[i]);
}
- fullAlignmentHeight = (al.getHeight() == seqs.length);
+ fullAlignmentHeight = (align.getHeight() == sqs.length);
}
- Edit(Action command, SequenceI[] seqs, int position, int number,
- AlignmentI al, String replace)
+ Edit(Action cmd, SequenceI[] sqs, int pos, int count,
+ AlignmentI align, String replace)
{
- this.command = command;
- this.seqs = seqs;
- this.position = position;
- this.number = number;
- this.al = al;
- this.gapChar = al.getGapCharacter();
- string = new char[seqs.length][];
- for (int i = 0; i < seqs.length; i++)
+ this.command = cmd;
+ this.seqs = sqs;
+ this.position = pos;
+ this.number = count;
+ this.al = align;
+ this.gapChar = align.getGapCharacter();
+ string = new char[sqs.length][];
+ for (int i = 0; i < sqs.length; i++)
{
string[i] = replace.toCharArray();
}
- fullAlignmentHeight = (al.getHeight() == seqs.length);
+ fullAlignmentHeight = (align.getHeight() == sqs.length);
}
public SequenceI[] getSequences()
*/
private AlignViewControllerGuiI avcg;
- @Override
- protected void finalize() throws Throwable
- {
- viewport = null;
- alignPanel = null;
- avcg = null;
- };
-
public AlignViewController(AlignViewControllerGuiI alignFrame,
AlignViewportI viewport, AlignmentViewPanel alignPanel)
{
if (changed)
{
viewport.setColumnSelection(cs);
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(false, false);
int columnCount = invert
? (sqcol.getEndRes() - sqcol.getStartRes() + 1)
- bs.cardinality()
if (!extendCurrent)
{
cs.clear();
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(false, false);
}
}
return false;
static int findColumnsWithFeature(String featureType,
SequenceCollectionI sqcol, BitSet bs)
{
- final int startPosition = sqcol.getStartRes() + 1; // converted to base 1
- final int endPosition = sqcol.getEndRes() + 1;
+ final int startColumn = sqcol.getStartRes() + 1; // converted to base 1
+ final int endColumn = sqcol.getEndRes() + 1;
List<SequenceI> seqs = sqcol.getSequences();
int nseq = 0;
for (SequenceI sq : seqs)
{
- boolean sequenceHasFeature = false;
if (sq != null)
{
- SequenceFeature[] sfs = sq.getSequenceFeatures();
- if (sfs != null)
+ // int ist = sq.findPosition(sqcol.getStartRes());
+ List<SequenceFeature> sfs = sq.findFeatures(startColumn,
+ endColumn, featureType);
+
+ if (!sfs.isEmpty())
{
- int ist = sq.findIndex(sq.getStart());
- int iend = sq.findIndex(sq.getEnd());
- if (iend < startPosition || ist > endPosition)
- {
- // sequence not in region
- continue;
- }
- for (SequenceFeature sf : sfs)
+ nseq++;
+ }
+
+ for (SequenceFeature sf : sfs)
+ {
+ int sfStartCol = sq.findIndex(sf.getBegin());
+ int sfEndCol = sq.findIndex(sf.getEnd());
+
+ if (sf.isContactFeature())
{
- // future functionality - featureType == null means mark columns
- // containing all displayed features
- if (sf != null && (featureType.equals(sf.getType())))
+ /*
+ * 'contact' feature - check for 'start' or 'end'
+ * position within the selected region
+ */
+ if (sfStartCol >= startColumn && sfStartCol <= endColumn)
{
- // optimisation - could consider 'spos,apos' like cursor argument
- // - findIndex wastes time by starting from first character and
- // counting
-
- int sfStartCol = sq.findIndex(sf.getBegin());
- int sfEndCol = sq.findIndex(sf.getEnd());
-
- if (sf.isContactFeature())
- {
- /*
- * 'contact' feature - check for 'start' or 'end'
- * position within the selected region
- */
- if (sfStartCol >= startPosition
- && sfStartCol <= endPosition)
- {
- bs.set(sfStartCol - 1);
- sequenceHasFeature = true;
- }
- if (sfEndCol >= startPosition && sfEndCol <= endPosition)
- {
- bs.set(sfEndCol - 1);
- sequenceHasFeature = true;
- }
- continue;
- }
-
- /*
- * contiguous feature - select feature positions (if any)
- * within the selected region
- */
- if (sfStartCol > endPosition || sfEndCol < startPosition)
- {
- // feature is outside selected region
- continue;
- }
- sequenceHasFeature = true;
- if (sfStartCol < startPosition)
- {
- sfStartCol = startPosition;
- }
- if (sfStartCol < ist)
- {
- sfStartCol = ist;
- }
- if (sfEndCol > endPosition)
- {
- sfEndCol = endPosition;
- }
- for (; sfStartCol <= sfEndCol; sfStartCol++)
- {
- bs.set(sfStartCol - 1); // convert to base 0
- }
+ bs.set(sfStartCol - 1);
}
+ if (sfEndCol >= startColumn && sfEndCol <= endColumn)
+ {
+ bs.set(sfEndCol - 1);
+ }
+ continue;
}
- }
- if (sequenceHasFeature)
- {
- nseq++;
+ /*
+ * contiguous feature - select feature positions (if any)
+ * within the selected region
+ */
+ if (sfStartCol < startColumn)
+ {
+ sfStartCol = startColumn;
+ }
+ // not sure what the point of this is
+ // if (sfStartCol < ist)
+ // {
+ // sfStartCol = ist;
+ // }
+ if (sfEndCol > endColumn)
+ {
+ sfEndCol = endColumn;
+ }
+ for (; sfStartCol <= sfEndCol; sfStartCol++)
+ {
+ bs.set(sfStartCol - 1); // convert to base 0
+ }
}
}
}
AlignmentSorter.sortByFeature(typ, gps, start, stop, al, method);
avcg.addHistoryItem(new OrderCommand(methodText, oldOrder,
viewport.getAlignment()));
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(true, false);
}
{
avcg.getFeatureSettingsUI().discoverAllFeatureData();
}
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(true, true);
}
return featuresFile;
if (changed)
{
viewport.setColumnSelection(cs);
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(false, false);
int columnCount = invert
? (sqcol.getEndRes() - sqcol.getStartRes() + 1)
- bs.cardinality()
if (!extendCurrent)
{
cs.clear();
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(false, false);
}
}
return false;
* Read off the mapped nucleotides (converting to position base 0)
*/
codonPos = MappingUtils.flattenRanges(codonPos);
- char[] dna = dnaSeq.getSequence();
int start = dnaSeq.getStart();
- result.add(
- new char[]
- { dna[codonPos[0] - start], dna[codonPos[1] - start],
- dna[codonPos[2] - start] });
+ char c1 = dnaSeq.getCharAt(codonPos[0] - start);
+ char c2 = dnaSeq.getCharAt(codonPos[1] - start);
+ char c3 = dnaSeq.getCharAt(codonPos[2] - start);
+ result.add(new char[] { c1, c2, c3 });
}
}
return result.isEmpty() ? null : result;
import jalview.util.MessageManager;
import java.util.ArrayList;
+import java.util.Arrays;
import java.util.Collections;
import java.util.Enumeration;
import java.util.HashSet;
{
// TODO JAL-1270 needs test coverage
// currently tested for use in jalview.gui.SequenceFetcher
- boolean samegap = toappend.getGapCharacter() == getGapCharacter();
char oldc = toappend.getGapCharacter();
+ boolean samegap = oldc == getGapCharacter();
boolean hashidden = toappend.getHiddenSequences() != null
&& toappend.getHiddenSequences().hiddenSequences != null;
// get all sequences including any hidden ones
{
if (!samegap)
{
- char[] oldseq = addedsq.getSequence();
- for (int c = 0; c < oldseq.length; c++)
- {
- if (oldseq[c] == oldc)
- {
- oldseq[c] = gapCharacter;
- }
- }
+ addedsq.replace(oldc, gapCharacter);
}
toappendsq.add(addedsq);
}
@Override
public Iterable<AlignmentAnnotation> findAnnotation(String calcId)
{
- List<AlignmentAnnotation> aa = new ArrayList<>();
AlignmentAnnotation[] alignmentAnnotation = getAlignmentAnnotation();
if (alignmentAnnotation != null)
{
- for (AlignmentAnnotation a : alignmentAnnotation)
- {
- if (a.getCalcId() == calcId || (a.getCalcId() != null
- && calcId != null && a.getCalcId().equals(calcId)))
- {
- aa.add(a);
- }
- }
+ return AlignmentAnnotation.findAnnotation(
+ Arrays.asList(getAlignmentAnnotation()), calcId);
}
- return aa;
+ return Arrays.asList(new AlignmentAnnotation[] {});
}
@Override
public Iterable<AlignmentAnnotation> findAnnotations(SequenceI seq,
String calcId, String label)
{
- ArrayList<AlignmentAnnotation> aa = new ArrayList<>();
- for (AlignmentAnnotation ann : getAlignmentAnnotation())
- {
- if ((calcId == null || (ann.getCalcId() != null
- && ann.getCalcId().equals(calcId)))
- && (seq == null || (ann.sequenceRef != null
- && ann.sequenceRef == seq))
- && (label == null
- || (ann.label != null && ann.label.equals(label))))
- {
- aa.add(ann);
- }
- }
- return aa;
+ return AlignmentAnnotation.findAnnotations(
+ Arrays.asList(getAlignmentAnnotation()), seq, calcId, label);
}
@Override
import jalview.analysis.SecStrConsensus.SimpleBP;
import jalview.analysis.WUSSParseException;
+import java.util.ArrayList;
import java.util.Collection;
import java.util.Collections;
import java.util.HashMap;
* Updates the _rnasecstr field Determines the positions that base pair and
* the positions of helices based on secondary structure from a Stockholm file
*
- * @param RNAannot
+ * @param rnaAnnotation
*/
- private void _updateRnaSecStr(CharSequence RNAannot)
+ private void _updateRnaSecStr(CharSequence rnaAnnotation)
{
try
{
- bps = Rna.getModeleBP(RNAannot);
- _rnasecstr = Rna.getBasePairs(bps);
+ _rnasecstr = Rna.getHelixMap(rnaAnnotation);
invalidrnastruc = -1;
} catch (WUSSParseException px)
{
{
return;
}
- Rna.HelixMap(_rnasecstr);
- // setRNAStruc(RNAannot);
if (_rnasecstr != null && _rnasecstr.length > 0)
{
private boolean isrna;
- /*
- * (non-Javadoc)
- *
- * @see java.lang.Object#finalize()
- */
- @Override
- protected void finalize() throws Throwable
- {
- sequenceRef = null;
- groupRef = null;
- super.finalize();
- }
-
public static int getGraphValueFromString(String string)
{
if (string.equalsIgnoreCase("BAR_GRAPH"))
}
}
- // JBPNote: what does this do ?
- public void ConcenStru(CharSequence RNAannot) throws WUSSParseException
- {
- bps = Rna.getModeleBP(RNAannot);
- }
-
/**
* Creates a new AlignmentAnnotation object.
*
{
return graphMin < graphMax;
}
+
+ public static Iterable<AlignmentAnnotation> findAnnotations(
+ Iterable<AlignmentAnnotation> list, SequenceI seq, String calcId,
+ String label)
+ {
+
+ ArrayList<AlignmentAnnotation> aa = new ArrayList<>();
+ for (AlignmentAnnotation ann : list)
+ {
+ if ((calcId == null || (ann.getCalcId() != null
+ && ann.getCalcId().equals(calcId)))
+ && (seq == null || (ann.sequenceRef != null
+ && ann.sequenceRef == seq))
+ && (label == null
+ || (ann.label != null && ann.label.equals(label))))
+ {
+ aa.add(ann);
+ }
+ }
+ return aa;
+ }
+
+ /**
+ * Answer true if any annotation matches the calcId passed in (if not null).
+ *
+ * @param list
+ * annotation to search
+ * @param calcId
+ * @return
+ */
+ public static boolean hasAnnotation(List<AlignmentAnnotation> list,
+ String calcId)
+ {
+
+ if (calcId != null && !"".equals(calcId))
+ {
+ for (AlignmentAnnotation a : list)
+ {
+ if (a.getCalcId() == calcId)
+ {
+ return true;
+ }
+ }
+ }
+ return false;
+ }
+
+ public static Iterable<AlignmentAnnotation> findAnnotation(
+ List<AlignmentAnnotation> list, String calcId)
+ {
+
+ List<AlignmentAnnotation> aa = new ArrayList<>();
+ if (calcId == null)
+ {
+ return aa;
+ }
+ for (AlignmentAnnotation a : list)
+ {
+
+ if (a.getCalcId() == calcId || (a.getCalcId() != null
+ && calcId != null && a.getCalcId().equals(calcId)))
+ {
+ aa.add(a);
+ }
+ }
+ return aa;
+ }
}
int nores = (isNa) ? ResidueProperties.maxNucleotideIndex
: ResidueProperties.maxProteinIndex;
- dbinary = new double[getSequence().length * nores];
+ dbinary = new double[getLength() * nores];
return nores;
}
{
int nores = initMatrixGetNoRes();
final int[] sindex = getSymbolmatrix();
- for (int i = 0; i < getSequence().length; i++)
+ for (int i = 0; i < getLength(); i++)
{
int aanum = nores - 1;
{
int nores = initMatrixGetNoRes();
- for (int i = 0, iSize = getSequence().length; i < iSize; i++)
+ for (int i = 0, iSize = getLength(); i < iSize; i++)
{
int aanum = nores - 1;
hideStart = region[0];
hideEnd = region[1];
// edit hidden regions to selection range
- if (hideStart < last)
+
+ // just move on if hideEnd is before last
+ if (hideEnd < last)
{
- if (hideEnd > last)
- {
- hideStart = last;
- }
- else
- {
- continue;
- }
+ continue;
}
-
+ // exit if next region is after end
if (hideStart > end)
{
break;
}
- if (hideEnd > end)
+ // truncate region at start if last falls in region
+ if ((hideStart < last) && (hideEnd >= last))
{
- hideEnd = end;
+ hideStart = last;
}
- if (hideStart > hideEnd)
+ // truncate region at end if end falls in region
+ if (hideEnd > end) // already checked that hideStart<=end
{
- break;
+ hideEnd = end;
}
+
/**
* form operations...
*/
last = hideEnd + 1;
}
// Final match if necessary.
- if (last < end)
+ if (last <= end)
{
addOperation(CigarArray.M, end - last + 1);
}
* along with Jalview. If not, see <http://www.gnu.org/licenses/>.
* The Jalview Authors are detailed in the 'AUTHORS' file.
*/
-package jalview.io;
+package jalview.datamodel;
-/**
- * Read or write a CLANS style score matrix file.
- */
-
-public class ClansFile extends FileParse
+public interface ContiguousI
{
+ int getBegin(); // todo want long for genomic positions?
+ int getEnd();
}
/*
* The characters of the aligned sequence e.g. "-cGT-ACgTG-"
*/
- private final char[] alignedSeq;
+ private final SequenceI alignedSeq;
/*
* the sequence start residue
*/
public AlignedCodonIterator(SequenceI seq, char gapChar)
{
- this.alignedSeq = seq.getSequence();
+ this.alignedSeq = seq;
this.start = seq.getStart();
this.gap = gapChar;
fromRanges = map.getFromRanges().iterator();
if (toPosition <= currentToRange[1])
{
SequenceI seq = Mapping.this.to;
- char pep = seq.getSequence()[toPosition - seq.getStart()];
+ char pep = seq.getCharAt(toPosition - seq.getStart());
toPosition++;
return String.valueOf(pep);
}
* allow for offset e.g. treat pos 8 as 2 if sequence starts at 7
*/
int truePos = sequencePos - (start - 1);
- while (alignedBases < truePos && alignedColumn < alignedSeq.length)
+ int length = alignedSeq.getLength();
+ while (alignedBases < truePos && alignedColumn < length)
{
- char c = alignedSeq[alignedColumn++];
+ char c = alignedSeq.getCharAt(alignedColumn++);
if (c != gap && !Comparison.isGap(c))
{
alignedBases++;
SequenceFeature[] vf = new SequenceFeature[frange.length / 2];
for (int i = 0, v = 0; i < frange.length; i += 2, v++)
{
- vf[v] = new SequenceFeature(f);
- vf[v].setBegin(frange[i]);
- vf[v].setEnd(frange[i + 1]);
+ vf[v] = new SequenceFeature(f, frange[i], frange[i + 1],
+ f.getFeatureGroup(), f.getScore());
if (frange.length > 2)
{
vf[v].setDescription(f.getDescription() + "\nPart " + (v + 1));
return vf;
}
}
- if (false) // else
- {
- int[] word = getWord(f.getBegin());
- if (word[0] < word[1])
- {
- f.setBegin(word[0]);
- }
- else
- {
- f.setBegin(word[1]);
- }
- word = getWord(f.getEnd());
- if (word[0] > word[1])
- {
- f.setEnd(word[0]);
- }
- else
- {
- f.setEnd(word[1]);
- }
- }
+
// give up and just return the feature.
return new SequenceFeature[] { f };
}
to = tto;
}
- /*
- * (non-Javadoc)
- *
- * @see java.lang.Object#finalize()
- */
- @Override
- protected void finalize() throws Throwable
- {
- map = null;
- to = null;
- super.finalize();
- }
-
/**
* Returns an iterator which can serve up the aligned codon column positions
* and their corresponding peptide products
--- /dev/null
+/*
+ * Jalview - A Sequence Alignment Editor and Viewer ($$Version-Rel$$)
+ * Copyright (C) $$Year-Rel$$ The Jalview Authors
+ *
+ * This file is part of Jalview.
+ *
+ * Jalview is free software: you can redistribute it and/or
+ * modify it under the terms of the GNU General Public License
+ * as published by the Free Software Foundation, either version 3
+ * of the License, or (at your option) any later version.
+ *
+ * Jalview is distributed in the hope that it will be useful, but
+ * WITHOUT ANY WARRANTY; without even the implied warranty
+ * of MERCHANTABILITY or FITNESS FOR A PARTICULAR
+ * PURPOSE. See the GNU General Public License for more details.
+ *
+ * You should have received a copy of the GNU General Public License
+ * along with Jalview. If not, see <http://www.gnu.org/licenses/>.
+ * The Jalview Authors are detailed in the 'AUTHORS' file.
+ */
+package jalview.datamodel;
+
+/**
+ * An immutable data bean that models a start-end range
+ */
+public class Range implements ContiguousI
+{
+ public final int start;
+
+ public final int end;
+
+ @Override
+ public int getBegin()
+ {
+ return start;
+ }
+
+ @Override
+ public int getEnd()
+ {
+ return end;
+ }
+
+ public Range(int i, int j)
+ {
+ start = i;
+ end = j;
+ }
+
+ @Override
+ public String toString()
+ {
+ return String.valueOf(start) + "-" + String.valueOf(end);
+ }
+
+ @Override
+ public int hashCode()
+ {
+ return start * 31 + end;
+ }
+
+ @Override
+ public boolean equals(Object obj)
+ {
+ if (obj instanceof Range)
+ {
+ Range r = (Range) obj;
+ return (start == r.start && end == r.end);
+ }
+ return false;
+ }
+}
public class SearchResults implements SearchResultsI
{
- private List<SearchResultMatchI> matches = new ArrayList<SearchResultMatchI>();
+ private List<SearchResultMatchI> matches = new ArrayList<>();
/**
* One match consists of a sequence reference, start and end positions.
*/
public class Match implements SearchResultMatchI
{
- SequenceI sequence;
+ final SequenceI sequence;
/**
* Start position of match in sequence (base 1)
*/
- int start;
+ final int start;
/**
* End position (inclusive) (base 1)
*/
- int end;
+ final int end;
/**
* create a Match on a range of sequence. Match always holds region in
return sb.toString();
}
- public void setSequence(SequenceI seq)
- {
- this.sequence = seq;
- }
-
/**
* Hashcode is the hashcode of the matched sequence plus a hash of start and
* end positions. Match objects that pass the test for equals are guaranteed
m = (Match) _m;
mfound = false;
- if (m.sequence == sequence)
- {
- mfound = true;
- // locate aligned position
- matchStart = sequence.findIndex(m.start) - 1;
- matchEnd = sequence.findIndex(m.end) - 1;
- }
- else if (m.sequence == sequence.getDatasetSequence())
+ if (m.sequence == sequence
+ || m.sequence == sequence.getDatasetSequence())
{
mfound = true;
- // locate region in local context
matchStart = sequence.findIndex(m.start) - 1;
- matchEnd = sequence.findIndex(m.end) - 1;
+ matchEnd = m.start == m.end ? matchStart : sequence
+ .findIndex(m.end) - 1;
}
+
if (mfound)
{
if (matchStart <= end && matchEnd >= start)
SearchResultsI sr = (SearchResultsI) obj;
return matches.equals(sr.getResults());
}
+
+ @Override
+ public void addSearchResults(SearchResultsI toAdd)
+ {
+ matches.addAll(toAdd.getResults());
+ }
}
SearchResultMatchI addResult(SequenceI seq, int start, int end);
/**
+ * adds all match results in the argument to this set
+ *
+ * @param toAdd
+ */
+ void addSearchResults(SearchResultsI toAdd);
+
+ /**
* Answers true if the search results include the given sequence (or its
* dataset sequence), else false
*
import jalview.analysis.AlignSeq;
import jalview.api.DBRefEntryI;
+import jalview.datamodel.features.SequenceFeatures;
+import jalview.datamodel.features.SequenceFeaturesI;
import jalview.util.Comparison;
import jalview.util.DBRefUtils;
import jalview.util.MapList;
import java.util.Collections;
import java.util.Enumeration;
import java.util.List;
+import java.util.ListIterator;
import java.util.Vector;
import fr.orsay.lri.varna.models.rna.RNA;
*/
Vector<AlignmentAnnotation> annotation;
- /**
- * The index of the sequence in a MSA
+ private SequenceFeaturesI sequenceFeatureStore;
+
+ /*
+ * A cursor holding the approximate current view position to the sequence,
+ * as determined by findIndex or findPosition or findPositions.
+ * Using a cursor as a hint allows these methods to be more performant for
+ * large sequences.
*/
- int index = -1;
+ private SequenceCursor cursor;
- /**
- * array of sequence features - may not be null for a valid sequence object
+ /*
+ * A number that should be incremented whenever the sequence is edited.
+ * If the value matches the cursor token, then we can trust the cursor,
+ * if not then it should be recomputed.
*/
- public SequenceFeature[] sequenceFeatures;
+ private int changeCount;
/**
* Creates a new Sequence object.
*/
public Sequence(String name, String sequence, int start, int end)
{
+ this();
initSeqAndName(name, sequence.toCharArray(), start, end);
}
public Sequence(String name, char[] sequence, int start, int end)
{
+ this();
initSeqAndName(name, sequence, start, end);
}
checkValidRange();
}
- com.stevesoft.pat.Regex limitrx = new com.stevesoft.pat.Regex(
- "[/][0-9]{1,}[-][0-9]{1,}$");
-
- com.stevesoft.pat.Regex endrx = new com.stevesoft.pat.Regex("[0-9]{1,}$");
-
+ /**
+ * If 'name' ends in /i-j, where i >= j > 0 are integers, extracts i and j as
+ * start and end respectively and removes the suffix from the name
+ */
void parseId()
{
if (name == null)
"POSSIBLE IMPLEMENTATION ERROR: null sequence name passed to constructor.");
name = "";
}
- // Does sequence have the /start-end signature?
- if (limitrx.search(name))
+ int slashPos = name.lastIndexOf('/');
+ if (slashPos > -1 && slashPos < name.length() - 1)
{
- name = limitrx.left();
- endrx.search(limitrx.stringMatched());
- setStart(Integer.parseInt(limitrx.stringMatched().substring(1,
- endrx.matchedFrom() - 1)));
- setEnd(Integer.parseInt(endrx.stringMatched()));
+ String suffix = name.substring(slashPos + 1);
+ String[] range = suffix.split("-");
+ if (range.length == 2)
+ {
+ try
+ {
+ int from = Integer.valueOf(range[0]);
+ int to = Integer.valueOf(range[1]);
+ if (from > 0 && to >= from)
+ {
+ name = name.substring(0, slashPos);
+ setStart(from);
+ setEnd(to);
+ checkValidRange();
+ }
+ } catch (NumberFormatException e)
+ {
+ // leave name unchanged if suffix is invalid
+ }
+ }
}
}
+ /**
+ * Ensures that 'end' is not before the end of the sequence, that is,
+ * (end-start+1) is at least as long as the count of ungapped positions. Note
+ * that end is permitted to be beyond the end of the sequence data.
+ */
void checkValidRange()
{
// Note: JAL-774 :
int endRes = 0;
for (int j = 0; j < sequence.length; j++)
{
- if (!jalview.util.Comparison.isGap(sequence[j]))
+ if (!Comparison.isGap(sequence[j]))
{
endRes++;
}
}
/**
+ * default constructor
+ */
+ private Sequence()
+ {
+ sequenceFeatureStore = new SequenceFeatures();
+ }
+
+ /**
* Creates a new Sequence object.
*
* @param name
*/
public Sequence(SequenceI seq, AlignmentAnnotation[] alAnnotation)
{
+ this();
initSeqFrom(seq, alAnnotation);
-
}
/**
protected void initSeqFrom(SequenceI seq,
AlignmentAnnotation[] alAnnotation)
{
- {
- char[] oseq = seq.getSequence();
- initSeqAndName(seq.getName(), Arrays.copyOf(oseq, oseq.length),
- seq.getStart(), seq.getEnd());
- }
+ char[] oseq = seq.getSequence(); // returns a copy of the array
+ initSeqAndName(seq.getName(), oseq, seq.getStart(), seq.getEnd());
+
description = seq.getDescription();
if (seq != datasetSequence)
{
setDatasetSequence(seq.getDatasetSequence());
}
- if (datasetSequence == null && seq.getDBRefs() != null)
+
+ /*
+ * only copy DBRefs and seqfeatures if we really are a dataset sequence
+ */
+ if (datasetSequence == null)
{
- // only copy DBRefs and seqfeatures if we really are a dataset sequence
- DBRefEntry[] dbr = seq.getDBRefs();
- for (int i = 0; i < dbr.length; i++)
- {
- addDBRef(new DBRefEntry(dbr[i]));
- }
- if (seq.getSequenceFeatures() != null)
+ if (seq.getDBRefs() != null)
{
- SequenceFeature[] sf = seq.getSequenceFeatures();
- for (int i = 0; i < sf.length; i++)
+ DBRefEntry[] dbr = seq.getDBRefs();
+ for (int i = 0; i < dbr.length; i++)
{
- addSequenceFeature(new SequenceFeature(sf[i]));
+ addDBRef(new DBRefEntry(dbr[i]));
}
}
+
+ /*
+ * make copies of any sequence features
+ */
+ for (SequenceFeature sf : seq.getSequenceFeatures())
+ {
+ addSequenceFeature(new SequenceFeature(sf));
+ }
}
+
if (seq.getAnnotation() != null)
{
AlignmentAnnotation[] sqann = seq.getAnnotation();
}
@Override
- public void setSequenceFeatures(SequenceFeature[] features)
+ public void setSequenceFeatures(List<SequenceFeature> features)
{
- if (datasetSequence == null)
- {
- sequenceFeatures = features;
- }
- else
+ if (datasetSequence != null)
{
- if (datasetSequence.getSequenceFeatures() != features
- && datasetSequence.getSequenceFeatures() != null
- && datasetSequence.getSequenceFeatures().length > 0)
- {
- new Exception(
- "Warning: JAL-2046 side effect ? Possible implementation error: overwriting dataset sequence features by setting sequence features on alignment")
- .printStackTrace();
- }
datasetSequence.setSequenceFeatures(features);
+ return;
}
+ sequenceFeatureStore = new SequenceFeatures(features);
}
@Override
public synchronized boolean addSequenceFeature(SequenceFeature sf)
{
- if (sequenceFeatures == null && datasetSequence != null)
- {
- return datasetSequence.addSequenceFeature(sf);
- }
- if (sequenceFeatures == null)
+ if (sf.getType() == null)
{
- sequenceFeatures = new SequenceFeature[0];
+ System.err.println("SequenceFeature type may not be null: "
+ + sf.toString());
+ return false;
}
- for (int i = 0; i < sequenceFeatures.length; i++)
+ if (datasetSequence != null)
{
- if (sequenceFeatures[i].equals(sf))
- {
- return false;
- }
+ return datasetSequence.addSequenceFeature(sf);
}
- SequenceFeature[] temp = new SequenceFeature[sequenceFeatures.length
- + 1];
- System.arraycopy(sequenceFeatures, 0, temp, 0, sequenceFeatures.length);
- temp[sequenceFeatures.length] = sf;
-
- sequenceFeatures = temp;
- return true;
+ return sequenceFeatureStore.add(sf);
}
@Override
public void deleteFeature(SequenceFeature sf)
{
- if (sequenceFeatures == null)
- {
- if (datasetSequence != null)
- {
- datasetSequence.deleteFeature(sf);
- }
- return;
- }
-
- int index = 0;
- for (index = 0; index < sequenceFeatures.length; index++)
- {
- if (sequenceFeatures[index].equals(sf))
- {
- break;
- }
- }
-
- if (index == sequenceFeatures.length)
- {
- return;
- }
-
- int sfLength = sequenceFeatures.length;
- if (sfLength < 2)
+ if (datasetSequence != null)
{
- sequenceFeatures = null;
+ datasetSequence.deleteFeature(sf);
}
else
{
- SequenceFeature[] temp = new SequenceFeature[sfLength - 1];
- System.arraycopy(sequenceFeatures, 0, temp, 0, index);
-
- if (index < sfLength)
- {
- System.arraycopy(sequenceFeatures, index + 1, temp, index,
- sequenceFeatures.length - index - 1);
- }
-
- sequenceFeatures = temp;
+ sequenceFeatureStore.delete(sf);
}
}
/**
- * Returns the sequence features (if any), looking first on the sequence, then
- * on its dataset sequence, and so on until a non-null value is found (or
- * none). This supports retrieval of sequence features stored on the sequence
- * (as in the applet) or on the dataset sequence (as in the Desktop version).
+ * {@inheritDoc}
*
* @return
*/
@Override
- public SequenceFeature[] getSequenceFeatures()
+ public List<SequenceFeature> getSequenceFeatures()
{
- SequenceFeature[] features = sequenceFeatures;
-
- SequenceI seq = this;
- int count = 0; // failsafe against loop in sequence.datasetsequence...
- while (features == null && seq.getDatasetSequence() != null
- && count++ < 10)
+ if (datasetSequence != null)
{
- seq = seq.getDatasetSequence();
- features = ((Sequence) seq).sequenceFeatures;
+ return datasetSequence.getSequenceFeatures();
}
- return features;
+ return sequenceFeatureStore.getAllFeatures();
+ }
+
+ @Override
+ public SequenceFeaturesI getFeatures()
+ {
+ return datasetSequence != null ? datasetSequence.getFeatures()
+ : sequenceFeatureStore;
}
@Override
}
/**
- * DOCUMENT ME!
+ * Sets the sequence name. If the name ends in /start-end, then the start-end
+ * values are parsed out and set, and the suffix is removed from the name.
*
- * @param name
- * DOCUMENT ME!
+ * @param theName
*/
@Override
- public void setName(String name)
+ public void setName(String theName)
{
- this.name = name;
+ this.name = theName;
this.parseId();
}
{
this.sequence = seq.toCharArray();
checkValidRange();
+ sequenceChanged();
}
@Override
@Override
public char[] getSequence()
{
- return sequence;
+ // return sequence;
+ return sequence == null ? null : Arrays.copyOf(sequence,
+ sequence.length);
}
/*
return this.description;
}
- /*
- * (non-Javadoc)
- *
- * @see jalview.datamodel.SequenceI#findIndex(int)
+ /**
+ * {@inheritDoc}
*/
@Override
public int findIndex(int pos)
{
- // returns the alignment position for a residue
+ /*
+ * use a valid, hopefully nearby, cursor if available
+ */
+ if (isValidCursor(cursor))
+ {
+ return findIndex(pos, cursor);
+ }
+
int j = start;
int i = 0;
- // Rely on end being at least as long as the length of the sequence.
+ int startColumn = 0;
+
+ /*
+ * traverse sequence from the start counting gaps; make a note of
+ * the column of the first residue to save in the cursor
+ */
while ((i < sequence.length) && (j <= end) && (j <= pos))
{
- if (!jalview.util.Comparison.isGap(sequence[i]))
+ if (!Comparison.isGap(sequence[i]))
{
+ if (j == start)
+ {
+ startColumn = i;
+ }
j++;
}
-
i++;
}
- if ((j == end) && (j < pos))
+ if (j == end && j < pos)
{
return end + 1;
}
- else
+
+ updateCursor(pos, i, startColumn);
+ return i;
+ }
+
+ /**
+ * Updates the cursor to the latest found residue and column position
+ *
+ * @param residuePos
+ * (start..)
+ * @param column
+ * (1..)
+ * @param startColumn
+ * column position of the first sequence residue
+ */
+ protected void updateCursor(int residuePos, int column, int startColumn)
+ {
+ /*
+ * preserve end residue column provided cursor was valid
+ */
+ int endColumn = isValidCursor(cursor) ? cursor.lastColumnPosition : 0;
+ if (residuePos == this.end)
{
- return i;
+ endColumn = column;
}
+
+ cursor = new SequenceCursor(this, residuePos, column, startColumn,
+ endColumn, this.changeCount);
}
+ /**
+ * Answers the aligned column position (1..) for the given residue position
+ * (start..) given a 'hint' of a residue/column location in the neighbourhood.
+ * The hint may be left of, at, or to the right of the required position.
+ *
+ * @param pos
+ * @param curs
+ * @return
+ */
+ protected int findIndex(int pos, SequenceCursor curs)
+ {
+ if (!isValidCursor(curs))
+ {
+ /*
+ * wrong or invalidated cursor, compute de novo
+ */
+ return findIndex(pos);
+ }
+
+ if (curs.residuePosition == pos)
+ {
+ return curs.columnPosition;
+ }
+
+ /*
+ * move left or right to find pos from hint.position
+ */
+ int col = curs.columnPosition - 1; // convert from base 1 to 0-based array
+ // index
+ int newPos = curs.residuePosition;
+ int delta = newPos > pos ? -1 : 1;
+
+ while (newPos != pos)
+ {
+ col += delta; // shift one column left or right
+ if (col < 0 || col == sequence.length)
+ {
+ break;
+ }
+ if (!Comparison.isGap(sequence[col]))
+ {
+ newPos += delta;
+ }
+ }
+
+ col++; // convert back to base 1
+ updateCursor(pos, col, curs.firstColumnPosition);
+
+ return col;
+ }
+
+ /**
+ * {@inheritDoc}
+ */
@Override
- public int findPosition(int i)
+ public int findPosition(final int column)
{
+ /*
+ * use a valid, hopefully nearby, cursor if available
+ */
+ if (isValidCursor(cursor))
+ {
+ return findPosition(column + 1, cursor);
+ }
+
+ // TODO recode this more naturally i.e. count residues only
+ // as they are found, not 'in anticipation'
+
+ /*
+ * traverse the sequence counting gaps; note the column position
+ * of the first residue, to save in the cursor
+ */
+ int firstResidueColumn = 0;
+ int lastPosFound = 0;
+ int lastPosFoundColumn = 0;
+ int seqlen = sequence.length;
+
+ if (seqlen > 0 && !Comparison.isGap(sequence[0]))
+ {
+ lastPosFound = start;
+ lastPosFoundColumn = 0;
+ }
+
int j = 0;
int pos = start;
- int seqlen = sequence.length;
- while ((j < i) && (j < seqlen))
+
+ while (j < column && j < seqlen)
{
- if (!jalview.util.Comparison.isGap(sequence[j]))
+ if (!Comparison.isGap(sequence[j]))
{
+ lastPosFound = pos;
+ lastPosFoundColumn = j;
+ if (pos == this.start)
+ {
+ firstResidueColumn = j;
+ }
pos++;
}
-
j++;
}
+ if (j < seqlen && !Comparison.isGap(sequence[j]))
+ {
+ lastPosFound = pos;
+ lastPosFoundColumn = j;
+ if (pos == this.start)
+ {
+ firstResidueColumn = j;
+ }
+ }
+
+ /*
+ * update the cursor to the last residue position found (if any)
+ * (converting column position to base 1)
+ */
+ if (lastPosFound != 0)
+ {
+ updateCursor(lastPosFound, lastPosFoundColumn + 1,
+ firstResidueColumn + 1);
+ }
return pos;
}
/**
+ * Answers true if the given cursor is not null, is for this sequence object,
+ * and has a token value that matches this object's changeCount, else false.
+ * This allows us to ignore a cursor as 'stale' if the sequence has been
+ * modified since the cursor was created.
+ *
+ * @param curs
+ * @return
+ */
+ protected boolean isValidCursor(SequenceCursor curs)
+ {
+ if (curs == null || curs.sequence != this || curs.token != changeCount)
+ {
+ return false;
+ }
+ /*
+ * sanity check against range
+ */
+ if (curs.columnPosition < 0 || curs.columnPosition > sequence.length)
+ {
+ return false;
+ }
+ if (curs.residuePosition < start || curs.residuePosition > end)
+ {
+ return false;
+ }
+ return true;
+ }
+
+ /**
+ * Answers the sequence position (start..) for the given aligned column
+ * position (1..), given a hint of a cursor in the neighbourhood. The cursor
+ * may lie left of, at, or to the right of the column position.
+ *
+ * @param col
+ * @param curs
+ * @return
+ */
+ protected int findPosition(final int col, SequenceCursor curs)
+ {
+ if (!isValidCursor(curs))
+ {
+ /*
+ * wrong or invalidated cursor, compute de novo
+ */
+ return findPosition(col - 1);// ugh back to base 0
+ }
+
+ if (curs.columnPosition == col)
+ {
+ cursor = curs; // in case this method becomes public
+ return curs.residuePosition; // easy case :-)
+ }
+
+ if (curs.lastColumnPosition > 0 && curs.lastColumnPosition < col)
+ {
+ /*
+ * sequence lies entirely to the left of col
+ * - return last residue + 1
+ */
+ return end + 1;
+ }
+
+ if (curs.firstColumnPosition > 0 && curs.firstColumnPosition > col)
+ {
+ /*
+ * sequence lies entirely to the right of col
+ * - return first residue
+ */
+ return start;
+ }
+
+ // todo could choose closest to col out of column,
+ // firstColumnPosition, lastColumnPosition as a start point
+
+ /*
+ * move left or right to find pos from cursor position
+ */
+ int firstResidueColumn = curs.firstColumnPosition;
+ int column = curs.columnPosition - 1; // to base 0
+ int newPos = curs.residuePosition;
+ int delta = curs.columnPosition > col ? -1 : 1;
+ boolean gapped = false;
+ int lastFoundPosition = curs.residuePosition;
+ int lastFoundPositionColumn = curs.columnPosition;
+
+ while (column != col - 1)
+ {
+ column += delta; // shift one column left or right
+ if (column < 0 || column == sequence.length)
+ {
+ break;
+ }
+ gapped = Comparison.isGap(sequence[column]);
+ if (!gapped)
+ {
+ newPos += delta;
+ lastFoundPosition = newPos;
+ lastFoundPositionColumn = column + 1;
+ if (lastFoundPosition == this.start)
+ {
+ firstResidueColumn = column + 1;
+ }
+ }
+ }
+
+ if (cursor == null || lastFoundPosition != cursor.residuePosition)
+ {
+ updateCursor(lastFoundPosition, lastFoundPositionColumn,
+ firstResidueColumn);
+ }
+
+ /*
+ * hack to give position to the right if on a gap
+ * or beyond the length of the sequence (see JAL-2562)
+ */
+ if (delta > 0 && (gapped || column >= sequence.length))
+ {
+ newPos++;
+ }
+
+ return newPos;
+ }
+
+ /**
+ * {@inheritDoc}
+ */
+ @Override
+ public Range findPositions(int fromColumn, int toColumn)
+ {
+ if (toColumn < fromColumn || fromColumn < 1)
+ {
+ return null;
+ }
+
+ /*
+ * find the first non-gapped position, if any
+ */
+ int firstPosition = 0;
+ int col = fromColumn - 1;
+ int length = sequence.length;
+ while (col < length && col < toColumn)
+ {
+ if (!Comparison.isGap(sequence[col]))
+ {
+ firstPosition = findPosition(col++);
+ break;
+ }
+ col++;
+ }
+
+ if (firstPosition == 0)
+ {
+ return null;
+ }
+
+ /*
+ * find the last non-gapped position
+ */
+ int lastPosition = firstPosition;
+ while (col < length && col < toColumn)
+ {
+ if (!Comparison.isGap(sequence[col++]))
+ {
+ lastPosition++;
+ }
+ }
+
+ return new Range(firstPosition, lastPosition);
+ }
+
+ /**
* Returns an int array where indices correspond to each residue in the
* sequence and the element value gives its position in the alignment
*
}
@Override
- public void deleteChars(int i, int j)
+ public void deleteChars(final int i, final int j)
{
int newstart = start, newend = end;
if (i >= sequence.length || i < 0)
boolean createNewDs = false;
// TODO: take a (second look) at the dataset creation validation method for
// the very large sequence case
- int eindex = -1, sindex = -1;
- boolean ecalc = false, scalc = false;
+ int startIndex = findIndex(start) - 1;
+ int endIndex = findIndex(end) - 1;
+ int startDeleteColumn = -1; // for dataset sequence deletions
+ int deleteCount = 0;
+
for (int s = i; s < j; s++)
{
- if (jalview.schemes.ResidueProperties.aaIndex[sequence[s]] != 23)
+ if (Comparison.isGap(sequence[s]))
+ {
+ continue;
+ }
+ deleteCount++;
+ if (startDeleteColumn == -1)
+ {
+ startDeleteColumn = findPosition(s) - start;
+ }
+ if (createNewDs)
+ {
+ newend--;
+ }
+ else
{
- if (createNewDs)
+ if (startIndex == s)
{
- newend--;
+ /*
+ * deleting characters from start of sequence; new start is the
+ * sequence position of the next column (position to the right
+ * if the column position is gapped)
+ */
+ newstart = findPosition(j);
+ break;
}
else
{
- if (!scalc)
+ if (endIndex < j)
{
- sindex = findIndex(start) - 1;
- scalc = true;
- }
- if (sindex == s)
- {
- // delete characters including start of sequence
- newstart = findPosition(j);
- break; // don't need to search for any more residue characters.
+ /*
+ * deleting characters at end of sequence; new end is the sequence
+ * position of the column before the deletion; subtract 1 if this is
+ * gapped since findPosition returns the next sequence position
+ */
+ newend = findPosition(i - 1);
+ if (Comparison.isGap(sequence[i - 1]))
+ {
+ newend--;
+ }
+ break;
}
else
{
- // delete characters after start.
- if (!ecalc)
- {
- eindex = findIndex(end) - 1;
- ecalc = true;
- }
- if (eindex < j)
- {
- // delete characters at end of sequence
- newend = findPosition(i - 1);
- break; // don't need to search for any more residue characters.
- }
- else
- {
- createNewDs = true;
- newend--; // decrease end position by one for the deleted residue
- // and search further
- }
+ createNewDs = true;
+ newend--;
}
}
}
}
- // deletion occured in the middle of the sequence
+
if (createNewDs && this.datasetSequence != null)
{
- // construct a new sequence
+ /*
+ * if deletion occured in the middle of the sequence,
+ * construct a new dataset sequence and delete the residues
+ * that were deleted from the aligned sequence
+ */
Sequence ds = new Sequence(datasetSequence);
+ ds.deleteChars(startDeleteColumn, startDeleteColumn + deleteCount);
+ datasetSequence = ds;
// TODO: remove any non-inheritable properties ?
// TODO: create a sequence mapping (since there is a relation here ?)
- ds.deleteChars(i, j);
- datasetSequence = ds;
}
start = newstart;
end = newend;
sequence = tmp;
+ sequenceChanged();
}
@Override
}
sequence = tmp;
+ sequenceChanged();
}
@Override
private boolean _isNa;
- private long _seqhash = 0;
+ private int _seqhash = 0;
/**
* Answers false if the sequence is more than 85% nucleotide (ACGTU), else
dsseq.setDescription(description);
// move features and database references onto dataset sequence
- dsseq.sequenceFeatures = sequenceFeatures;
- sequenceFeatures = null;
+ dsseq.sequenceFeatureStore = sequenceFeatureStore;
+ sequenceFeatureStore = null;
dsseq.dbrefs = dbrefs;
dbrefs = null;
// TODO: search and replace any references to this sequence with
return null;
}
- Vector subset = new Vector();
- Enumeration e = annotation.elements();
+ Vector<AlignmentAnnotation> subset = new Vector<AlignmentAnnotation>();
+ Enumeration<AlignmentAnnotation> e = annotation.elements();
while (e.hasMoreElements())
{
- AlignmentAnnotation ann = (AlignmentAnnotation) e.nextElement();
+ AlignmentAnnotation ann = e.nextElement();
if (ann.label != null && ann.label.equals(label))
{
subset.addElement(ann);
e = subset.elements();
while (e.hasMoreElements())
{
- anns[i++] = (AlignmentAnnotation) e.nextElement();
+ anns[i++] = e.nextElement();
}
subset.removeAllElements();
return anns;
if (entry.getSequenceFeatures() != null)
{
- SequenceFeature[] sfs = entry.getSequenceFeatures();
- for (int si = 0; si < sfs.length; si++)
+ List<SequenceFeature> sfs = entry.getSequenceFeatures();
+ for (SequenceFeature feature : sfs)
{
- SequenceFeature sf[] = (mp != null) ? mp.locateFeature(sfs[si])
- : new SequenceFeature[]
- { new SequenceFeature(sfs[si]) };
- if (sf != null && sf.length > 0)
+ SequenceFeature sf[] = (mp != null) ? mp.locateFeature(feature)
+ : new SequenceFeature[] { new SequenceFeature(feature) };
+ if (sf != null)
{
for (int sfi = 0; sfi < sf.length; sfi++)
{
// transfer PDB entries
if (entry.getAllPDBEntries() != null)
{
- Enumeration e = entry.getAllPDBEntries().elements();
+ Enumeration<PDBEntry> e = entry.getAllPDBEntries().elements();
while (e.hasMoreElements())
{
- PDBEntry pdb = (PDBEntry) e.nextElement();
+ PDBEntry pdb = e.nextElement();
addPDBId(pdb);
}
}
}
}
- /**
- * @return The index (zero-based) on this sequence in the MSA. It returns
- * {@code -1} if this information is not available.
- */
- @Override
- public int getIndex()
- {
- return index;
- }
-
- /**
- * Defines the position of this sequence in the MSA. Use the value {@code -1}
- * if this information is undefined.
- *
- * @param The
- * position for this sequence. This value is zero-based (zero for
- * this first sequence)
- */
- @Override
- public void setIndex(int value)
- {
- index = value;
- }
-
@Override
public void setRNA(RNA r)
{
}
}
+ /**
+ * {@inheritDoc}
+ */
+ @Override
+ public List<SequenceFeature> findFeatures(int fromColumn, int toColumn,
+ String... types)
+ {
+ int startPos = findPosition(fromColumn - 1); // convert base 1 to base 0
+ int endPos = fromColumn == toColumn ? startPos
+ : findPosition(toColumn - 1);
+
+ List<SequenceFeature> result = getFeatures().findFeatures(startPos,
+ endPos, types);
+
+ /*
+ * if end column is gapped, endPos may be to the right,
+ * and we may have included adjacent or enclosing features;
+ * remove any that are not enclosing, non-contact features
+ */
+ boolean endColumnIsGapped = toColumn > 0 && toColumn <= sequence.length
+ && Comparison.isGap(sequence[toColumn - 1]);
+ if (endPos > this.end || endColumnIsGapped)
+ {
+ ListIterator<SequenceFeature> it = result.listIterator();
+ while (it.hasNext())
+ {
+ SequenceFeature sf = it.next();
+ int sfBegin = sf.getBegin();
+ int sfEnd = sf.getEnd();
+ int featureStartColumn = findIndex(sfBegin);
+ if (featureStartColumn > toColumn)
+ {
+ it.remove();
+ }
+ else if (featureStartColumn < fromColumn)
+ {
+ int featureEndColumn = sfEnd == sfBegin ? featureStartColumn
+ : findIndex(sfEnd);
+ if (featureEndColumn < fromColumn)
+ {
+ it.remove();
+ }
+ else if (featureEndColumn > toColumn && sf.isContactFeature())
+ {
+ /*
+ * remove an enclosing feature if it is a contact feature
+ */
+ it.remove();
+ }
+ }
+ }
+ }
+
+ return result;
+ }
+
+ /**
+ * Invalidates any stale cursors (forcing recalculation) by incrementing the
+ * token that has to match the one presented by the cursor
+ */
+ @Override
+ public void sequenceChanged()
+ {
+ changeCount++;
+ }
+
+ /**
+ * {@inheritDoc}
+ */
+ @Override
+ public int replace(char c1, char c2)
+ {
+ if (c1 == c2)
+ {
+ return 0;
+ }
+ int count = 0;
+ synchronized (sequence)
+ {
+ for (int c = 0; c < sequence.length; c++)
+ {
+ if (sequence[c] == c1)
+ {
+ sequence[c] = c2;
+ count++;
+ }
+ }
+ }
+ if (count > 0)
+ {
+ sequenceChanged();
+ }
+
+ return count;
+ }
}
--- /dev/null
+/*
+ * Jalview - A Sequence Alignment Editor and Viewer ($$Version-Rel$$)
+ * Copyright (C) $$Year-Rel$$ The Jalview Authors
+ *
+ * This file is part of Jalview.
+ *
+ * Jalview is free software: you can redistribute it and/or
+ * modify it under the terms of the GNU General Public License
+ * as published by the Free Software Foundation, either version 3
+ * of the License, or (at your option) any later version.
+ *
+ * Jalview is distributed in the hope that it will be useful, but
+ * WITHOUT ANY WARRANTY; without even the implied warranty
+ * of MERCHANTABILITY or FITNESS FOR A PARTICULAR
+ * PURPOSE. See the GNU General Public License for more details.
+ *
+ * You should have received a copy of the GNU General Public License
+ * along with Jalview. If not, see <http://www.gnu.org/licenses/>.
+ * The Jalview Authors are detailed in the 'AUTHORS' file.
+ */
+package jalview.datamodel;
+
+/**
+ * An immutable object representing one or more residue and corresponding
+ * alignment column positions for a sequence
+ */
+public class SequenceCursor
+{
+ /**
+ * the aligned sequence this cursor applies to
+ */
+ public final SequenceI sequence;
+
+ /**
+ * residue position in sequence (start...), 0 if undefined
+ */
+ public final int residuePosition;
+
+ /**
+ * column position (1...) corresponding to residuePosition, or 0 if undefined
+ */
+ public final int columnPosition;
+
+ /**
+ * column position (1...) of first residue in the sequence, or 0 if undefined
+ */
+ public final int firstColumnPosition;
+
+ /**
+ * column position (1...) of last residue in the sequence, or 0 if undefined
+ */
+ public final int lastColumnPosition;
+
+ /**
+ * a token which may be used to check whether this cursor is still valid for
+ * its sequence (allowing it to be ignored if the sequence has changed)
+ */
+ public final int token;
+
+ /**
+ * Constructor
+ *
+ * @param seq
+ * sequence this cursor applies to
+ * @param resPos
+ * residue position in sequence (start..)
+ * @param column
+ * column position in alignment (1..)
+ * @param tok
+ * a token that may be validated by the sequence to check the cursor
+ * is not stale
+ */
+ public SequenceCursor(SequenceI seq, int resPos, int column, int tok)
+ {
+ this(seq, resPos, column, 0, 0, tok);
+ }
+
+ /**
+ * Constructor
+ *
+ * @param seq
+ * sequence this cursor applies to
+ * @param resPos
+ * residue position in sequence (start..)
+ * @param column
+ * column position in alignment (1..)
+ * @param firstResCol
+ * column position of the first residue in the sequence (1..), or 0
+ * if not known
+ * @param lastResCol
+ * column position of the last residue in the sequence (1..), or 0 if
+ * not known
+ * @param tok
+ * a token that may be validated by the sequence to check the cursor
+ * is not stale
+ */
+ public SequenceCursor(SequenceI seq, int resPos, int column, int firstResCol,
+ int lastResCol, int tok)
+ {
+ sequence = seq;
+ residuePosition = resPos;
+ columnPosition = column;
+ firstColumnPosition = firstResCol;
+ lastColumnPosition = lastResCol;
+ token = tok;
+ }
+
+ @Override
+ public int hashCode()
+ {
+ int hash = 31 * residuePosition;
+ hash = 31 * hash + columnPosition;
+ hash = 31 * hash + token;
+ if (sequence != null)
+ {
+ hash += sequence.hashCode();
+ }
+ return hash;
+ }
+
+ /**
+ * Two cursors are equal if they refer to the same sequence object and have
+ * the same residue position, column position and token value
+ */
+ @Override
+ public boolean equals(Object obj)
+ {
+ if (!(obj instanceof SequenceCursor))
+ {
+ return false;
+ }
+ SequenceCursor sc = (SequenceCursor) obj;
+ return sequence == sc.sequence && residuePosition == sc.residuePosition
+ && columnPosition == sc.columnPosition && token == sc.token;
+ }
+
+ @Override
+ public String toString()
+ {
+ String name = sequence == null ? "" : sequence.getName();
+ return String.format("%s:Pos%d:Col%d:startCol%d:endCol%d:tok%d", name,
+ residuePosition, columnPosition, firstColumnPosition,
+ lastColumnPosition, token);
+ }
+}
*/
package jalview.datamodel;
+import jalview.datamodel.features.FeatureLocationI;
+
import java.util.HashMap;
import java.util.Map;
+import java.util.Map.Entry;
import java.util.Vector;
/**
* @author $author$
* @version $Revision$
*/
-public class SequenceFeature
+public class SequenceFeature implements FeatureLocationI
{
+ /*
+ * score value if none is set; preferably Float.Nan, but see
+ * JAL-2060 and JAL-2554 for a couple of blockers to that
+ */
+ private static final float NO_SCORE = 0f;
+
private static final String STATUS = "status";
private static final String STRAND = "STRAND";
*/
private static final String ATTRIBUTES = "ATTRIBUTES";
- public int begin;
+ /*
+ * type, begin, end, featureGroup, score and contactFeature are final
+ * to ensure that the integrity of SequenceFeatures data store
+ * can't be broken by direct update of these fields
+ */
+ public final String type;
- public int end;
+ public final int begin;
- public float score;
+ public final int end;
- public String type;
+ public final String featureGroup;
+
+ public final float score;
+
+ private final boolean contactFeature;
public String description;
public Vector<String> links;
- // Feature group can be set from a features file
- // as a group of features between STARTGROUP and ENDGROUP markers
- public String featureGroup;
-
- public SequenceFeature()
- {
- }
-
/**
* Constructs a duplicate feature. Note: Uses makes a shallow copy of the
* otherDetails map, so the new and original SequenceFeature may reference the
*/
public SequenceFeature(SequenceFeature cpy)
{
- if (cpy != null)
- {
- begin = cpy.begin;
- end = cpy.end;
- score = cpy.score;
- if (cpy.type != null)
- {
- type = new String(cpy.type);
- }
- if (cpy.description != null)
- {
- description = new String(cpy.description);
- }
- if (cpy.featureGroup != null)
- {
- featureGroup = new String(cpy.featureGroup);
- }
- if (cpy.otherDetails != null)
- {
- try
- {
- otherDetails = (Map<String, Object>) ((HashMap<String, Object>) cpy.otherDetails)
- .clone();
- } catch (Exception e)
- {
- // ignore
- }
- }
- if (cpy.links != null && cpy.links.size() > 0)
- {
- links = new Vector<String>();
- for (int i = 0, iSize = cpy.links.size(); i < iSize; i++)
- {
- links.addElement(cpy.links.elementAt(i));
- }
- }
- }
+ this(cpy, cpy.getBegin(), cpy.getEnd(), cpy.getFeatureGroup(), cpy
+ .getScore());
}
/**
- * Constructor including a Status value
+ * Constructor
*
- * @param type
- * @param desc
- * @param status
- * @param begin
- * @param end
- * @param featureGroup
+ * @param theType
+ * @param theDesc
+ * @param theBegin
+ * @param theEnd
+ * @param group
*/
- public SequenceFeature(String type, String desc, String status, int begin,
- int end, String featureGroup)
+ public SequenceFeature(String theType, String theDesc, int theBegin,
+ int theEnd, String group)
{
- this(type, desc, begin, end, featureGroup);
- setStatus(status);
+ this(theType, theDesc, theBegin, theEnd, NO_SCORE, group);
}
/**
- * Constructor
+ * Constructor including a score value
*
- * @param type
- * @param desc
- * @param begin
- * @param end
- * @param featureGroup
+ * @param theType
+ * @param theDesc
+ * @param theBegin
+ * @param theEnd
+ * @param theScore
+ * @param group
*/
- SequenceFeature(String type, String desc, int begin, int end,
- String featureGroup)
+ public SequenceFeature(String theType, String theDesc, int theBegin,
+ int theEnd, float theScore, String group)
{
- this.type = type;
- this.description = desc;
- this.begin = begin;
- this.end = end;
- this.featureGroup = featureGroup;
+ this.type = theType;
+ this.description = theDesc;
+ this.begin = theBegin;
+ this.end = theEnd;
+ this.featureGroup = group;
+ this.score = theScore;
+
+ /*
+ * for now, only "Disulfide/disulphide bond" is treated as a contact feature
+ */
+ this.contactFeature = "disulfide bond".equalsIgnoreCase(type)
+ || "disulphide bond".equalsIgnoreCase(type);
}
/**
- * Constructor including a score value
+ * A copy constructor that allows the value of final fields to be 'modified'
+ *
+ * @param sf
+ * @param newType
+ * @param newBegin
+ * @param newEnd
+ * @param newGroup
+ * @param newScore
+ */
+ public SequenceFeature(SequenceFeature sf, String newType, int newBegin,
+ int newEnd, String newGroup, float newScore)
+ {
+ this(newType, sf.getDescription(), newBegin, newEnd, newScore,
+ newGroup);
+
+ if (sf.otherDetails != null)
+ {
+ otherDetails = new HashMap<String, Object>();
+ for (Entry<String, Object> entry : sf.otherDetails.entrySet())
+ {
+ otherDetails.put(entry.getKey(), entry.getValue());
+ }
+ }
+ if (sf.links != null && sf.links.size() > 0)
+ {
+ links = new Vector<String>();
+ for (int i = 0, iSize = sf.links.size(); i < iSize; i++)
+ {
+ links.addElement(sf.links.elementAt(i));
+ }
+ }
+ }
+
+ /**
+ * A copy constructor that allows the value of final fields to be 'modified'
*
- * @param type
- * @param desc
- * @param begin
- * @param end
- * @param score
- * @param featureGroup
+ * @param sf
+ * @param newBegin
+ * @param newEnd
+ * @param newGroup
+ * @param newScore
*/
- public SequenceFeature(String type, String desc, int begin, int end,
- float score, String featureGroup)
+ public SequenceFeature(SequenceFeature sf, int newBegin, int newEnd,
+ String newGroup, float newScore)
{
- this(type, desc, begin, end, featureGroup);
- this.score = score;
+ this(sf, sf.getType(), newBegin, newEnd, newGroup, newScore);
}
/**
*
* @return DOCUMENT ME!
*/
+ @Override
public int getBegin()
{
return begin;
}
- public void setBegin(int start)
- {
- this.begin = start;
- }
-
/**
* DOCUMENT ME!
*
* @return DOCUMENT ME!
*/
+ @Override
public int getEnd()
{
return end;
}
- public void setEnd(int end)
- {
- this.end = end;
- }
-
/**
* DOCUMENT ME!
*
return type;
}
- public void setType(String type)
- {
- this.type = type;
- }
-
/**
* DOCUMENT ME!
*
return featureGroup;
}
- public void setFeatureGroup(String featureGroup)
- {
- this.featureGroup = featureGroup;
- }
-
public void addLink(String labelLink)
{
if (links == null)
links = new Vector<String>();
}
- links.insertElementAt(labelLink, 0);
+ if (!links.contains(labelLink))
+ {
+ links.insertElementAt(labelLink, 0);
+ }
}
public float getScore()
return score;
}
- public void setScore(float value)
- {
- score = value;
- }
-
/**
* Used for getting values which are not in the basic set. eg STRAND, PHASE
* for GFF file
return (String) getValue(ATTRIBUTES);
}
- public void setPosition(int pos)
- {
- begin = pos;
- end = pos;
- }
-
- public int getPosition()
- {
- return begin;
- }
-
/**
* Return 1 for forward strand ('+' in GFF), -1 for reverse strand ('-' in
* GFF), and 0 for unknown or not (validly) specified
* positions, rather than ends of a range. Such features may be visualised or
* reported differently to features on a range.
*/
+ @Override
public boolean isContactFeature()
{
- // TODO abstract one day to a FeatureType class
- if ("disulfide bond".equalsIgnoreCase(type)
- || "disulphide bond".equalsIgnoreCase(type))
- {
- return true;
- }
- return false;
+ return contactFeature;
+ }
+
+ /**
+ * Answers true if the sequence has zero start and end position
+ *
+ * @return
+ */
+ public boolean isNonPositional()
+ {
+ return begin == 0 && end == 0;
}
}
import java.beans.PropertyChangeListener;
import java.beans.PropertyChangeSupport;
import java.util.ArrayList;
+import java.util.Arrays;
import java.util.List;
import java.util.Map;
@Override
public Iterable<AlignmentAnnotation> findAnnotation(String calcId)
{
- List<AlignmentAnnotation> aa = new ArrayList<>();
- if (calcId == null)
- {
- return aa;
- }
- for (AlignmentAnnotation a : getAlignmentAnnotation())
- {
- if (calcId.equals(a.getCalcId()))
- {
- aa.add(a);
- }
- }
- return aa;
+ return AlignmentAnnotation.findAnnotation(
+ Arrays.asList(getAlignmentAnnotation()), calcId);
}
@Override
public Iterable<AlignmentAnnotation> findAnnotations(SequenceI seq,
String calcId, String label)
{
- ArrayList<AlignmentAnnotation> aa = new ArrayList<>();
- for (AlignmentAnnotation ann : getAlignmentAnnotation())
- {
- if ((calcId == null || (ann.getCalcId() != null
- && ann.getCalcId().equals(calcId)))
- && (seq == null || (ann.sequenceRef != null
- && ann.sequenceRef == seq))
- && (label == null
- || (ann.label != null && ann.label.equals(label))))
- {
- aa.add(ann);
- }
- }
- return aa;
+ return AlignmentAnnotation.findAnnotations(
+ Arrays.asList(getAlignmentAnnotation()), seq, calcId, label);
}
/**
*/
public boolean hasAnnotation(String calcId)
{
- if (calcId != null && !"".equals(calcId))
- {
- for (AlignmentAnnotation a : getAlignmentAnnotation())
- {
- if (a.getCalcId() == calcId)
- {
- return true;
- }
- }
- }
- return false;
+ return AlignmentAnnotation
+ .hasAnnotation(Arrays.asList(getAlignmentAnnotation()), calcId);
}
/**
*/
package jalview.datamodel;
+import jalview.datamodel.features.SequenceFeaturesI;
+
import java.util.BitSet;
import java.util.List;
import java.util.Vector;
public String getSequenceAsString(int start, int end);
/**
- * Get the sequence as a character array
+ * Answers a copy of the sequence as a character array
*
- * @return seqeunce and any gaps
+ * @return
*/
public char[] getSequence();
public String getDescription();
/**
- * Return the alignment column for a sequence position
+ * Return the alignment column (from 1..) for a sequence position
*
* @param pos
* lying from start to end
public int findIndex(int pos);
/**
- * Returns the sequence position for an alignment position.
+ * Returns the sequence position for an alignment (column) position. If at a
+ * gap, returns the position of the next residue to the right. If beyond the
+ * end of the sequence, returns 1 more than the last residue position.
*
* @param i
* column index in alignment (from 0..<length)
*
- * @return TODO: JAL-2562 - residue number for residue (left of and) nearest
- * ith column
+ * @return
*/
public int findPosition(int i);
/**
+ * Returns the from-to sequence positions (start..) for the given column
+ * positions (1..), or null if no residues are included in the range
+ *
+ * @param fromColum
+ * @param toColumn
+ * @return
+ */
+ public Range findPositions(int fromColum, int toColumn);
+
+ /**
* Returns an int array where indices correspond to each residue in the
* sequence and the element value gives its position in the alignment
*
public void insertCharAt(int position, int count, char ch);
/**
- * Gets array holding sequence features associated with this sequence. The
- * array may be held by the sequence's dataset sequence if that is defined.
+ * Answers a list of all sequence features associated with this sequence. The
+ * list may be held by the sequence's dataset sequence if that is defined.
*
- * @return hard reference to array
+ * @return
+ */
+ public List<SequenceFeature> getSequenceFeatures();
+
+ /**
+ * Answers the object holding features for the sequence
+ *
+ * @return
*/
- public SequenceFeature[] getSequenceFeatures();
+ SequenceFeaturesI getFeatures();
/**
- * Replaces the array of sequence features associated with this sequence with
- * a new array reference. If this sequence has a dataset sequence, then this
- * method will update the dataset sequence's feature array
+ * Replaces the sequence features associated with this sequence with the given
+ * features. If this sequence has a dataset sequence, then this method will
+ * update the dataset sequence's features instead.
*
* @param features
- * New array of sequence features
*/
- public void setSequenceFeatures(SequenceFeature[] features);
+ public void setSequenceFeatures(List<SequenceFeature> features);
/**
* DOCUMENT ME!
/**
* Adds the given sequence feature and returns true, or returns false if it is
- * already present on the sequence
+ * already present on the sequence, or if the feature type is null.
*
* @param sf
* @return
public void transferAnnotation(SequenceI entry, Mapping mp);
/**
- * @param index
- * The sequence index in the MSA
- */
- public void setIndex(int index);
-
- /**
- * @return The index of the sequence in the alignment
- */
- public int getIndex();
-
- /**
* @return The RNA of the sequence in the alignment
*/
public List<DBRefEntry> getPrimaryDBRefs();
/**
+ * Returns a (possibly empty) list of sequence features that overlap the given
+ * alignment column range, optionally restricted to one or more specified
+ * feature types. If the range is all gaps, then features which enclose it are
+ * included (but not contact features).
+ *
+ * @param fromCol
+ * start column of range inclusive (1..)
+ * @param toCol
+ * end column of range inclusive (1..)
+ * @param types
+ * optional feature types to restrict results to
+ * @return
+ */
+ List<SequenceFeature> findFeatures(int fromCol, int toCol, String... types);
+
+ /**
+ * Method to call to indicate that the sequence (characters or alignment/gaps)
+ * has been modified. Provided to allow any cursors on residue/column
+ * positions to be invalidated.
+ */
+ void sequenceChanged();
+
+ /**
*
* @return BitSet corresponding to index [0,length) where Comparison.isGap()
* returns true.
*/
BitSet getInsertionsAsBits();
+
+ /**
+ * Replaces every occurrence of c1 in the sequence with c2 and returns the
+ * number of characters changed
+ *
+ * @param c1
+ * @param c2
+ */
+ public int replace(char c1, char c2);
}
* along with Jalview. If not, see <http://www.gnu.org/licenses/>.
* The Jalview Authors are detailed in the 'AUTHORS' file.
*/
-package jalview.io;
+package jalview.datamodel.features;
+
+import jalview.datamodel.ContiguousI;
/**
- * IO for asymmetric matrix with arbitrary dimension with labels, as displayed
- * by PCA viewer. Form is: tab separated entity defs header line TITLE\ttitle
- * DESC\tdesc PROPERTY\t<id or empty for whole matrix>\tname\ttype\tvalue
- * ROW\tRow i label (ID)/tPrinciple text/tprinciple description/t...
- * COLUMN\t(similar, optional).. .. <float>\t<float>...(column-wise data for row
- * i)
+ * An extension of ContiguousI that allows start/end values to be interpreted
+ * instead as two contact positions
*/
-
-public class MatrixFile extends FileParse
+public interface FeatureLocationI extends ContiguousI
{
-
+ boolean isContactFeature();
}
--- /dev/null
+/*
+ * Jalview - A Sequence Alignment Editor and Viewer ($$Version-Rel$$)
+ * Copyright (C) $$Year-Rel$$ The Jalview Authors
+ *
+ * This file is part of Jalview.
+ *
+ * Jalview is free software: you can redistribute it and/or
+ * modify it under the terms of the GNU General Public License
+ * as published by the Free Software Foundation, either version 3
+ * of the License, or (at your option) any later version.
+ *
+ * Jalview is distributed in the hope that it will be useful, but
+ * WITHOUT ANY WARRANTY; without even the implied warranty
+ * of MERCHANTABILITY or FITNESS FOR A PARTICULAR
+ * PURPOSE. See the GNU General Public License for more details.
+ *
+ * You should have received a copy of the GNU General Public License
+ * along with Jalview. If not, see <http://www.gnu.org/licenses/>.
+ * The Jalview Authors are detailed in the 'AUTHORS' file.
+ */
+package jalview.datamodel.features;
+
+import jalview.datamodel.ContiguousI;
+import jalview.datamodel.SequenceFeature;
+
+import java.util.ArrayList;
+import java.util.Collections;
+import java.util.Comparator;
+import java.util.HashSet;
+import java.util.List;
+import java.util.Set;
+
+/**
+ * A data store for a set of sequence features that supports efficient lookup of
+ * features overlapping a given range. Intended for (but not limited to) storage
+ * of features for one sequence and feature type.
+ *
+ * @author gmcarstairs
+ *
+ */
+public class FeatureStore
+{
+ /**
+ * a class providing criteria for performing a binary search of a list
+ */
+ abstract static class SearchCriterion
+ {
+ /**
+ * Answers true if the entry passes the search criterion test
+ *
+ * @param entry
+ * @return
+ */
+ abstract boolean compare(SequenceFeature entry);
+
+ /**
+ * serves a search condition for finding the first feature whose start
+ * position follows a given target location
+ *
+ * @param target
+ * @return
+ */
+ static SearchCriterion byStart(final long target)
+ {
+ return new SearchCriterion() {
+
+ @Override
+ boolean compare(SequenceFeature entry)
+ {
+ return entry.getBegin() >= target;
+ }
+ };
+ }
+
+ /**
+ * serves a search condition for finding the first feature whose end
+ * position is at or follows a given target location
+ *
+ * @param target
+ * @return
+ */
+ static SearchCriterion byEnd(final long target)
+ {
+ return new SearchCriterion()
+ {
+
+ @Override
+ boolean compare(SequenceFeature entry)
+ {
+ return entry.getEnd() >= target;
+ }
+ };
+ }
+
+ /**
+ * serves a search condition for finding the first feature which follows the
+ * given range as determined by a supplied comparator
+ *
+ * @param target
+ * @return
+ */
+ static SearchCriterion byFeature(final ContiguousI to,
+ final Comparator<ContiguousI> rc)
+ {
+ return new SearchCriterion()
+ {
+
+ @Override
+ boolean compare(SequenceFeature entry)
+ {
+ return rc.compare(entry, to) >= 0;
+ }
+ };
+ }
+ }
+
+ /*
+ * Non-positional features have no (zero) start/end position.
+ * Kept as a separate list in case this criterion changes in future.
+ */
+ List<SequenceFeature> nonPositionalFeatures;
+
+ /*
+ * An ordered list of features, with the promise that no feature in the list
+ * properly contains any other. This constraint allows bounded linear search
+ * of the list for features overlapping a region.
+ * Contact features are not included in this list.
+ */
+ List<SequenceFeature> nonNestedFeatures;
+
+ /*
+ * contact features ordered by first contact position
+ */
+ List<SequenceFeature> contactFeatureStarts;
+
+ /*
+ * contact features ordered by second contact position
+ */
+ List<SequenceFeature> contactFeatureEnds;
+
+ /*
+ * Nested Containment List is used to hold any features that are nested
+ * within (properly contained by) any other feature. This is a recursive tree
+ * which supports depth-first scan for features overlapping a range.
+ * It is used here as a 'catch-all' fallback for features that cannot be put
+ * into a simple ordered list without invalidating the search methods.
+ */
+ NCList<SequenceFeature> nestedFeatures;
+
+ /*
+ * Feature groups represented in stored positional features
+ * (possibly including null)
+ */
+ Set<String> positionalFeatureGroups;
+
+ /*
+ * Feature groups represented in stored non-positional features
+ * (possibly including null)
+ */
+ Set<String> nonPositionalFeatureGroups;
+
+ /*
+ * the total length of all positional features; contact features count 1 to
+ * the total and 1 to size(), consistent with an average 'feature length' of 1
+ */
+ int totalExtent;
+
+ float positionalMinScore;
+
+ float positionalMaxScore;
+
+ float nonPositionalMinScore;
+
+ float nonPositionalMaxScore;
+
+ /**
+ * Constructor
+ */
+ public FeatureStore()
+ {
+ nonNestedFeatures = new ArrayList<SequenceFeature>();
+ positionalFeatureGroups = new HashSet<String>();
+ nonPositionalFeatureGroups = new HashSet<String>();
+ positionalMinScore = Float.NaN;
+ positionalMaxScore = Float.NaN;
+ nonPositionalMinScore = Float.NaN;
+ nonPositionalMaxScore = Float.NaN;
+
+ // we only construct nonPositionalFeatures, contactFeatures
+ // or the NCList if we need to
+ }
+
+ /**
+ * Adds one sequence feature to the store, and returns true, unless the
+ * feature is already contained in the store, in which case this method
+ * returns false. Containment is determined by SequenceFeature.equals()
+ * comparison.
+ *
+ * @param feature
+ */
+ public boolean addFeature(SequenceFeature feature)
+ {
+ if (contains(feature))
+ {
+ return false;
+ }
+
+ /*
+ * keep a record of feature groups
+ */
+ if (!feature.isNonPositional())
+ {
+ positionalFeatureGroups.add(feature.getFeatureGroup());
+ }
+
+ boolean added = false;
+
+ if (feature.isContactFeature())
+ {
+ added = addContactFeature(feature);
+ }
+ else if (feature.isNonPositional())
+ {
+ added = addNonPositionalFeature(feature);
+ }
+ else
+ {
+ added = addNonNestedFeature(feature);
+ if (!added)
+ {
+ /*
+ * detected a nested feature - put it in the NCList structure
+ */
+ added = addNestedFeature(feature);
+ }
+ }
+
+ if (added)
+ {
+ /*
+ * record the total extent of positional features, to make
+ * getTotalFeatureLength possible; we count the length of a
+ * contact feature as 1
+ */
+ totalExtent += getFeatureLength(feature);
+
+ /*
+ * record the minimum and maximum score for positional
+ * and non-positional features
+ */
+ float score = feature.getScore();
+ if (!Float.isNaN(score))
+ {
+ if (feature.isNonPositional())
+ {
+ nonPositionalMinScore = min(nonPositionalMinScore, score);
+ nonPositionalMaxScore = max(nonPositionalMaxScore, score);
+ }
+ else
+ {
+ positionalMinScore = min(positionalMinScore, score);
+ positionalMaxScore = max(positionalMaxScore, score);
+ }
+ }
+ }
+
+ return added;
+ }
+
+ /**
+ * Answers true if this store contains the given feature (testing by
+ * SequenceFeature.equals), else false
+ *
+ * @param feature
+ * @return
+ */
+ public boolean contains(SequenceFeature feature)
+ {
+ if (feature.isNonPositional())
+ {
+ return nonPositionalFeatures == null ? false : nonPositionalFeatures
+ .contains(feature);
+ }
+
+ if (feature.isContactFeature())
+ {
+ return contactFeatureStarts == null ? false : listContains(
+ contactFeatureStarts, feature);
+ }
+
+ if (listContains(nonNestedFeatures, feature))
+ {
+ return true;
+ }
+
+ return nestedFeatures == null ? false : nestedFeatures
+ .contains(feature);
+ }
+
+ /**
+ * Answers the 'length' of the feature, counting 0 for non-positional features
+ * and 1 for contact features
+ *
+ * @param feature
+ * @return
+ */
+ protected static int getFeatureLength(SequenceFeature feature)
+ {
+ if (feature.isNonPositional())
+ {
+ return 0;
+ }
+ if (feature.isContactFeature())
+ {
+ return 1;
+ }
+ return 1 + feature.getEnd() - feature.getBegin();
+ }
+
+ /**
+ * Adds the feature to the list of non-positional features (with lazy
+ * instantiation of the list if it is null), and returns true. The feature
+ * group is added to the set of distinct feature groups for non-positional
+ * features. This method allows duplicate features, so test before calling to
+ * prevent this.
+ *
+ * @param feature
+ */
+ protected boolean addNonPositionalFeature(SequenceFeature feature)
+ {
+ if (nonPositionalFeatures == null)
+ {
+ nonPositionalFeatures = new ArrayList<SequenceFeature>();
+ }
+
+ nonPositionalFeatures.add(feature);
+
+ nonPositionalFeatureGroups.add(feature.getFeatureGroup());
+
+ return true;
+ }
+
+ /**
+ * Adds one feature to the NCList that can manage nested features (creating
+ * the NCList if necessary), and returns true. If the feature is already
+ * stored in the NCList (by equality test), then it is not added, and this
+ * method returns false.
+ */
+ protected synchronized boolean addNestedFeature(SequenceFeature feature)
+ {
+ if (nestedFeatures == null)
+ {
+ nestedFeatures = new NCList<>(feature);
+ return true;
+ }
+ return nestedFeatures.add(feature, false);
+ }
+
+ /**
+ * Add a feature to the list of non-nested features, maintaining the ordering
+ * of the list. A check is made for whether the feature is nested in (properly
+ * contained by) an existing feature. If there is no nesting, the feature is
+ * added to the list and the method returns true. If nesting is found, the
+ * feature is not added and the method returns false.
+ *
+ * @param feature
+ * @return
+ */
+ protected boolean addNonNestedFeature(SequenceFeature feature)
+ {
+ synchronized (nonNestedFeatures)
+ {
+ /*
+ * find the first stored feature which doesn't precede the new one
+ */
+ int insertPosition = binarySearch(nonNestedFeatures,
+ SearchCriterion.byFeature(feature, RangeComparator.BY_START_POSITION));
+
+ /*
+ * fail if we detect feature enclosure - of the new feature by
+ * the one preceding it, or of the next feature by the new one
+ */
+ if (insertPosition > 0)
+ {
+ if (encloses(nonNestedFeatures.get(insertPosition - 1), feature))
+ {
+ return false;
+ }
+ }
+ if (insertPosition < nonNestedFeatures.size())
+ {
+ if (encloses(feature, nonNestedFeatures.get(insertPosition)))
+ {
+ return false;
+ }
+ }
+
+ /*
+ * checks passed - add the feature
+ */
+ nonNestedFeatures.add(insertPosition, feature);
+
+ return true;
+ }
+ }
+
+ /**
+ * Answers true if range1 properly encloses range2, else false
+ *
+ * @param range1
+ * @param range2
+ * @return
+ */
+ protected boolean encloses(ContiguousI range1, ContiguousI range2)
+ {
+ int begin1 = range1.getBegin();
+ int begin2 = range2.getBegin();
+ int end1 = range1.getEnd();
+ int end2 = range2.getEnd();
+ if (begin1 == begin2 && end1 > end2)
+ {
+ return true;
+ }
+ if (begin1 < begin2 && end1 >= end2)
+ {
+ return true;
+ }
+ return false;
+ }
+
+ /**
+ * Add a contact feature to the lists that hold them ordered by start (first
+ * contact) and by end (second contact) position, ensuring the lists remain
+ * ordered, and returns true. This method allows duplicate features to be
+ * added, so test before calling to avoid this.
+ *
+ * @param feature
+ * @return
+ */
+ protected synchronized boolean addContactFeature(SequenceFeature feature)
+ {
+ if (contactFeatureStarts == null)
+ {
+ contactFeatureStarts = new ArrayList<SequenceFeature>();
+ }
+ if (contactFeatureEnds == null)
+ {
+ contactFeatureEnds = new ArrayList<SequenceFeature>();
+ }
+
+ /*
+ * binary search the sorted list to find the insertion point
+ */
+ int insertPosition = binarySearch(contactFeatureStarts,
+ SearchCriterion.byFeature(feature,
+ RangeComparator.BY_START_POSITION));
+ contactFeatureStarts.add(insertPosition, feature);
+ // and resort to mak siccar...just in case insertion point not quite right
+ Collections.sort(contactFeatureStarts, RangeComparator.BY_START_POSITION);
+
+ insertPosition = binarySearch(contactFeatureStarts,
+ SearchCriterion.byFeature(feature,
+ RangeComparator.BY_END_POSITION));
+ contactFeatureEnds.add(feature);
+ Collections.sort(contactFeatureEnds, RangeComparator.BY_END_POSITION);
+
+ return true;
+ }
+
+ /**
+ * Answers true if the list contains the feature, else false. This method is
+ * optimised for the condition that the list is sorted on feature start
+ * position ascending, and will give unreliable results if this does not hold.
+ *
+ * @param features
+ * @param feature
+ * @return
+ */
+ protected static boolean listContains(List<SequenceFeature> features,
+ SequenceFeature feature)
+ {
+ if (features == null || feature == null)
+ {
+ return false;
+ }
+
+ /*
+ * locate the first entry in the list which does not precede the feature
+ */
+ int pos = binarySearch(features,
+ SearchCriterion.byFeature(feature, RangeComparator.BY_START_POSITION));
+ int len = features.size();
+ while (pos < len)
+ {
+ SequenceFeature sf = features.get(pos);
+ if (sf.getBegin() > feature.getBegin())
+ {
+ return false; // no match found
+ }
+ if (sf.equals(feature))
+ {
+ return true;
+ }
+ pos++;
+ }
+ return false;
+ }
+
+ /**
+ * Returns a (possibly empty) list of features whose extent overlaps the given
+ * range. The returned list is not ordered. Contact features are included if
+ * either of the contact points lies within the range.
+ *
+ * @param start
+ * start position of overlap range (inclusive)
+ * @param end
+ * end position of overlap range (inclusive)
+ * @return
+ */
+ public List<SequenceFeature> findOverlappingFeatures(long start, long end)
+ {
+ List<SequenceFeature> result = new ArrayList<>();
+
+ findNonNestedFeatures(start, end, result);
+
+ findContactFeatures(start, end, result);
+
+ if (nestedFeatures != null)
+ {
+ result.addAll(nestedFeatures.findOverlaps(start, end));
+ }
+
+ return result;
+ }
+
+ /**
+ * Adds contact features to the result list where either the second or the
+ * first contact position lies within the target range
+ *
+ * @param from
+ * @param to
+ * @param result
+ */
+ protected void findContactFeatures(long from, long to,
+ List<SequenceFeature> result)
+ {
+ if (contactFeatureStarts != null)
+ {
+ findContactStartFeatures(from, to, result);
+ }
+ if (contactFeatureEnds != null)
+ {
+ findContactEndFeatures(from, to, result);
+ }
+ }
+
+ /**
+ * Adds to the result list any contact features whose end (second contact
+ * point), but not start (first contact point), lies in the query from-to
+ * range
+ *
+ * @param from
+ * @param to
+ * @param result
+ */
+ protected void findContactEndFeatures(long from, long to,
+ List<SequenceFeature> result)
+ {
+ /*
+ * find the first contact feature (if any) that does not lie
+ * entirely before the target range
+ */
+ int startPosition = binarySearch(contactFeatureEnds,
+ SearchCriterion.byEnd(from));
+ for (; startPosition < contactFeatureEnds.size(); startPosition++)
+ {
+ SequenceFeature sf = contactFeatureEnds.get(startPosition);
+ if (!sf.isContactFeature())
+ {
+ System.err.println("Error! non-contact feature type "
+ + sf.getType() + " in contact features list");
+ continue;
+ }
+
+ int begin = sf.getBegin();
+ if (begin >= from && begin <= to)
+ {
+ /*
+ * this feature's first contact position lies in the search range
+ * so we don't include it in results a second time
+ */
+ continue;
+ }
+
+ int end = sf.getEnd();
+ if (end >= from && end <= to)
+ {
+ result.add(sf);
+ }
+ if (end > to)
+ {
+ break;
+ }
+ }
+ }
+
+ /**
+ * Adds non-nested features to the result list that lie within the target
+ * range. Non-positional features (start=end=0), contact features and nested
+ * features are excluded.
+ *
+ * @param from
+ * @param to
+ * @param result
+ */
+ protected void findNonNestedFeatures(long from, long to,
+ List<SequenceFeature> result)
+ {
+ /*
+ * find the first feature whose end position is
+ * after the target range start
+ */
+ int startIndex = binarySearch(nonNestedFeatures,
+ SearchCriterion.byEnd(from));
+
+ final int startIndex1 = startIndex;
+ int i = startIndex1;
+ while (i < nonNestedFeatures.size())
+ {
+ SequenceFeature sf = nonNestedFeatures.get(i);
+ if (sf.getBegin() > to)
+ {
+ break;
+ }
+ if (sf.getBegin() <= to && sf.getEnd() >= from)
+ {
+ result.add(sf);
+ }
+ i++;
+ }
+ }
+
+ /**
+ * Adds contact features whose start position lies in the from-to range to the
+ * result list
+ *
+ * @param from
+ * @param to
+ * @param result
+ */
+ protected void findContactStartFeatures(long from, long to,
+ List<SequenceFeature> result)
+ {
+ int startPosition = binarySearch(contactFeatureStarts,
+ SearchCriterion.byStart(from));
+
+ for (; startPosition < contactFeatureStarts.size(); startPosition++)
+ {
+ SequenceFeature sf = contactFeatureStarts.get(startPosition);
+ if (!sf.isContactFeature())
+ {
+ System.err.println("Error! non-contact feature type "
+ + sf.getType() + " in contact features list");
+ continue;
+ }
+ int begin = sf.getBegin();
+ if (begin >= from && begin <= to)
+ {
+ result.add(sf);
+ }
+ }
+ }
+
+ /**
+ * Answers a list of all positional features stored, in no guaranteed order
+ *
+ * @return
+ */
+ public List<SequenceFeature> getPositionalFeatures()
+ {
+ /*
+ * add non-nested features (may be all features for many cases)
+ */
+ List<SequenceFeature> result = new ArrayList<>();
+ result.addAll(nonNestedFeatures);
+
+ /*
+ * add any contact features - from the list by start position
+ */
+ if (contactFeatureStarts != null)
+ {
+ result.addAll(contactFeatureStarts);
+ }
+
+ /*
+ * add any nested features
+ */
+ if (nestedFeatures != null)
+ {
+ result.addAll(nestedFeatures.getEntries());
+ }
+
+ return result;
+ }
+
+ /**
+ * Answers a list of all contact features. If there are none, returns an
+ * immutable empty list.
+ *
+ * @return
+ */
+ public List<SequenceFeature> getContactFeatures()
+ {
+ if (contactFeatureStarts == null)
+ {
+ return Collections.emptyList();
+ }
+ return new ArrayList<>(contactFeatureStarts);
+ }
+
+ /**
+ * Answers a list of all non-positional features. If there are none, returns
+ * an immutable empty list.
+ *
+ * @return
+ */
+ public List<SequenceFeature> getNonPositionalFeatures()
+ {
+ if (nonPositionalFeatures == null)
+ {
+ return Collections.emptyList();
+ }
+ return new ArrayList<>(nonPositionalFeatures);
+ }
+
+ /**
+ * Deletes the given feature from the store, returning true if it was found
+ * (and deleted), else false. This method makes no assumption that the feature
+ * is in the 'expected' place in the store, in case it has been modified since
+ * it was added.
+ *
+ * @param sf
+ */
+ public synchronized boolean delete(SequenceFeature sf)
+ {
+ /*
+ * try the non-nested positional features first
+ */
+ boolean removed = nonNestedFeatures.remove(sf);
+
+ /*
+ * if not found, try contact positions (and if found, delete
+ * from both lists of contact positions)
+ */
+ if (!removed && contactFeatureStarts != null)
+ {
+ removed = contactFeatureStarts.remove(sf);
+ if (removed)
+ {
+ contactFeatureEnds.remove(sf);
+ }
+ }
+
+ boolean removedNonPositional = false;
+
+ /*
+ * if not found, try non-positional features
+ */
+ if (!removed && nonPositionalFeatures != null)
+ {
+ removedNonPositional = nonPositionalFeatures.remove(sf);
+ removed = removedNonPositional;
+ }
+
+ /*
+ * if not found, try nested features
+ */
+ if (!removed && nestedFeatures != null)
+ {
+ removed = nestedFeatures.delete(sf);
+ }
+
+ if (removed)
+ {
+ rescanAfterDelete();
+ }
+
+ return removed;
+ }
+
+ /**
+ * Rescan all features to recompute any cached values after an entry has been
+ * deleted. This is expected to be an infrequent event, so performance here is
+ * not critical.
+ */
+ protected synchronized void rescanAfterDelete()
+ {
+ positionalFeatureGroups.clear();
+ nonPositionalFeatureGroups.clear();
+ totalExtent = 0;
+ positionalMinScore = Float.NaN;
+ positionalMaxScore = Float.NaN;
+ nonPositionalMinScore = Float.NaN;
+ nonPositionalMaxScore = Float.NaN;
+
+ /*
+ * scan non-positional features for groups and scores
+ */
+ for (SequenceFeature sf : getNonPositionalFeatures())
+ {
+ nonPositionalFeatureGroups.add(sf.getFeatureGroup());
+ float score = sf.getScore();
+ nonPositionalMinScore = min(nonPositionalMinScore, score);
+ nonPositionalMaxScore = max(nonPositionalMaxScore, score);
+ }
+
+ /*
+ * scan positional features for groups, scores and extents
+ */
+ for (SequenceFeature sf : getPositionalFeatures())
+ {
+ positionalFeatureGroups.add(sf.getFeatureGroup());
+ float score = sf.getScore();
+ positionalMinScore = min(positionalMinScore, score);
+ positionalMaxScore = max(positionalMaxScore, score);
+ totalExtent += getFeatureLength(sf);
+ }
+ }
+
+ /**
+ * A helper method to return the minimum of two floats, where a non-NaN value
+ * is treated as 'less than' a NaN value (unlike Math.min which does the
+ * opposite)
+ *
+ * @param f1
+ * @param f2
+ */
+ protected static float min(float f1, float f2)
+ {
+ if (Float.isNaN(f1))
+ {
+ return Float.isNaN(f2) ? f1 : f2;
+ }
+ else
+ {
+ return Float.isNaN(f2) ? f1 : Math.min(f1, f2);
+ }
+ }
+
+ /**
+ * A helper method to return the maximum of two floats, where a non-NaN value
+ * is treated as 'greater than' a NaN value (unlike Math.max which does the
+ * opposite)
+ *
+ * @param f1
+ * @param f2
+ */
+ protected static float max(float f1, float f2)
+ {
+ if (Float.isNaN(f1))
+ {
+ return Float.isNaN(f2) ? f1 : f2;
+ }
+ else
+ {
+ return Float.isNaN(f2) ? f1 : Math.max(f1, f2);
+ }
+ }
+
+ /**
+ * Answers true if this store has no features, else false
+ *
+ * @return
+ */
+ public boolean isEmpty()
+ {
+ boolean hasFeatures = !nonNestedFeatures.isEmpty()
+ || (contactFeatureStarts != null && !contactFeatureStarts
+ .isEmpty())
+ || (nonPositionalFeatures != null && !nonPositionalFeatures
+ .isEmpty())
+ || (nestedFeatures != null && nestedFeatures.size() > 0);
+
+ return !hasFeatures;
+ }
+
+ /**
+ * Answers the set of distinct feature groups stored, possibly including null,
+ * as an unmodifiable view of the set. The parameter determines whether the
+ * groups for positional or for non-positional features are returned.
+ *
+ * @param positionalFeatures
+ * @return
+ */
+ public Set<String> getFeatureGroups(boolean positionalFeatures)
+ {
+ if (positionalFeatures)
+ {
+ return Collections.unmodifiableSet(positionalFeatureGroups);
+ }
+ else
+ {
+ return nonPositionalFeatureGroups == null ? Collections
+ .<String> emptySet() : Collections
+ .unmodifiableSet(nonPositionalFeatureGroups);
+ }
+ }
+
+ /**
+ * Performs a binary search of the (sorted) list to find the index of the
+ * first entry which returns true for the given comparator function. Returns
+ * the length of the list if there is no such entry.
+ *
+ * @param features
+ * @param sc
+ * @return
+ */
+ protected static int binarySearch(List<SequenceFeature> features,
+ SearchCriterion sc)
+ {
+ int start = 0;
+ int end = features.size() - 1;
+ int matched = features.size();
+
+ while (start <= end)
+ {
+ int mid = (start + end) / 2;
+ SequenceFeature entry = features.get(mid);
+ boolean compare = sc.compare(entry);
+ if (compare)
+ {
+ matched = mid;
+ end = mid - 1;
+ }
+ else
+ {
+ start = mid + 1;
+ }
+ }
+
+ return matched;
+ }
+
+ /**
+ * Answers the number of positional (or non-positional) features stored.
+ * Contact features count as 1.
+ *
+ * @param positional
+ * @return
+ */
+ public int getFeatureCount(boolean positional)
+ {
+ if (!positional)
+ {
+ return nonPositionalFeatures == null ? 0 : nonPositionalFeatures
+ .size();
+ }
+
+ int size = nonNestedFeatures.size();
+
+ if (contactFeatureStarts != null)
+ {
+ // note a contact feature (start/end) counts as one
+ size += contactFeatureStarts.size();
+ }
+
+ if (nestedFeatures != null)
+ {
+ size += nestedFeatures.size();
+ }
+
+ return size;
+ }
+
+ /**
+ * Answers the total length of positional features (or zero if there are
+ * none). Contact features contribute a value of 1 to the total.
+ *
+ * @return
+ */
+ public int getTotalFeatureLength()
+ {
+ return totalExtent;
+ }
+
+ /**
+ * Answers the minimum score held for positional or non-positional features.
+ * This may be Float.NaN if there are no features, are none has a non-NaN
+ * score.
+ *
+ * @param positional
+ * @return
+ */
+ public float getMinimumScore(boolean positional)
+ {
+ return positional ? positionalMinScore : nonPositionalMinScore;
+ }
+
+ /**
+ * Answers the maximum score held for positional or non-positional features.
+ * This may be Float.NaN if there are no features, are none has a non-NaN
+ * score.
+ *
+ * @param positional
+ * @return
+ */
+ public float getMaximumScore(boolean positional)
+ {
+ return positional ? positionalMaxScore : nonPositionalMaxScore;
+ }
+
+ /**
+ * Answers a list of all either positional or non-positional features whose
+ * feature group matches the given group (which may be null)
+ *
+ * @param positional
+ * @param group
+ * @return
+ */
+ public List<SequenceFeature> getFeaturesForGroup(boolean positional,
+ String group)
+ {
+ List<SequenceFeature> result = new ArrayList<>();
+
+ /*
+ * if we know features don't include the target group, no need
+ * to inspect them for matches
+ */
+ if (positional && !positionalFeatureGroups.contains(group)
+ || !positional && !nonPositionalFeatureGroups.contains(group))
+ {
+ return result;
+ }
+
+ List<SequenceFeature> sfs = positional ? getPositionalFeatures()
+ : getNonPositionalFeatures();
+ for (SequenceFeature sf : sfs)
+ {
+ String featureGroup = sf.getFeatureGroup();
+ if (group == null && featureGroup == null || group != null
+ && group.equals(featureGroup))
+ {
+ result.add(sf);
+ }
+ }
+ return result;
+ }
+
+ /**
+ * Adds the shift value to the start and end of all positional features.
+ * Returns true if at least one feature was updated, else false.
+ *
+ * @param shift
+ * @return
+ */
+ public synchronized boolean shiftFeatures(int shift)
+ {
+ /*
+ * Because begin and end are final fields (to ensure the data store's
+ * integrity), we have to delete each feature and re-add it as amended.
+ * (Although a simple shift of all values would preserve data integrity!)
+ */
+ boolean modified = false;
+ for (SequenceFeature sf : getPositionalFeatures())
+ {
+ modified = true;
+ int newBegin = sf.getBegin() + shift;
+ int newEnd = sf.getEnd() + shift;
+
+ /*
+ * sanity check: don't shift left of the first residue
+ */
+ if (newEnd > 0)
+ {
+ newBegin = Math.max(1, newBegin);
+ SequenceFeature sf2 = new SequenceFeature(sf, newBegin, newEnd,
+ sf.getFeatureGroup(), sf.getScore());
+ addFeature(sf2);
+ }
+ delete(sf);
+ }
+ return modified;
+ }
+}
--- /dev/null
+/*
+ * Jalview - A Sequence Alignment Editor and Viewer ($$Version-Rel$$)
+ * Copyright (C) $$Year-Rel$$ The Jalview Authors
+ *
+ * This file is part of Jalview.
+ *
+ * Jalview is free software: you can redistribute it and/or
+ * modify it under the terms of the GNU General Public License
+ * as published by the Free Software Foundation, either version 3
+ * of the License, or (at your option) any later version.
+ *
+ * Jalview is distributed in the hope that it will be useful, but
+ * WITHOUT ANY WARRANTY; without even the implied warranty
+ * of MERCHANTABILITY or FITNESS FOR A PARTICULAR
+ * PURPOSE. See the GNU General Public License for more details.
+ *
+ * You should have received a copy of the GNU General Public License
+ * along with Jalview. If not, see <http://www.gnu.org/licenses/>.
+ * The Jalview Authors are detailed in the 'AUTHORS' file.
+ */
+package jalview.datamodel.features;
+
+import jalview.datamodel.ContiguousI;
+import jalview.datamodel.Range;
+
+import java.util.ArrayList;
+import java.util.Collections;
+import java.util.List;
+
+/**
+ * An adapted implementation of NCList as described in the paper
+ *
+ * <pre>
+ * Nested Containment List (NCList): a new algorithm for accelerating
+ * interval query of genome alignment and interval databases
+ * - Alexander V. Alekseyenko, Christopher J. Lee
+ * https://doi.org/10.1093/bioinformatics/btl647
+ * </pre>
+ */
+public class NCList<T extends ContiguousI>
+{
+ /*
+ * the number of ranges represented
+ */
+ private int size;
+
+ /*
+ * a list, in start position order, of sublists of ranges ordered so
+ * that each contains (or is the same as) the one that follows it
+ */
+ private List<NCNode<T>> subranges;
+
+ /**
+ * Constructor given a list of things that are each located on a contiguous
+ * interval. Note that the constructor may reorder the list.
+ * <p>
+ * We assume here that for each range, start <= end. Behaviour for reverse
+ * ordered ranges is undefined.
+ *
+ * @param ranges
+ */
+ public NCList(List<T> ranges)
+ {
+ this();
+ build(ranges);
+ }
+
+ /**
+ * Sort and group ranges into sublists where each sublist represents a region
+ * and its contained subregions
+ *
+ * @param ranges
+ */
+ protected void build(List<T> ranges)
+ {
+ /*
+ * sort by start ascending so that contained intervals
+ * follow their containing interval
+ */
+ Collections.sort(ranges, RangeComparator.BY_START_POSITION);
+
+ List<Range> sublists = buildSubranges(ranges);
+
+ /*
+ * convert each subrange to an NCNode consisting of a range and
+ * (possibly) its contained NCList
+ */
+ for (Range sublist : sublists)
+ {
+ subranges.add(new NCNode<T>(ranges.subList(sublist.start,
+ sublist.end + 1)));
+ }
+
+ size = ranges.size();
+ }
+
+ public NCList(T entry)
+ {
+ this();
+ subranges.add(new NCNode<>(entry));
+ size = 1;
+ }
+
+ public NCList()
+ {
+ subranges = new ArrayList<NCNode<T>>();
+ }
+
+ /**
+ * Traverses the sorted ranges to identify sublists, within which each
+ * interval contains the one that follows it
+ *
+ * @param ranges
+ * @return
+ */
+ protected List<Range> buildSubranges(List<T> ranges)
+ {
+ List<Range> sublists = new ArrayList<>();
+
+ if (ranges.isEmpty())
+ {
+ return sublists;
+ }
+
+ int listStartIndex = 0;
+ long lastEndPos = Long.MAX_VALUE;
+
+ for (int i = 0; i < ranges.size(); i++)
+ {
+ ContiguousI nextInterval = ranges.get(i);
+ long nextStart = nextInterval.getBegin();
+ long nextEnd = nextInterval.getEnd();
+ if (nextStart > lastEndPos || nextEnd > lastEndPos)
+ {
+ /*
+ * this interval is not contained in the preceding one
+ * close off the last sublist
+ */
+ sublists.add(new Range(listStartIndex, i - 1));
+ listStartIndex = i;
+ }
+ lastEndPos = nextEnd;
+ }
+
+ sublists.add(new Range(listStartIndex, ranges.size() - 1));
+ return sublists;
+ }
+
+ /**
+ * Adds one entry to the stored set (with duplicates allowed)
+ *
+ * @param entry
+ */
+ public void add(T entry)
+ {
+ add(entry, true);
+ }
+
+ /**
+ * Adds one entry to the stored set, and returns true, unless allowDuplicates
+ * is set to false and it is already contained (by object equality test), in
+ * which case it is not added and this method returns false.
+ *
+ * @param entry
+ * @param allowDuplicates
+ * @return
+ */
+ public synchronized boolean add(T entry, boolean allowDuplicates)
+ {
+ if (!allowDuplicates && contains(entry))
+ {
+ return false;
+ }
+
+ size++;
+ long start = entry.getBegin();
+ long end = entry.getEnd();
+
+ /*
+ * cases:
+ * - precedes all subranges: add as NCNode on front of list
+ * - follows all subranges: add as NCNode on end of list
+ * - enclosed by a subrange - add recursively to subrange
+ * - encloses one or more subranges - push them inside it
+ * - none of the above - add as a new node and resort nodes list (?)
+ */
+
+ /*
+ * find the first subrange whose end does not precede entry's start
+ */
+ int candidateIndex = findFirstOverlap(start);
+ if (candidateIndex == -1)
+ {
+ /*
+ * all subranges precede this one - add it on the end
+ */
+ subranges.add(new NCNode<>(entry));
+ return true;
+ }
+
+ /*
+ * search for maximal span of subranges i-k that the new entry
+ * encloses; or a subrange that encloses the new entry
+ */
+ boolean enclosing = false;
+ int firstEnclosed = 0;
+ int lastEnclosed = 0;
+ boolean overlapping = false;
+
+ for (int j = candidateIndex; j < subranges.size(); j++)
+ {
+ NCNode<T> subrange = subranges.get(j);
+
+ if (end < subrange.getBegin() && !overlapping && !enclosing)
+ {
+ /*
+ * new entry lies between subranges j-1 j
+ */
+ subranges.add(j, new NCNode<>(entry));
+ return true;
+ }
+
+ if (subrange.getBegin() <= start && subrange.getEnd() >= end)
+ {
+ /*
+ * push new entry inside this subrange as it encloses it
+ */
+ subrange.add(entry);
+ return true;
+ }
+
+ if (start <= subrange.getBegin())
+ {
+ if (end >= subrange.getEnd())
+ {
+ /*
+ * new entry encloses this subrange (and possibly preceding ones);
+ * continue to find the maximal list it encloses
+ */
+ if (!enclosing)
+ {
+ firstEnclosed = j;
+ }
+ lastEnclosed = j;
+ enclosing = true;
+ continue;
+ }
+ else
+ {
+ /*
+ * entry spans from before this subrange to inside it
+ */
+ if (enclosing)
+ {
+ /*
+ * entry encloses one or more preceding subranges
+ */
+ addEnclosingRange(entry, firstEnclosed, lastEnclosed);
+ return true;
+ }
+ else
+ {
+ /*
+ * entry spans two subranges but doesn't enclose any
+ * so just add it
+ */
+ subranges.add(j, new NCNode<>(entry));
+ return true;
+ }
+ }
+ }
+ else
+ {
+ overlapping = true;
+ }
+ }
+
+ /*
+ * drops through to here if new range encloses all others
+ * or overlaps the last one
+ */
+ if (enclosing)
+ {
+ addEnclosingRange(entry, firstEnclosed, lastEnclosed);
+ }
+ else
+ {
+ subranges.add(new NCNode<>(entry));
+ }
+
+ return true;
+ }
+
+ /**
+ * Answers true if this NCList contains the given entry (by object equality
+ * test), else false
+ *
+ * @param entry
+ * @return
+ */
+ public boolean contains(T entry)
+ {
+ /*
+ * find the first sublist that might overlap, i.e.
+ * the first whose end position is >= from
+ */
+ int candidateIndex = findFirstOverlap(entry.getBegin());
+
+ if (candidateIndex == -1)
+ {
+ return false;
+ }
+
+ int to = entry.getEnd();
+
+ for (int i = candidateIndex; i < subranges.size(); i++)
+ {
+ NCNode<T> candidate = subranges.get(i);
+ if (candidate.getBegin() > to)
+ {
+ /*
+ * we are past the end of our target range
+ */
+ break;
+ }
+ if (candidate.contains(entry))
+ {
+ return true;
+ }
+ }
+ return false;
+ }
+
+ /**
+ * Update the tree so that the range of the new entry encloses subranges i to
+ * j (inclusive). That is, replace subranges i-j (inclusive) with a new
+ * subrange that contains them.
+ *
+ * @param entry
+ * @param i
+ * @param j
+ */
+ protected synchronized void addEnclosingRange(T entry, final int i,
+ final int j)
+ {
+ NCList<T> newNCList = new NCList<>();
+ newNCList.addNodes(subranges.subList(i, j + 1));
+ NCNode<T> newNode = new NCNode<>(entry, newNCList);
+ for (int k = j; k >= i; k--)
+ {
+ subranges.remove(k);
+ }
+ subranges.add(i, newNode);
+ }
+
+ protected void addNodes(List<NCNode<T>> nodes)
+ {
+ for (NCNode<T> node : nodes)
+ {
+ subranges.add(node);
+ size += node.size();
+ }
+ }
+
+ /**
+ * Returns a (possibly empty) list of items whose extent overlaps the given
+ * range
+ *
+ * @param from
+ * start of overlap range (inclusive)
+ * @param to
+ * end of overlap range (inclusive)
+ * @return
+ */
+ public List<T> findOverlaps(long from, long to)
+ {
+ List<T> result = new ArrayList<>();
+
+ findOverlaps(from, to, result);
+
+ return result;
+ }
+
+ /**
+ * Recursively searches the NCList adding any items that overlap the from-to
+ * range to the result list
+ *
+ * @param from
+ * @param to
+ * @param result
+ */
+ protected void findOverlaps(long from, long to, List<T> result)
+ {
+ /*
+ * find the first sublist that might overlap, i.e.
+ * the first whose end position is >= from
+ */
+ int candidateIndex = findFirstOverlap(from);
+
+ if (candidateIndex == -1)
+ {
+ return;
+ }
+
+ for (int i = candidateIndex; i < subranges.size(); i++)
+ {
+ NCNode<T> candidate = subranges.get(i);
+ if (candidate.getBegin() > to)
+ {
+ /*
+ * we are past the end of our target range
+ */
+ break;
+ }
+ candidate.findOverlaps(from, to, result);
+ }
+
+ }
+
+ /**
+ * Search subranges for the first one whose end position is not before the
+ * target range's start position, i.e. the first one that may overlap the
+ * target range. Returns the index in the list of the first such range found,
+ * or -1 if none found.
+ *
+ * @param from
+ * @return
+ */
+ protected int findFirstOverlap(long from)
+ {
+ /*
+ * The NCList paper describes binary search for this step,
+ * but this not implemented here as (a) I haven't understood it yet
+ * and (b) it seems to imply complications for adding to an NCList
+ */
+
+ int i = 0;
+ if (subranges != null)
+ {
+ for (NCNode<T> subrange : subranges)
+ {
+ if (subrange.getEnd() >= from)
+ {
+ return i;
+ }
+ i++;
+ }
+ }
+ return -1;
+ }
+
+ /**
+ * Formats the tree as a bracketed list e.g.
+ *
+ * <pre>
+ * [1-100 [10-30 [10-20]], 15-30 [20-20]]
+ * </pre>
+ */
+ @Override
+ public String toString()
+ {
+ return subranges.toString();
+ }
+
+ /**
+ * Returns a string representation of the data where containment is shown by
+ * indentation on new lines
+ *
+ * @return
+ */
+ public String prettyPrint()
+ {
+ StringBuilder sb = new StringBuilder(512);
+ int offset = 0;
+ int indent = 2;
+ prettyPrint(sb, offset, indent);
+ sb.append(System.lineSeparator());
+ return sb.toString();
+ }
+
+ /**
+ * @param sb
+ * @param offset
+ * @param indent
+ */
+ void prettyPrint(StringBuilder sb, int offset, int indent)
+ {
+ boolean first = true;
+ for (NCNode<T> subrange : subranges)
+ {
+ if (!first)
+ {
+ sb.append(System.lineSeparator());
+ }
+ first = false;
+ subrange.prettyPrint(sb, offset, indent);
+ }
+ }
+
+ /**
+ * Answers true if the data held satisfy the rules of construction of an
+ * NCList, else false.
+ *
+ * @return
+ */
+ public boolean isValid()
+ {
+ return isValid(Integer.MIN_VALUE, Integer.MAX_VALUE);
+ }
+
+ /**
+ * Answers true if the data held satisfy the rules of construction of an
+ * NCList bounded within the given start-end range, else false.
+ * <p>
+ * Each subrange must lie within start-end (inclusive). Subranges must be
+ * ordered by start position ascending.
+ * <p>
+ *
+ * @param start
+ * @param end
+ * @return
+ */
+ boolean isValid(final int start, final int end)
+ {
+ int lastStart = start;
+ for (NCNode<T> subrange : subranges)
+ {
+ if (subrange.getBegin() < lastStart)
+ {
+ System.err.println("error in NCList: range " + subrange.toString()
+ + " starts before " + lastStart);
+ return false;
+ }
+ if (subrange.getEnd() > end)
+ {
+ System.err.println("error in NCList: range " + subrange.toString()
+ + " ends after " + end);
+ return false;
+ }
+ lastStart = subrange.getBegin();
+
+ if (!subrange.isValid())
+ {
+ return false;
+ }
+ }
+ return true;
+ }
+
+ /**
+ * Answers the lowest start position enclosed by the ranges
+ *
+ * @return
+ */
+ public int getStart()
+ {
+ return subranges.isEmpty() ? 0 : subranges.get(0).getBegin();
+ }
+
+ /**
+ * Returns the number of ranges held (deep count)
+ *
+ * @return
+ */
+ public int size()
+ {
+ return size;
+ }
+
+ /**
+ * Returns a list of all entries stored
+ *
+ * @return
+ */
+ public List<T> getEntries()
+ {
+ List<T> result = new ArrayList<>();
+ getEntries(result);
+ return result;
+ }
+
+ /**
+ * Adds all contained entries to the given list
+ *
+ * @param result
+ */
+ void getEntries(List<T> result)
+ {
+ for (NCNode<T> subrange : subranges)
+ {
+ subrange.getEntries(result);
+ }
+ }
+
+ /**
+ * Deletes the given entry from the store, returning true if it was found (and
+ * deleted), else false. This method makes no assumption that the entry is in
+ * the 'expected' place in the store, in case it has been modified since it
+ * was added. Only the first 'same object' match is deleted, not 'equal' or
+ * multiple objects.
+ *
+ * @param entry
+ */
+ public synchronized boolean delete(T entry)
+ {
+ if (entry == null)
+ {
+ return false;
+ }
+ for (int i = 0; i < subranges.size(); i++)
+ {
+ NCNode<T> subrange = subranges.get(i);
+ NCList<T> subRegions = subrange.getSubRegions();
+
+ if (subrange.getRegion() == entry)
+ {
+ /*
+ * if the subrange is rooted on this entry, promote its
+ * subregions (if any) to replace the subrange here;
+ * NB have to resort subranges after doing this since e.g.
+ * [10-30 [12-20 [16-18], 13-19]]
+ * after deleting 12-20, 16-18 is promoted to sibling of 13-19
+ * but should follow it in the list of subranges of 10-30
+ */
+ subranges.remove(i);
+ if (subRegions != null)
+ {
+ subranges.addAll(subRegions.subranges);
+ Collections.sort(subranges, RangeComparator.BY_START_POSITION);
+ }
+ size--;
+ return true;
+ }
+ else
+ {
+ if (subRegions != null && subRegions.delete(entry))
+ {
+ size--;
+ subrange.deleteSubRegionsIfEmpty();
+ return true;
+ }
+ }
+ }
+ return false;
+ }
+}
--- /dev/null
+/*
+ * Jalview - A Sequence Alignment Editor and Viewer ($$Version-Rel$$)
+ * Copyright (C) $$Year-Rel$$ The Jalview Authors
+ *
+ * This file is part of Jalview.
+ *
+ * Jalview is free software: you can redistribute it and/or
+ * modify it under the terms of the GNU General Public License
+ * as published by the Free Software Foundation, either version 3
+ * of the License, or (at your option) any later version.
+ *
+ * Jalview is distributed in the hope that it will be useful, but
+ * WITHOUT ANY WARRANTY; without even the implied warranty
+ * of MERCHANTABILITY or FITNESS FOR A PARTICULAR
+ * PURPOSE. See the GNU General Public License for more details.
+ *
+ * You should have received a copy of the GNU General Public License
+ * along with Jalview. If not, see <http://www.gnu.org/licenses/>.
+ * The Jalview Authors are detailed in the 'AUTHORS' file.
+ */
+package jalview.datamodel.features;
+
+import jalview.datamodel.ContiguousI;
+
+import java.util.ArrayList;
+import java.util.List;
+
+/**
+ * Each node of the NCList tree consists of a range, and (optionally) the NCList
+ * of ranges it encloses
+ *
+ * @param <V>
+ */
+class NCNode<V extends ContiguousI> implements ContiguousI
+{
+ /*
+ * deep size (number of ranges included)
+ */
+ private int size;
+
+ private V region;
+
+ /*
+ * null, or an object holding contained subregions of this nodes region
+ */
+ private NCList<V> subregions;
+
+ /**
+ * Constructor given a list of ranges
+ *
+ * @param ranges
+ */
+ NCNode(List<V> ranges)
+ {
+ build(ranges);
+ }
+
+ /**
+ * Constructor given a single range
+ *
+ * @param range
+ */
+ NCNode(V range)
+ {
+ List<V> ranges = new ArrayList<>();
+ ranges.add(range);
+ build(ranges);
+ }
+
+ NCNode(V entry, NCList<V> newNCList)
+ {
+ region = entry;
+ subregions = newNCList;
+ size = 1 + newNCList.size();
+ }
+
+ /**
+ * @param ranges
+ */
+ protected void build(List<V> ranges)
+ {
+ size = ranges.size();
+
+ if (!ranges.isEmpty())
+ {
+ region = ranges.get(0);
+ }
+ if (ranges.size() > 1)
+ {
+ subregions = new NCList<V>(ranges.subList(1, ranges.size()));
+ }
+ }
+
+ @Override
+ public int getBegin()
+ {
+ return region.getBegin();
+ }
+
+ @Override
+ public int getEnd()
+ {
+ return region.getEnd();
+ }
+
+ /**
+ * Formats the node as a bracketed list e.g.
+ *
+ * <pre>
+ * [1-100 [10-30 [10-20]], 15-30 [20-20]]
+ * </pre>
+ */
+ @Override
+ public String toString() {
+ StringBuilder sb = new StringBuilder(10 * size);
+ sb.append(region.getBegin()).append("-").append(region.getEnd());
+ if (subregions != null)
+ {
+ sb.append(" ").append(subregions.toString());
+ }
+ return sb.toString();
+ }
+
+ void prettyPrint(StringBuilder sb, int offset, int indent) {
+ for (int i = 0 ; i < offset ; i++) {
+ sb.append(" ");
+ }
+ sb.append(region.getBegin()).append("-").append(region.getEnd());
+ if (subregions != null)
+ {
+ sb.append(System.lineSeparator());
+ subregions.prettyPrint(sb, offset + 2, indent);
+ }
+ }
+ /**
+ * Add any ranges that overlap the from-to range to the result list
+ *
+ * @param from
+ * @param to
+ * @param result
+ */
+ void findOverlaps(long from, long to, List<V> result)
+ {
+ if (region.getBegin() <= to && region.getEnd() >= from)
+ {
+ result.add(region);
+ }
+ if (subregions != null)
+ {
+ subregions.findOverlaps(from, to, result);
+ }
+ }
+
+ /**
+ * Add one range to this subrange
+ *
+ * @param entry
+ */
+ synchronized void add(V entry)
+ {
+ if (entry.getBegin() < region.getBegin() || entry.getEnd() > region.getEnd()) {
+ throw new IllegalArgumentException(String.format(
+ "adding improper subrange %d-%d to range %d-%d",
+ entry.getBegin(), entry.getEnd(), region.getBegin(),
+ region.getEnd()));
+ }
+ if (subregions == null)
+ {
+ subregions = new NCList<V>(entry);
+ }
+ else
+ {
+ subregions.add(entry);
+ }
+ size++;
+ }
+
+ /**
+ * Answers true if the data held satisfy the rules of construction of an
+ * NCList, else false.
+ *
+ * @return
+ */
+ boolean isValid()
+ {
+ /*
+ * we don't handle reverse ranges
+ */
+ if (region != null && region.getBegin() > region.getEnd())
+ {
+ return false;
+ }
+ if (subregions == null)
+ {
+ return true;
+ }
+ return subregions.isValid(getBegin(), getEnd());
+ }
+
+ /**
+ * Adds all contained entries to the given list
+ *
+ * @param entries
+ */
+ void getEntries(List<V> entries)
+ {
+ entries.add(region);
+ if (subregions != null)
+ {
+ subregions.getEntries(entries);
+ }
+ }
+
+ /**
+ * Answers true if this object contains the given entry (by object equals
+ * test), else false
+ *
+ * @param entry
+ * @return
+ */
+ boolean contains(V entry)
+ {
+ if (entry == null)
+ {
+ return false;
+ }
+ if (entry.equals(region))
+ {
+ return true;
+ }
+ return subregions == null ? false : subregions.contains(entry);
+ }
+
+ /**
+ * Answers the 'root' region modelled by this object
+ *
+ * @return
+ */
+ V getRegion()
+ {
+ return region;
+ }
+
+ /**
+ * Answers the (possibly null) contained regions within this object
+ *
+ * @return
+ */
+ NCList<V> getSubRegions()
+ {
+ return subregions;
+ }
+
+ /**
+ * Nulls the subregion reference if it is empty (after a delete entry
+ * operation)
+ */
+ void deleteSubRegionsIfEmpty()
+ {
+ if (subregions != null && subregions.size() == 0)
+ {
+ subregions = null;
+ }
+ }
+
+ /**
+ * Answers the (deep) size of this node i.e. the number of ranges it models
+ *
+ * @return
+ */
+ int size()
+ {
+ return size;
+ }
+}
--- /dev/null
+/*
+ * Jalview - A Sequence Alignment Editor and Viewer ($$Version-Rel$$)
+ * Copyright (C) $$Year-Rel$$ The Jalview Authors
+ *
+ * This file is part of Jalview.
+ *
+ * Jalview is free software: you can redistribute it and/or
+ * modify it under the terms of the GNU General Public License
+ * as published by the Free Software Foundation, either version 3
+ * of the License, or (at your option) any later version.
+ *
+ * Jalview is distributed in the hope that it will be useful, but
+ * WITHOUT ANY WARRANTY; without even the implied warranty
+ * of MERCHANTABILITY or FITNESS FOR A PARTICULAR
+ * PURPOSE. See the GNU General Public License for more details.
+ *
+ * You should have received a copy of the GNU General Public License
+ * along with Jalview. If not, see <http://www.gnu.org/licenses/>.
+ * The Jalview Authors are detailed in the 'AUTHORS' file.
+ */
+package jalview.datamodel.features;
+
+import jalview.datamodel.ContiguousI;
+
+import java.util.Comparator;
+
+/**
+ * A comparator that orders ranges by either start position or end position
+ * ascending. If the position matches, ordering is resolved by end position (or
+ * start position).
+ *
+ * @author gmcarstairs
+ *
+ */
+public class RangeComparator implements Comparator<ContiguousI>
+{
+ public static final Comparator<ContiguousI> BY_START_POSITION = new RangeComparator(
+ true);
+
+ public static final Comparator<ContiguousI> BY_END_POSITION = new RangeComparator(
+ false);
+
+ boolean byStart;
+
+ /**
+ * Constructor
+ *
+ * @param byStartPosition
+ * if true, order based on start position, if false by end position
+ */
+ RangeComparator(boolean byStartPosition)
+ {
+ byStart = byStartPosition;
+ }
+
+ @Override
+ public int compare(ContiguousI o1, ContiguousI o2)
+ {
+ int len1 = o1.getEnd() - o1.getBegin();
+ int len2 = o2.getEnd() - o2.getBegin();
+
+ if (byStart)
+ {
+ return compare(o1.getBegin(), o2.getBegin(), len1, len2);
+ }
+ else
+ {
+ return compare(o1.getEnd(), o2.getEnd(), len1, len2);
+ }
+ }
+
+ /**
+ * Compares two ranges for ordering
+ *
+ * @param pos1
+ * first range positional ordering criterion
+ * @param pos2
+ * second range positional ordering criterion
+ * @param len1
+ * first range length ordering criterion
+ * @param len2
+ * second range length ordering criterion
+ * @return
+ */
+ public int compare(long pos1, long pos2, int len1, int len2)
+ {
+ int order = Long.compare(pos1, pos2);
+ if (order == 0)
+ {
+ /*
+ * if tied on position order, longer length sorts to left
+ * i.e. the negation of normal ordering by length
+ */
+ order = -Integer.compare(len1, len2);
+ }
+ return order;
+ }
+}
--- /dev/null
+/*
+ * Jalview - A Sequence Alignment Editor and Viewer ($$Version-Rel$$)
+ * Copyright (C) $$Year-Rel$$ The Jalview Authors
+ *
+ * This file is part of Jalview.
+ *
+ * Jalview is free software: you can redistribute it and/or
+ * modify it under the terms of the GNU General Public License
+ * as published by the Free Software Foundation, either version 3
+ * of the License, or (at your option) any later version.
+ *
+ * Jalview is distributed in the hope that it will be useful, but
+ * WITHOUT ANY WARRANTY; without even the implied warranty
+ * of MERCHANTABILITY or FITNESS FOR A PARTICULAR
+ * PURPOSE. See the GNU General Public License for more details.
+ *
+ * You should have received a copy of the GNU General Public License
+ * along with Jalview. If not, see <http://www.gnu.org/licenses/>.
+ * The Jalview Authors are detailed in the 'AUTHORS' file.
+ */
+package jalview.datamodel.features;
+
+import jalview.datamodel.ContiguousI;
+import jalview.datamodel.SequenceFeature;
+import jalview.io.gff.SequenceOntologyFactory;
+import jalview.io.gff.SequenceOntologyI;
+
+import java.util.ArrayList;
+import java.util.Arrays;
+import java.util.Collections;
+import java.util.Comparator;
+import java.util.HashSet;
+import java.util.List;
+import java.util.Map;
+import java.util.Map.Entry;
+import java.util.Set;
+import java.util.TreeMap;
+
+/**
+ * A class that stores sequence features in a way that supports efficient
+ * querying by type and location (overlap). Intended for (but not limited to)
+ * storage of features for one sequence.
+ *
+ * @author gmcarstairs
+ *
+ */
+public class SequenceFeatures implements SequenceFeaturesI
+{
+ /**
+ * a comparator for sorting features by start position ascending
+ */
+ private static Comparator<ContiguousI> FORWARD_STRAND = new Comparator<ContiguousI>()
+ {
+ @Override
+ public int compare(ContiguousI o1, ContiguousI o2)
+ {
+ return Integer.compare(o1.getBegin(), o2.getBegin());
+ }
+ };
+
+ /**
+ * a comparator for sorting features by end position descending
+ */
+ private static Comparator<ContiguousI> REVERSE_STRAND = new Comparator<ContiguousI>()
+ {
+ @Override
+ public int compare(ContiguousI o1, ContiguousI o2)
+ {
+ return Integer.compare(o2.getEnd(), o1.getEnd());
+ }
+ };
+
+ /*
+ * map from feature type to structured store of features for that type
+ * null types are permitted (but not a good idea!)
+ */
+ private Map<String, FeatureStore> featureStore;
+
+ /**
+ * Constructor
+ */
+ public SequenceFeatures()
+ {
+ /*
+ * use a TreeMap so that features are returned in alphabetical order of type
+ * ? wrap as a synchronized map for add and delete operations
+ */
+ // featureStore = Collections
+ // .synchronizedSortedMap(new TreeMap<String, FeatureStore>());
+ featureStore = new TreeMap<String, FeatureStore>();
+ }
+
+ /**
+ * Constructor given a list of features
+ */
+ public SequenceFeatures(List<SequenceFeature> features)
+ {
+ this();
+ if (features != null)
+ {
+ for (SequenceFeature feature : features)
+ {
+ add(feature);
+ }
+ }
+ }
+
+ /**
+ * {@inheritDoc}
+ */
+ @Override
+ public boolean add(SequenceFeature sf)
+ {
+ String type = sf.getType();
+ if (type == null)
+ {
+ System.err.println("Feature type may not be null: " + sf.toString());
+ return false;
+ }
+
+ if (featureStore.get(type) == null)
+ {
+ featureStore.put(type, new FeatureStore());
+ }
+ return featureStore.get(type).addFeature(sf);
+ }
+
+ /**
+ * {@inheritDoc}
+ */
+ @Override
+ public List<SequenceFeature> findFeatures(int from, int to,
+ String... type)
+ {
+ List<SequenceFeature> result = new ArrayList<>();
+
+ for (FeatureStore featureSet : varargToTypes(type))
+ {
+ result.addAll(featureSet.findOverlappingFeatures(from, to));
+ }
+
+ return result;
+ }
+
+ /**
+ * {@inheritDoc}
+ */
+ @Override
+ public List<SequenceFeature> getAllFeatures(String... type)
+ {
+ List<SequenceFeature> result = new ArrayList<>();
+
+ result.addAll(getPositionalFeatures(type));
+
+ result.addAll(getNonPositionalFeatures());
+
+ return result;
+ }
+
+ /**
+ * {@inheritDoc}
+ */
+ @Override
+ public List<SequenceFeature> getFeaturesByOntology(String... ontologyTerm)
+ {
+ if (ontologyTerm == null || ontologyTerm.length == 0)
+ {
+ return new ArrayList<>();
+ }
+
+ Set<String> featureTypes = getFeatureTypes(ontologyTerm);
+ if (featureTypes.isEmpty())
+ {
+ /*
+ * no features of the specified type or any sub-type
+ */
+ return new ArrayList<>();
+ }
+
+ return getAllFeatures(featureTypes.toArray(new String[featureTypes
+ .size()]));
+ }
+
+ /**
+ * {@inheritDoc}
+ */
+ @Override
+ public int getFeatureCount(boolean positional, String... type)
+ {
+ int result = 0;
+
+ for (FeatureStore featureSet : varargToTypes(type))
+ {
+ result += featureSet.getFeatureCount(positional);
+ }
+ return result;
+ }
+
+ /**
+ * {@inheritDoc}
+ */
+ @Override
+ public int getTotalFeatureLength(String... type)
+ {
+ int result = 0;
+
+ for (FeatureStore featureSet : varargToTypes(type))
+ {
+ result += featureSet.getTotalFeatureLength();
+ }
+ return result;
+ }
+
+ /**
+ * {@inheritDoc}
+ */
+ @Override
+ public List<SequenceFeature> getPositionalFeatures(String... type)
+ {
+ List<SequenceFeature> result = new ArrayList<>();
+
+ for (FeatureStore featureSet : varargToTypes(type))
+ {
+ result.addAll(featureSet.getPositionalFeatures());
+ }
+ return result;
+ }
+
+ /**
+ * A convenience method that converts a vararg for feature types to an
+ * Iterable over matched feature sets in key order
+ *
+ * @param type
+ * @return
+ */
+ protected Iterable<FeatureStore> varargToTypes(String... type)
+ {
+ if (type == null || type.length == 0)
+ {
+ /*
+ * no vararg parameter supplied - return all
+ */
+ return featureStore.values();
+ }
+
+ List<FeatureStore> types = new ArrayList<>();
+ List<String> args = Arrays.asList(type);
+ for (Entry<String, FeatureStore> featureType : featureStore.entrySet())
+ {
+ if (args.contains(featureType.getKey()))
+ {
+ types.add(featureType.getValue());
+ }
+ }
+ return types;
+ }
+
+ /**
+ * {@inheritDoc}
+ */
+ @Override
+ public List<SequenceFeature> getContactFeatures(String... type)
+ {
+ List<SequenceFeature> result = new ArrayList<>();
+
+ for (FeatureStore featureSet : varargToTypes(type))
+ {
+ result.addAll(featureSet.getContactFeatures());
+ }
+ return result;
+ }
+
+ /**
+ * {@inheritDoc}
+ */
+ @Override
+ public List<SequenceFeature> getNonPositionalFeatures(String... type)
+ {
+ List<SequenceFeature> result = new ArrayList<>();
+
+ for (FeatureStore featureSet : varargToTypes(type))
+ {
+ result.addAll(featureSet.getNonPositionalFeatures());
+ }
+ return result;
+ }
+
+ /**
+ * {@inheritDoc}
+ */
+ @Override
+ public boolean delete(SequenceFeature sf)
+ {
+ for (FeatureStore featureSet : featureStore.values())
+ {
+ if (featureSet.delete(sf))
+ {
+ return true;
+ }
+ }
+ return false;
+ }
+
+ /**
+ * {@inheritDoc}
+ */
+ @Override
+ public boolean hasFeatures()
+ {
+ for (FeatureStore featureSet : featureStore.values())
+ {
+ if (!featureSet.isEmpty())
+ {
+ return true;
+ }
+ }
+ return false;
+ }
+
+ /**
+ * {@inheritDoc}
+ */
+ @Override
+ public Set<String> getFeatureGroups(boolean positionalFeatures,
+ String... type)
+ {
+ Set<String> groups = new HashSet<>();
+
+ for (FeatureStore featureSet : varargToTypes(type))
+ {
+ groups.addAll(featureSet.getFeatureGroups(positionalFeatures));
+ }
+
+ return groups;
+ }
+
+ /**
+ * {@inheritDoc}
+ */
+ @Override
+ public Set<String> getFeatureTypesForGroups(boolean positionalFeatures,
+ String... groups)
+ {
+ Set<String> result = new HashSet<>();
+
+ for (Entry<String, FeatureStore> featureType : featureStore.entrySet())
+ {
+ Set<String> featureGroups = featureType.getValue().getFeatureGroups(
+ positionalFeatures);
+ for (String group : groups)
+ {
+ if (featureGroups.contains(group))
+ {
+ /*
+ * yes this feature type includes one of the query groups
+ */
+ result.add(featureType.getKey());
+ break;
+ }
+ }
+ }
+
+ return result;
+ }
+
+ /**
+ * {@inheritDoc}
+ */
+ @Override
+ public Set<String> getFeatureTypes(String... soTerm)
+ {
+ Set<String> types = new HashSet<>();
+ for (Entry<String, FeatureStore> entry : featureStore.entrySet())
+ {
+ String type = entry.getKey();
+ if (!entry.getValue().isEmpty() && isOntologyTerm(type, soTerm))
+ {
+ types.add(type);
+ }
+ }
+ return types;
+ }
+
+ /**
+ * Answers true if the given type is one of the specified sequence ontology
+ * terms (or a sub-type of one), or if no terms are supplied. Answers false if
+ * filter terms are specified and the given term does not match any of them.
+ *
+ * @param type
+ * @param soTerm
+ * @return
+ */
+ protected boolean isOntologyTerm(String type, String... soTerm)
+ {
+ if (soTerm == null || soTerm.length == 0)
+ {
+ return true;
+ }
+ SequenceOntologyI so = SequenceOntologyFactory.getInstance();
+ for (String term : soTerm)
+ {
+ if (so.isA(type, term))
+ {
+ return true;
+ }
+ }
+ return false;
+ }
+
+ /**
+ * {@inheritDoc}
+ */
+ @Override
+ public float getMinimumScore(String type, boolean positional)
+ {
+ return featureStore.containsKey(type) ? featureStore.get(type)
+ .getMinimumScore(positional) : Float.NaN;
+ }
+
+ /**
+ * {@inheritDoc}
+ */
+ @Override
+ public float getMaximumScore(String type, boolean positional)
+ {
+ return featureStore.containsKey(type) ? featureStore.get(type)
+ .getMaximumScore(positional) : Float.NaN;
+ }
+
+ /**
+ * A convenience method to sort features by start position ascending (if on
+ * forward strand), or end position descending (if on reverse strand)
+ *
+ * @param features
+ * @param forwardStrand
+ */
+ public static void sortFeatures(List<SequenceFeature> features,
+ final boolean forwardStrand)
+ {
+ Collections.sort(features, forwardStrand ? FORWARD_STRAND
+ : REVERSE_STRAND);
+ }
+
+ /**
+ * {@inheritDoc} This method is 'semi-optimised': it only inspects features
+ * for types that include the specified group, but has to inspect every
+ * feature of those types for matching feature group. This is efficient unless
+ * a sequence has features that share the same type but are in different
+ * groups - an unlikely case.
+ * <p>
+ * For example, if RESNUM feature is created with group = PDBID, then features
+ * would only be retrieved for those sequences associated with the target
+ * PDBID (group).
+ */
+ @Override
+ public List<SequenceFeature> getFeaturesForGroup(boolean positional,
+ String group, String... type)
+ {
+ List<SequenceFeature> result = new ArrayList<>();
+ for (FeatureStore featureSet : varargToTypes(type))
+ {
+ if (featureSet.getFeatureGroups(positional).contains(group))
+ {
+ result.addAll(featureSet.getFeaturesForGroup(positional, group));
+ }
+ }
+ return result;
+ }
+
+ /**
+ * {@inheritDoc}
+ */
+ @Override
+ public boolean shiftFeatures(int shift)
+ {
+ boolean modified = false;
+ for (FeatureStore fs : featureStore.values())
+ {
+ modified |= fs.shiftFeatures(shift);
+ }
+ return modified;
+ }
+}
\ No newline at end of file
--- /dev/null
+/*
+ * Jalview - A Sequence Alignment Editor and Viewer ($$Version-Rel$$)
+ * Copyright (C) $$Year-Rel$$ The Jalview Authors
+ *
+ * This file is part of Jalview.
+ *
+ * Jalview is free software: you can redistribute it and/or
+ * modify it under the terms of the GNU General Public License
+ * as published by the Free Software Foundation, either version 3
+ * of the License, or (at your option) any later version.
+ *
+ * Jalview is distributed in the hope that it will be useful, but
+ * WITHOUT ANY WARRANTY; without even the implied warranty
+ * of MERCHANTABILITY or FITNESS FOR A PARTICULAR
+ * PURPOSE. See the GNU General Public License for more details.
+ *
+ * You should have received a copy of the GNU General Public License
+ * along with Jalview. If not, see <http://www.gnu.org/licenses/>.
+ * The Jalview Authors are detailed in the 'AUTHORS' file.
+ */
+package jalview.datamodel.features;
+
+import jalview.datamodel.SequenceFeature;
+
+import java.util.List;
+import java.util.Set;
+
+public interface SequenceFeaturesI
+{
+
+ /**
+ * Adds one sequence feature to the store, and returns true, unless the
+ * feature is already contained in the store, in which case this method
+ * returns false. Containment is determined by SequenceFeature.equals()
+ * comparison. Answers false, and does not add the feature, if feature type is
+ * null.
+ *
+ * @param sf
+ */
+ boolean add(SequenceFeature sf);
+
+ /**
+ * Returns a (possibly empty) list of features, optionally restricted to
+ * specified types, which overlap the given (inclusive) sequence position
+ * range
+ *
+ * @param from
+ * @param to
+ * @param type
+ * @return
+ */
+ List<SequenceFeature> findFeatures(int from, int to,
+ String... type);
+
+ /**
+ * Answers a list of all features stored, in no particular guaranteed order.
+ * Positional features may optionally be restricted to specified types, but
+ * all non-positional features (if any) are always returned.
+ * <p>
+ * To filter non-positional features by type, use
+ * getNonPositionalFeatures(type).
+ *
+ * @param type
+ * @return
+ */
+ List<SequenceFeature> getAllFeatures(String... type);
+
+ /**
+ * Answers a list of all positional (or non-positional) features which are in
+ * the specified feature group, optionally restricted to features of specified
+ * types.
+ *
+ * @param positional
+ * if true returns positional features, else non-positional features
+ * @param group
+ * the feature group to be matched (which may be null)
+ * @param type
+ * optional feature types to filter by
+ * @return
+ */
+ List<SequenceFeature> getFeaturesForGroup(boolean positional,
+ String group, String... type);
+
+ /**
+ * Answers a list of all features stored, whose type either matches one of the
+ * given ontology terms, or is a specialisation of a term in the Sequence
+ * Ontology. Results are returned in no particular guaranteed order.
+ *
+ * @param ontologyTerm
+ * @return
+ */
+ List<SequenceFeature> getFeaturesByOntology(String... ontologyTerm);
+
+ /**
+ * Answers the number of (positional or non-positional) features, optionally
+ * restricted to specified feature types. Contact features are counted as 1.
+ *
+ * @param positional
+ * @param type
+ * @return
+ */
+ int getFeatureCount(boolean positional, String... type);
+
+ /**
+ * Answers the total length of positional features, optionally restricted to
+ * specified feature types. Contact features are counted as length 1.
+ *
+ * @param type
+ * @return
+ */
+ int getTotalFeatureLength(String... type);
+
+ /**
+ * Answers a list of all positional features, optionally restricted to
+ * specified types, in no particular guaranteed order
+ *
+ * @param type
+ * @return
+ */
+ List<SequenceFeature> getPositionalFeatures(
+ String... type);
+
+ /**
+ * Answers a list of all contact features, optionally restricted to specified
+ * types, in no particular guaranteed order
+ *
+ * @return
+ */
+ List<SequenceFeature> getContactFeatures(String... type);
+
+ /**
+ * Answers a list of all non-positional features, optionally restricted to
+ * specified types, in no particular guaranteed order
+ *
+ * @param type
+ * if no type is specified, all are returned
+ * @return
+ */
+ List<SequenceFeature> getNonPositionalFeatures(
+ String... type);
+
+ /**
+ * Deletes the given feature from the store, returning true if it was found
+ * (and deleted), else false. This method makes no assumption that the feature
+ * is in the 'expected' place in the store, in case it has been modified since
+ * it was added.
+ *
+ * @param sf
+ */
+ boolean delete(SequenceFeature sf);
+
+ /**
+ * Answers true if this store contains at least one feature, else false
+ *
+ * @return
+ */
+ boolean hasFeatures();
+
+ /**
+ * Returns a set of the distinct feature groups present in the collection. The
+ * set may include null. The boolean parameter determines whether the groups
+ * for positional or for non-positional features are returned. The optional
+ * type parameter may be used to restrict to groups for specified feature
+ * types.
+ *
+ * @param positionalFeatures
+ * @param type
+ * @return
+ */
+ Set<String> getFeatureGroups(boolean positionalFeatures,
+ String... type);
+
+ /**
+ * Answers the set of distinct feature types for which there is at least one
+ * feature with one of the given feature group(s). The boolean parameter
+ * determines whether the groups for positional or for non-positional features
+ * are returned.
+ *
+ * @param positionalFeatures
+ * @param groups
+ * @return
+ */
+ Set<String> getFeatureTypesForGroups(
+ boolean positionalFeatures, String... groups);
+
+ /**
+ * Answers a set of the distinct feature types for which a feature is stored.
+ * The types may optionally be restricted to those which match, or are a
+ * subtype of, given sequence ontology terms
+ *
+ * @return
+ */
+ Set<String> getFeatureTypes(String... soTerm);
+
+ /**
+ * Answers the minimum score held for positional or non-positional features
+ * for the specified type. This may be Float.NaN if there are no features, or
+ * none has a non-NaN score.
+ *
+ * @param type
+ * @param positional
+ * @return
+ */
+ float getMinimumScore(String type, boolean positional);
+
+ /**
+ * Answers the maximum score held for positional or non-positional features
+ * for the specified type. This may be Float.NaN if there are no features, or
+ * none has a non-NaN score.
+ *
+ * @param type
+ * @param positional
+ * @return
+ */
+ float getMaximumScore(String type, boolean positional);
+
+ /**
+ * Adds the shift amount to the start and end of all positional features,
+ * returning true if at least one feature was shifted, else false
+ *
+ * @param shift
+ */
+ abstract boolean shiftFeatures(int shift);
+}
\ No newline at end of file
System.err.println(
"Implementation Notice: EMBLCDS records not properly supported yet - Making up the CDNA region of this sequence... may be incorrect ("
+ sourceDb + ":" + getAccession() + ")");
- if (translationLength
- * 3 == (1 - codonStart + dna.getSequence().length))
+ int dnaLength = dna.getLength();
+ if (translationLength * 3 == (1 - codonStart + dnaLength))
{
System.err.println(
"Not allowing for additional stop codon at end of cDNA fragment... !");
new int[]
{ 1, translationLength }, 3, 1);
}
- if ((translationLength + 1)
- * 3 == (1 - codonStart + dna.getSequence().length))
+ if ((translationLength + 1) * 3 == (1 - codonStart + dnaLength))
{
System.err.println(
"Allowing for additional stop codon at end of cDNA fragment... will probably cause an error in VAMSAs!");
/*
* add cds features to dna sequence
*/
- for (int xint = 0; exons != null && xint < exons.length; xint += 2)
+ String cds = feature.getName(); // "CDS"
+ for (int xint = 0; exons != null && xint < exons.length - 1; xint += 2)
{
- SequenceFeature sf = makeCdsFeature(exons, xint, proteinName,
- proteinId, vals, codonStart);
- sf.setType(feature.getName()); // "CDS"
+ int exonStart = exons[xint];
+ int exonEnd = exons[xint + 1];
+ int begin = Math.min(exonStart, exonEnd);
+ int end = Math.max(exonStart, exonEnd);
+ int exonNumber = xint / 2 + 1;
+ String desc = String.format("Exon %d for protein '%s' EMBLCDS:%s",
+ exonNumber, proteinName, proteinId);
+
+ SequenceFeature sf = makeCdsFeature(cds, desc, begin, end,
+ sourceDb, vals);
+
sf.setEnaLocation(feature.getLocation());
- sf.setFeatureGroup(sourceDb);
+ boolean forwardStrand = exonStart <= exonEnd;
+ sf.setStrand(forwardStrand ? "+" : "-");
+ sf.setPhase(String.valueOf(codonStart - 1));
+ sf.setValue(FeatureProperties.EXONPOS, exonNumber);
+ sf.setValue(FeatureProperties.EXONPRODUCT, proteinName);
+
dna.addSequenceFeature(sf);
}
}
/**
* Helper method to construct a SequenceFeature for one cds range
*
- * @param exons
- * array of cds [start, end, ...] positions
- * @param exonStartIndex
- * offset into the exons array
- * @param proteinName
- * @param proteinAccessionId
+ * @param type
+ * feature type ("CDS")
+ * @param desc
+ * description
+ * @param begin
+ * start position
+ * @param end
+ * end position
+ * @param group
+ * feature group
* @param vals
* map of 'miscellaneous values' for feature
- * @param codonStart
- * codon start position for CDS (1/2/3, normally 1)
* @return
*/
- protected SequenceFeature makeCdsFeature(int[] exons, int exonStartIndex,
- String proteinName, String proteinAccessionId,
- Map<String, String> vals, int codonStart)
- {
- int exonNumber = exonStartIndex / 2 + 1;
- SequenceFeature sf = new SequenceFeature();
- sf.setBegin(Math.min(exons[exonStartIndex], exons[exonStartIndex + 1]));
- sf.setEnd(Math.max(exons[exonStartIndex], exons[exonStartIndex + 1]));
- sf.setDescription(String.format("Exon %d for protein '%s' EMBLCDS:%s",
- exonNumber, proteinName, proteinAccessionId));
- sf.setPhase(String.valueOf(codonStart - 1));
- sf.setStrand(
- exons[exonStartIndex] <= exons[exonStartIndex + 1] ? "+" : "-");
- sf.setValue(FeatureProperties.EXONPOS, exonNumber);
- sf.setValue(FeatureProperties.EXONPRODUCT, proteinName);
+ protected SequenceFeature makeCdsFeature(String type, String desc,
+ int begin, int end, String group, Map<String, String> vals)
+ {
+ SequenceFeature sf = new SequenceFeature(type, desc, begin, end, group);
if (!vals.isEmpty())
{
StringBuilder sb = new StringBuilder();
* along with Jalview. If not, see <http://www.gnu.org/licenses/>.
* The Jalview Authors are detailed in the 'AUTHORS' file.
*/
-package jalview.datamodel;
+package jalview.datamodel.xdb.uniprot;
+
+import jalview.datamodel.PDBEntry;
import java.util.Vector;
Vector<String> accession;
- Vector<SequenceFeature> feature;
+ Vector<UniprotFeature> feature;
Vector<PDBEntry> dbrefs;
accession = items;
}
- public void setFeature(Vector<SequenceFeature> items)
+ public void setFeature(Vector<UniprotFeature> items)
{
feature = items;
}
- public Vector<SequenceFeature> getFeature()
+ public Vector<UniprotFeature> getFeature()
{
return feature;
}
--- /dev/null
+/*
+ * Jalview - A Sequence Alignment Editor and Viewer ($$Version-Rel$$)
+ * Copyright (C) $$Year-Rel$$ The Jalview Authors
+ *
+ * This file is part of Jalview.
+ *
+ * Jalview is free software: you can redistribute it and/or
+ * modify it under the terms of the GNU General Public License
+ * as published by the Free Software Foundation, either version 3
+ * of the License, or (at your option) any later version.
+ *
+ * Jalview is distributed in the hope that it will be useful, but
+ * WITHOUT ANY WARRANTY; without even the implied warranty
+ * of MERCHANTABILITY or FITNESS FOR A PARTICULAR
+ * PURPOSE. See the GNU General Public License for more details.
+ *
+ * You should have received a copy of the GNU General Public License
+ * along with Jalview. If not, see <http://www.gnu.org/licenses/>.
+ * The Jalview Authors are detailed in the 'AUTHORS' file.
+ */
+package jalview.datamodel.xdb.uniprot;
+
+/**
+ * A data model class for binding from Uniprot XML via uniprot_mapping.xml
+ */
+public class UniprotFeature
+{
+ private String type;
+
+ private String description;
+
+ private String status;
+
+ private int begin;
+
+ private int end;
+
+ public String getType()
+ {
+ return type;
+ }
+
+ public void setType(String t)
+ {
+ this.type = t;
+ }
+
+ public String getDescription()
+ {
+ return description;
+ }
+
+ public void setDescription(String d)
+ {
+ this.description = d;
+ }
+
+ public String getStatus()
+ {
+ return status;
+ }
+
+ public void setStatus(String s)
+ {
+ this.status = s;
+ }
+
+ public int getBegin()
+ {
+ return begin;
+ }
+
+ public void setBegin(int b)
+ {
+ this.begin = b;
+ }
+
+ public int getEnd()
+ {
+ return end;
+ }
+
+ public void setEnd(int e)
+ {
+ this.end = e;
+ }
+
+ public int getPosition()
+ {
+ return begin;
+ }
+
+ public void setPosition(int p)
+ {
+ this.begin = p;
+ this.end = p;
+ }
+}
* along with Jalview. If not, see <http://www.gnu.org/licenses/>.
* The Jalview Authors are detailed in the 'AUTHORS' file.
*/
-package jalview.datamodel;
+package jalview.datamodel.xdb.uniprot;
import java.util.Vector;
* along with Jalview. If not, see <http://www.gnu.org/licenses/>.
* The Jalview Authors are detailed in the 'AUTHORS' file.
*/
-package jalview.datamodel;
+package jalview.datamodel.xdb.uniprot;
import java.util.Vector;
* along with Jalview. If not, see <http://www.gnu.org/licenses/>.
* The Jalview Authors are detailed in the 'AUTHORS' file.
*/
-package jalview.datamodel;
+package jalview.datamodel.xdb.uniprot;
/**
* Data model for the sequence returned by a Uniprot query
import jalview.io.gff.SequenceOntologyFactory;
import jalview.io.gff.SequenceOntologyI;
+import java.util.HashMap;
+import java.util.Map;
+
import com.stevesoft.pat.Regex;
/**
private static final Regex ACCESSION_REGEX = new Regex(
"(ENS([A-Z]{3}|)[TG][0-9]{11}$)" + "|" + "(CCDS[0-9.]{3,}$)");
+ private static Map<String, String> params = new HashMap<String, String>();
+
+ static
+ {
+ params.put("object_type", "transcript");
+ }
+
/*
* fetch exon features on genomic sequence (to identify the cdna regions)
* and cds and variation features (to retain)
return false;
}
+ /**
+ * Parameter object_type=cdna added to ensure cdna and not peptide is returned
+ * (JAL-2529)
+ */
+ @Override
+ protected Map<String, String> getAdditionalParameters()
+ {
+ return params;
+ }
+
}
import jalview.datamodel.Sequence;
import jalview.datamodel.SequenceFeature;
import jalview.datamodel.SequenceI;
+import jalview.datamodel.features.SequenceFeatures;
import jalview.io.gff.SequenceOntologyFactory;
import jalview.io.gff.SequenceOntologyI;
import jalview.schemes.FeatureColour;
}
/**
- * Converts a query, which may contain one or more gene or transcript
- * identifiers, into a non-redundant list of gene identifiers.
+ * Converts a query, which may contain one or more gene, transcript, or
+ * external (to Ensembl) identifiers, into a non-redundant list of gene
+ * identifiers.
*
* @param accessions
* @return
for (String acc : accessions.split(getAccessionSeparator()))
{
- if (isGeneIdentifier(acc))
- {
- if (!geneIds.contains(acc))
- {
- geneIds.add(acc);
- }
- }
-
/*
- * if given a transcript id, look up its gene parent
+ * First try lookup as an Ensembl (gene or transcript) identifier
*/
- else if (isTranscriptIdentifier(acc))
+ String geneId = new EnsemblLookup(getDomain()).getGeneId(acc);
+ if (geneId != null)
{
- String geneId = new EnsemblLookup(getDomain()).getParent(acc);
- if (geneId != null && !geneIds.contains(geneId))
+ if (!geneIds.contains(geneId))
{
geneIds.add(geneId);
}
}
- else if (isProteinIdentifier(acc))
- {
- String tscriptId = new EnsemblLookup(getDomain()).getParent(acc);
- if (tscriptId != null)
- {
- String geneId = new EnsemblLookup(getDomain())
- .getParent(tscriptId);
-
- if (geneId != null && !geneIds.contains(geneId))
- {
- geneIds.add(geneId);
- }
- }
- // NOTE - acc is lost if it resembles an ENS.+ ID but isn't actually
- // resolving to one... e.g. ENSMICP00000009241
- }
- /*
- * if given a gene or other external name, lookup and fetch
- * the corresponding gene for all model organisms
- */
else
{
+ /*
+ * if given a gene or other external name, lookup and fetch
+ * the corresponding gene for all model organisms
+ */
List<String> ids = new EnsemblSymbol(getDomain(), getDbSource(),
- getDbVersion()).getIds(acc);
- for (String geneId : ids)
+ getDbVersion()).getGeneIds(acc);
+ for (String id : ids)
{
- if (!geneIds.contains(geneId))
+ if (!geneIds.contains(id))
{
- geneIds.add(geneId);
+ geneIds.add(id);
}
}
}
}
/**
- * Attempts to get Ensembl stable identifiers for model organisms for a gene
- * name by calling the xrefs symbol REST service to resolve the gene name.
- *
- * @param query
- * @return
- */
- protected String getGeneIdentifiersForName(String query)
- {
- List<String> ids = new EnsemblSymbol(getDomain(), getDbSource(),
- getDbVersion()).getIds(query);
- if (ids != null)
- {
- for (String id : ids)
- {
- if (isGeneIdentifier(id))
- {
- return id;
- }
- }
- }
- return null;
- }
-
- /**
* Constructs all transcripts for the gene, as identified by "transcript"
* features whose Parent is the requested gene. The coding transcript
* sequences (i.e. with introns omitted) are added to the alignment.
*/
protected void clearGeneFeatures(SequenceI gene)
{
- SequenceFeature[] sfs = gene.getSequenceFeatures();
- if (sfs != null)
+ /*
+ * Note we include NMD_transcript_variant here because it behaves like
+ * 'transcript' in Ensembl, although strictly speaking it is not
+ * (it is a sub-type of sequence_variant)
+ */
+ String[] soTerms = new String[] {
+ SequenceOntologyI.NMD_TRANSCRIPT_VARIANT,
+ SequenceOntologyI.TRANSCRIPT, SequenceOntologyI.EXON,
+ SequenceOntologyI.CDS };
+ List<SequenceFeature> sfs = gene.getFeatures().getFeaturesByOntology(
+ soTerms);
+ for (SequenceFeature sf : sfs)
{
- SequenceOntologyI so = SequenceOntologyFactory.getInstance();
- List<SequenceFeature> filtered = new ArrayList<SequenceFeature>();
- for (SequenceFeature sf : sfs)
- {
- String type = sf.getType();
- if (!isTranscript(type) && !so.isA(type, SequenceOntologyI.EXON)
- && !so.isA(type, SequenceOntologyI.CDS))
- {
- filtered.add(sf);
- }
- }
- gene.setSequenceFeatures(
- filtered.toArray(new SequenceFeature[filtered.size()]));
+ gene.deleteFeature(sf);
}
}
{
splices = findFeatures(gene, SequenceOntologyI.CDS, parentId);
}
+ SequenceFeatures.sortFeatures(splices, true);
int transcriptLength = 0;
final char[] geneChars = gene.getSequence();
mapTo.add(new int[] { 1, transcriptLength });
MapList mapping = new MapList(mappedFrom, mapTo, 1, 1);
EnsemblCdna cdna = new EnsemblCdna(getDomain());
- cdna.transferFeatures(gene.getSequenceFeatures(),
+ cdna.transferFeatures(gene.getFeatures().getPositionalFeatures(),
transcript.getDatasetSequence(), mapping, parentId);
/*
/**
* Returns a list of the transcript features on the sequence whose Parent is
* the gene for the accession id.
+ * <p>
+ * Transcript features are those of type "transcript", or any of its sub-types
+ * in the Sequence Ontology e.g. "mRNA", "processed_transcript". We also
+ * include "NMD_transcript_variant", because this type behaves like a
+ * transcript identifier in Ensembl, although strictly speaking it is not in
+ * the SO.
*
* @param accId
* @param geneSequence
List<SequenceFeature> transcriptFeatures = new ArrayList<SequenceFeature>();
String parentIdentifier = GENE_PREFIX + accId;
- SequenceFeature[] sfs = geneSequence.getSequenceFeatures();
- if (sfs != null)
+ List<SequenceFeature> sfs = geneSequence.getFeatures()
+ .getFeaturesByOntology(SequenceOntologyI.TRANSCRIPT);
+ sfs.addAll(geneSequence.getFeatures().getPositionalFeatures(
+ SequenceOntologyI.NMD_TRANSCRIPT_VARIANT));
+
+ for (SequenceFeature sf : sfs)
{
- for (SequenceFeature sf : sfs)
+ String parent = (String) sf.getValue(PARENT);
+ if (parentIdentifier.equals(parent))
{
- if (isTranscript(sf.getType()))
- {
- String parent = (String) sf.getValue(PARENT);
- if (parentIdentifier.equals(parent))
- {
- transcriptFeatures.add(sf);
- }
- }
+ transcriptFeatures.add(sf);
}
}
}
@Override
- public boolean isGeneIdentifier(String query)
- {
- return true;
- }
-
- @Override
public String getDbName()
{
return "EnsemblGenomes";
@Override
public String getTestQuery()
{
- return "DDB_G0283883";
+ /*
+ * Salmonella gene, Uniprot Q8Z9G6, EMBLCDS CAD01290
+ */
+ return "CAD01290";
}
@Override
// flag set to true if REST major version is not the one expected
boolean restMajorVersionMismatch;
- /*
- * absolute time to wait till if we overloaded the REST service
- */
- long retryAfter;
-
/**
* Constructor given expected REST version number e.g 4.5 or 3.4.3
*
public class EnsemblLookup extends EnsemblRestClient
{
+ private static final String OBJECT_TYPE_TRANSLATION = "Translation";
+ private static final String PARENT = "Parent";
+ private static final String OBJECT_TYPE_TRANSCRIPT = "Transcript";
+ private static final String ID = "id";
+ private static final String OBJECT_TYPE_GENE = "Gene";
+ private static final String OBJECT_TYPE = "object_type";
+
/**
* Default constructor (to use rest.ensembl.org)
*/
protected URL getUrl(String identifier)
{
String url = getDomain() + "/lookup/id/" + identifier
- + "?content-type=application/json";
+ + CONTENT_TYPE_JSON;
try
{
return new URL(url);
* @param identifier
* @return
*/
- public String getParent(String identifier)
+ public String getGeneId(String identifier)
{
List<String> ids = Arrays.asList(new String[] { identifier });
{
br = getHttpResponse(url, ids);
}
- return (parseResponse(br));
+ return br == null ? null : parseResponse(br);
} catch (IOException e)
{
// ignore
}
/**
- * Parses "Parent" from the JSON response and returns the value, or null if
- * not found
+ * Parses the JSON response and returns the gene identifier, or null if not
+ * found. If the returned object_type is Gene, returns the id, if Transcript
+ * returns the Parent. If it is Translation (peptide identifier), then the
+ * Parent is the transcript identifier, so we redo the search with this value.
*
* @param br
* @return
*/
protected String parseResponse(BufferedReader br) throws IOException
{
- String parent = null;
+ String geneId = null;
JSONParser jp = new JSONParser();
try
{
JSONObject val = (JSONObject) jp.parse(br);
- parent = val.get("Parent").toString();
+ String type = val.get(OBJECT_TYPE).toString();
+ if (OBJECT_TYPE_GENE.equalsIgnoreCase(type))
+ {
+ geneId = val.get(ID).toString();
+ }
+ else if (OBJECT_TYPE_TRANSCRIPT.equalsIgnoreCase(type))
+ {
+ geneId = val.get(PARENT).toString();
+ }
+ else if (OBJECT_TYPE_TRANSLATION.equalsIgnoreCase(type))
+ {
+ String transcriptId = val.get(PARENT).toString();
+ try
+ {
+ geneId = getGeneId(transcriptId);
+ } catch (StackOverflowError e)
+ {
+ /*
+ * unlikely data condition error!
+ */
+ System.err
+ .println("** Ensembl lookup "
+ + getUrl(transcriptId).toString()
+ + " looping on Parent!");
+ }
+ }
} catch (ParseException e)
{
// ignore
}
- return parent;
+ return geneId;
}
}
import jalview.datamodel.AlignmentI;
import jalview.datamodel.SequenceFeature;
-import java.util.List;
-
import com.stevesoft.pat.Regex;
/**
import java.io.InputStreamReader;
import java.net.HttpURLConnection;
import java.net.MalformedURLException;
+import java.net.ProtocolException;
import java.net.URL;
import java.util.HashMap;
import java.util.List;
import org.json.simple.JSONObject;
import org.json.simple.parser.JSONParser;
-import com.stevesoft.pat.Regex;
-
/**
* Base class for Ensembl REST service clients
*
private static final int CONNECT_TIMEOUT_MS = 10 * 1000; // 10 seconds
+ private static final int MAX_RETRIES = 3;
+
+ private static final int HTTP_OK = 200;
+
+ private static final int HTTP_OVERLOAD = 429;
+
/*
* update these constants when Jalview has been checked / updated for
* changes to Ensembl REST API (ref JAL-2105)
* @see https://github.com/Ensembl/ensembl-rest/wiki/Change-log
* @see http://rest.ensembl.org/info/rest?content-type=application/json
*/
- private static final String LATEST_ENSEMBLGENOMES_REST_VERSION = "5.0";
+ private static final String LATEST_ENSEMBLGENOMES_REST_VERSION = "6.0";
- private static final String LATEST_ENSEMBL_REST_VERSION = "5.0";
+ private static final String LATEST_ENSEMBL_REST_VERSION = "6.1";
private static final String REST_CHANGE_LOG = "https://github.com/Ensembl/ensembl-rest/wiki/Change-log";
private final static long VERSION_RETEST_INTERVAL = 1000L * 3600; // 1 hr
- private static final Regex PROTEIN_REGEX = new Regex(
- "(ENS)([A-Z]{3}|)P[0-9]{11}$");
-
- private static final Regex TRANSCRIPT_REGEX = new Regex(
- "(ENS)([A-Z]{3}|)T[0-9]{11}$");
-
- private static final Regex GENE_REGEX = new Regex(
- "(ENS)([A-Z]{3}|)G[0-9]{11}$");
+ protected static final String CONTENT_TYPE_JSON = "?content-type=application/json";
static
{
- domainData = new HashMap<String, EnsemblInfo>();
+ domainData = new HashMap<>();
domainData.put(ENSEMBL_REST,
new EnsemblInfo(ENSEMBL_REST, LATEST_ENSEMBL_REST_VERSION));
domainData.put(ENSEMBL_GENOMES_REST, new EnsemblInfo(
setDomain(d);
}
- /**
- * Answers true if the query matches the regular expression pattern for an
- * Ensembl transcript stable identifier
- *
- * @param query
- * @return
- */
- public boolean isTranscriptIdentifier(String query)
- {
- return query == null ? false : TRANSCRIPT_REGEX.search(query);
- }
-
- /**
- * Answers true if the query matches the regular expression pattern for an
- * Ensembl protein stable identifier
- *
- * @param query
- * @return
- */
- public boolean isProteinIdentifier(String query)
- {
- return query == null ? false : PROTEIN_REGEX.search(query);
- }
-
- /**
- * Answers true if the query matches the regular expression pattern for an
- * Ensembl gene stable identifier
- *
- * @param query
- * @return
- */
- public boolean isGeneIdentifier(String query)
- {
- return query == null ? false : GENE_REGEX.search(query);
- }
-
@Override
public boolean queryInProgress()
{
* @see http://rest.ensembl.org/documentation/info/ping
* @return
*/
- private boolean checkEnsembl()
+ boolean checkEnsembl()
{
BufferedReader br = null;
try
{
// note this format works for both ensembl and ensemblgenomes
// info/ping.json works for ensembl only (March 2016)
- URL ping = new URL(
- getDomain() + "/info/ping?content-type=application/json");
+ URL ping = new URL(getDomain() + "/info/ping" + CONTENT_TYPE_JSON);
/*
* expect {"ping":1} if ok
* if ping takes more than 2 seconds to respond, treat as if unavailable
*/
br = getHttpResponse(ping, null, 2 * 1000);
+ if (br == null)
+ {
+ // error reponse status
+ return false;
+ }
JSONParser jp = new JSONParser();
JSONObject val = (JSONObject) jp.parse(br);
String pingString = val.get("ping").toString();
}
/**
- * Writes the HTTP request and gets the response as a reader.
+ * Sends the HTTP request and gets the response as a reader
*
* @param url
* @param ids
protected BufferedReader getHttpResponse(URL url, List<String> ids,
int readTimeout) throws IOException
{
- // long now = System.currentTimeMillis();
+ int retriesLeft = MAX_RETRIES;
+ HttpURLConnection connection = null;
+ int responseCode = 0;
+
+ while (retriesLeft > 0)
+ {
+ connection = tryConnection(url, ids, readTimeout);
+ responseCode = connection.getResponseCode();
+ if (responseCode == HTTP_OVERLOAD) // 429
+ {
+ retriesLeft--;
+ checkRetryAfter(connection);
+ }
+ else
+ {
+ retriesLeft = 0;
+ }
+ }
+ if (responseCode != HTTP_OK) // 200
+ {
+ /*
+ * note: a GET request for an invalid id returns an error code e.g. 415
+ * but POST request returns 200 and an empty Fasta response
+ */
+ System.err.println("Response code " + responseCode + " for " + url);
+ return null;
+ }
+
+ InputStream response = connection.getInputStream();
+
+ // System.out.println(getClass().getName() + " took "
+ // + (System.currentTimeMillis() - now) + "ms to fetch");
+
+ BufferedReader reader = null;
+ reader = new BufferedReader(new InputStreamReader(response, "UTF-8"));
+ return reader;
+ }
+
+ /**
+ * @param url
+ * @param ids
+ * @param readTimeout
+ * @return
+ * @throws IOException
+ * @throws ProtocolException
+ */
+ protected HttpURLConnection tryConnection(URL url, List<String> ids,
+ int readTimeout) throws IOException, ProtocolException
+ {
+ // System.out.println(System.currentTimeMillis() + " " + url);
HttpURLConnection connection = (HttpURLConnection) url.openConnection();
/*
{
writePostBody(connection, ids);
}
-
- int responseCode = connection.getResponseCode();
-
- if (responseCode != 200)
- {
- /*
- * note: a GET request for an invalid id returns an error code e.g. 415
- * but POST request returns 200 and an empty Fasta response
- */
- System.err.println("Response code " + responseCode + " for " + url);
- return null;
- }
- // get content
- InputStream response = connection.getInputStream();
-
- // System.out.println(getClass().getName() + " took "
- // + (System.currentTimeMillis() - now) + "ms to fetch");
-
- checkRateLimits(connection);
-
- BufferedReader reader = null;
- reader = new BufferedReader(new InputStreamReader(response, "UTF-8"));
- return reader;
+ return connection;
}
/**
- * Inspect response headers for any sign of server overload and respect any
- * 'retry-after' directive
+ * Inspects response headers for a 'retry-after' directive, and waits for the
+ * directed period (if less than 10 seconds)
*
* @see https://github.com/Ensembl/ensembl-rest/wiki/Rate-Limits
* @param connection
*/
- void checkRateLimits(HttpURLConnection connection)
+ void checkRetryAfter(HttpURLConnection connection)
{
- // number of requests allowed per time interval:
- String limit = connection.getHeaderField("X-RateLimit-Limit");
- // length of quota time interval in seconds:
- // String period = connection.getHeaderField("X-RateLimit-Period");
- // seconds remaining until usage quota is reset:
- String reset = connection.getHeaderField("X-RateLimit-Reset");
- // number of requests remaining from quota for current period:
- String remaining = connection.getHeaderField("X-RateLimit-Remaining");
- // number of seconds to wait before retrying (if remaining == 0)
String retryDelay = connection.getHeaderField("Retry-After");
// to test:
// retryDelay = "5";
- EnsemblInfo info = domainData.get(getDomain());
if (retryDelay != null)
{
- System.err.println("Ensembl REST service rate limit exceeded, wait "
- + retryDelay + " seconds before retrying");
try
{
- info.retryAfter = System.currentTimeMillis()
- + (1000 * Integer.valueOf(retryDelay));
- } catch (NumberFormatException e)
+ int retrySecs = Integer.valueOf(retryDelay);
+ if (retrySecs > 0 && retrySecs < 10)
+ {
+ System.err
+ .println("Ensembl REST service rate limit exceeded, waiting "
+ + retryDelay + " seconds before retrying");
+ Thread.sleep(1000 * retrySecs);
+ }
+ } catch (NumberFormatException | InterruptedException e)
{
- System.err
- .println("Unexpected value for Retry-After: " + retryDelay);
+ System.err.println("Error handling Retry-After: " + e.getMessage());
}
}
- else
- {
- info.retryAfter = 0;
- // debug:
- // System.out.println(String.format(
- // "%s Ensembl requests remaining of %s (reset in %ss)",
- // remaining, limit, reset));
- }
}
/**
long now = System.currentTimeMillis();
/*
- * check if we are waiting for 'Retry-After' to expire
- */
- if (info.retryAfter > now)
- {
- System.err.println("Still " + (1 + (info.retryAfter - now) / 1000)
- + " secs to wait before retrying Ensembl");
- return false;
- }
- else
- {
- info.retryAfter = 0;
- }
-
- /*
* recheck if Ensembl is up if it was down, or the recheck period has elapsed
*/
boolean retestAvailability = (now
URL url = null;
try
{
- url = new URL(
- getDomain() + "/info/rest?content-type=application/json");
+ url = new URL(getDomain() + "/info/rest" + CONTENT_TYPE_JSON);
BufferedReader br = getHttpResponse(url, null);
+ if (br == null)
+ {
+ return;
+ }
JSONObject val = (JSONObject) jp.parse(br);
String version = val.get("release").toString();
String majorVersion = version.substring(0, version.indexOf("."));
{
JSONParser jp = new JSONParser();
URL url = null;
+ BufferedReader br = null;
+
try
{
- url = new URL(
- getDomain() + "/info/data?content-type=application/json");
- BufferedReader br = getHttpResponse(url, null);
- JSONObject val = (JSONObject) jp.parse(br);
- JSONArray versions = (JSONArray) val.get("releases");
- domainData.get(getDomain()).dataVersion = versions.get(0).toString();
+ url = new URL(getDomain() + "/info/data" + CONTENT_TYPE_JSON);
+ br = getHttpResponse(url, null);
+ if (br != null)
+ {
+ JSONObject val = (JSONObject) jp.parse(br);
+ JSONArray versions = (JSONArray) val.get("releases");
+ domainData.get(getDomain()).dataVersion = versions.get(0)
+ .toString();
+ }
} catch (Throwable t)
{
System.err.println(
"Error checking Ensembl data version: " + t.getMessage());
+ } finally
+ {
+ if (br != null)
+ {
+ try
+ {
+ br.close();
+ } catch (IOException e)
+ {
+ // ignore
+ }
+ }
}
}
import jalview.datamodel.Mapping;
import jalview.datamodel.SequenceFeature;
import jalview.datamodel.SequenceI;
+import jalview.datamodel.features.SequenceFeatures;
import jalview.exceptions.JalviewException;
import jalview.io.FastaFile;
import jalview.io.FileParse;
import jalview.io.gff.SequenceOntologyI;
import jalview.util.Comparison;
import jalview.util.DBRefUtils;
+import jalview.util.IntRangeComparator;
import jalview.util.MapList;
-import jalview.util.RangeComparator;
import java.io.IOException;
import java.net.MalformedURLException;
import java.util.ArrayList;
import java.util.Arrays;
import java.util.Collections;
-import java.util.Comparator;
import java.util.List;
+import java.util.Map;
+import java.util.Map.Entry;
/**
* Base class for Ensembl sequence fetchers
urlstring.append("?type=").append(getSourceEnsemblType().getType());
urlstring.append(("&Accept=text/x-fasta"));
+ Map<String, String> params = getAdditionalParameters();
+ if (params != null)
+ {
+ for (Entry<String, String> entry : params.entrySet())
+ {
+ urlstring.append("&").append(entry.getKey()).append("=")
+ .append(entry.getValue());
+ }
+ }
+
URL url = new URL(urlstring.toString());
return url;
}
/**
+ * Override this method to add any additional x=y URL parameters needed
+ *
+ * @return
+ */
+ protected Map<String, String> getAdditionalParameters()
+ {
+ return null;
+ }
+
+ /**
* A sequence/id POST request currently allows up to 50 queries
*
* @see http://rest.ensembl.org/documentation/info/sequence_id_post
protected MapList getGenomicRangesFromFeatures(SequenceI sourceSequence,
String accId, int start)
{
- SequenceFeature[] sfs = sourceSequence.getSequenceFeatures();
- if (sfs == null)
+ // SequenceFeature[] sfs = sourceSequence.getSequenceFeatures();
+ List<SequenceFeature> sfs = sourceSequence.getFeatures()
+ .getPositionalFeatures();
+ if (sfs.isEmpty())
{
return null;
}
* a final sort is needed since Ensembl returns CDS sorted within source
* (havana / ensembl_havana)
*/
- Collections.sort(regions, new RangeComparator(direction == 1));
+ Collections.sort(regions, direction == 1 ? IntRangeComparator.ASCENDING
+ : IntRangeComparator.DESCENDING);
List<int[]> to = Arrays
.asList(new int[]
if (mappedRange != null)
{
- SequenceFeature copy = new SequenceFeature(sf);
- copy.setBegin(Math.min(mappedRange[0], mappedRange[1]));
- copy.setEnd(Math.max(mappedRange[0], mappedRange[1]));
- if (".".equals(copy.getFeatureGroup()))
+ String group = sf.getFeatureGroup();
+ if (".".equals(group))
{
- copy.setFeatureGroup(getDbSource());
+ group = getDbSource();
}
+ int newBegin = Math.min(mappedRange[0], mappedRange[1]);
+ int newEnd = Math.max(mappedRange[0], mappedRange[1]);
+ SequenceFeature copy = new SequenceFeature(sf, newBegin, newEnd,
+ group, sf.getScore());
targetSequence.addSequenceFeature(copy);
/*
return false;
}
- // long start = System.currentTimeMillis();
- SequenceFeature[] sfs = sourceSequence.getSequenceFeatures();
+// long start = System.currentTimeMillis();
+ List<SequenceFeature> sfs = sourceSequence.getFeatures()
+ .getPositionalFeatures();
MapList mapping = getGenomicRangesFromFeatures(sourceSequence,
accessionId, targetSequence.getStart());
if (mapping == null)
boolean result = transferFeatures(sfs, targetSequence, mapping,
accessionId);
- // System.out.println("transferFeatures (" + (sfs.length) + " --> "
- // + targetSequence.getSequenceFeatures().length + ") to "
- // + targetSequence.getName()
- // + " took " + (System.currentTimeMillis() - start) + "ms");
+// System.out.println("transferFeatures (" + (sfs.size()) + " --> "
+// + targetSequence.getFeatures().getFeatureCount(true) + ") to "
+// + targetSequence.getName() + " took "
+// + (System.currentTimeMillis() - start) + "ms");
return result;
}
* converted using the mapping. Features which do not overlap are ignored.
* Features whose parent is not the specified identifier are also ignored.
*
- * @param features
+ * @param sfs
* @param targetSequence
* @param mapping
* @param parentId
* @return
*/
- protected boolean transferFeatures(SequenceFeature[] features,
+ protected boolean transferFeatures(List<SequenceFeature> sfs,
SequenceI targetSequence, MapList mapping, String parentId)
{
final boolean forwardStrand = mapping.isFromForwardStrand();
* position descending if reverse strand) so as to add them in
* 'forwards' order to the target sequence
*/
- sortFeatures(features, forwardStrand);
+ SequenceFeatures.sortFeatures(sfs, forwardStrand);
boolean transferred = false;
- for (SequenceFeature sf : features)
+ for (SequenceFeature sf : sfs)
{
if (retainFeature(sf, parentId))
{
}
/**
- * Sort features by start position ascending (if on forward strand), or end
- * position descending (if on reverse strand)
- *
- * @param features
- * @param forwardStrand
- */
- protected static void sortFeatures(SequenceFeature[] features,
- final boolean forwardStrand)
- {
- Arrays.sort(features, new Comparator<SequenceFeature>()
- {
- @Override
- public int compare(SequenceFeature o1, SequenceFeature o2)
- {
- if (forwardStrand)
- {
- return Integer.compare(o1.getBegin(), o2.getBegin());
- }
- else
- {
- return Integer.compare(o2.getEnd(), o1.getEnd());
- }
- }
- });
- }
-
- /**
* Answers true if the feature type is one we want to keep for the sequence.
* Some features are only retrieved in order to identify the sequence range,
* and may then be discarded as redundant information (e.g. "CDS" feature for
/**
* Returns a (possibly empty) list of features on the sequence which have the
- * specified sequence ontology type (or a sub-type of it), and the given
+ * specified sequence ontology term (or a sub-type of it), and the given
* identifier as parent
*
* @param sequence
- * @param type
+ * @param term
* @param parentId
* @return
*/
protected List<SequenceFeature> findFeatures(SequenceI sequence,
- String type, String parentId)
+ String term, String parentId)
{
List<SequenceFeature> result = new ArrayList<SequenceFeature>();
- SequenceFeature[] sfs = sequence.getSequenceFeatures();
- if (sfs != null)
+ List<SequenceFeature> sfs = sequence.getFeatures()
+ .getFeaturesByOntology(term);
+ for (SequenceFeature sf : sfs)
{
- SequenceOntologyI so = SequenceOntologyFactory.getInstance();
- for (SequenceFeature sf : sfs)
+ String parent = (String) sf.getValue(PARENT);
+ if (parent != null && parent.equals(parentId))
{
- if (so.isA(sf.getType(), type))
- {
- String parent = (String) sf.getValue(PARENT);
- if (parent.equals(parentId))
- {
- result.add(sf);
- }
- }
+ result.add(sf);
}
}
+
return result;
}
*/
public class EnsemblSymbol extends EnsemblXref
{
+ private static final String GENE = "gene";
+ private static final String TYPE = "type";
+ private static final String ID = "id";
+
/**
* Constructor given the target domain to fetch data from
*
while (rvals.hasNext())
{
JSONObject val = (JSONObject) rvals.next();
- String id = val.get("id").toString();
- if (id != null && isGeneIdentifier(id))
+ String id = val.get(ID).toString();
+ String type = val.get(TYPE).toString();
+ if (id != null && GENE.equals(type))
{
result = id;
break;
return result;
}
- protected URL getUrl(String id, Species species)
+ /**
+ * Constructs the URL for the REST symbol endpoint
+ *
+ * @param id
+ * the accession id (Ensembl or external)
+ * @param species
+ * a species name recognisable by Ensembl
+ * @param type
+ * an optional type to filter the response (gene, transcript,
+ * translation)
+ * @return
+ */
+ protected URL getUrl(String id, Species species, String... type)
{
- String url = getDomain() + "/xrefs/symbol/" + species.toString() + "/"
- + id + "?content-type=application/json";
+ StringBuilder sb = new StringBuilder();
+ sb.append(getDomain()).append("/xrefs/symbol/")
+ .append(species.toString()).append("/").append(id)
+ .append(CONTENT_TYPE_JSON);
+ for (String t : type)
+ {
+ sb.append("&object_type=").append(t);
+ }
try
{
+ String url = sb.toString();
return new URL(url);
} catch (MalformedURLException e)
{
* @param identifier
* @return
*/
- public List<String> getIds(String identifier)
+ public List<String> getGeneIds(String identifier)
{
List<String> result = new ArrayList<String>();
List<String> ids = new ArrayList<String>();
{
for (String query : queries)
{
- for (Species taxon : Species.values())
+ for (Species taxon : Species.getModelOrganisms())
{
- if (taxon.isModelOrganism())
+ URL url = getUrl(query, taxon, GENE);
+ if (url != null)
{
- URL url = getUrl(query, taxon);
- if (url != null)
- {
- br = getHttpResponse(url, ids);
- }
- String geneId = parseSymbolResponse(br);
- if (geneId != null)
+ br = getHttpResponse(url, ids);
+ if (br != null)
{
- result.add(geneId);
+ String geneId = parseSymbolResponse(br);
+ System.out.println(url + " returned " + geneId);
+ if (geneId != null && !result.contains(geneId))
+ {
+ result.add(geneId);
+ }
}
}
}
if (url != null)
{
br = getHttpResponse(url, ids);
+ if (br != null)
+ {
+ result = parseResponse(br);
+ }
}
- return (parseResponse(br));
} catch (IOException e)
{
// ignore
while (rvals.hasNext())
{
JSONObject val = (JSONObject) rvals.next();
- String dbName = val.get("dbname").toString();
- if (dbName.equals(GO_GENE_ONTOLOGY))
- {
- continue;
- }
+ String db = val.get("dbname").toString();
String id = val.get("primary_id").toString();
- if (dbName != null && id != null)
+ if (db != null && id != null
+ && !GO_GENE_ONTOLOGY.equals(db))
{
- dbName = DBRefUtils.getCanonicalName(dbName);
- DBRefEntry dbref = new DBRefEntry(dbName, getXRefVersion(), id);
+ db = DBRefUtils.getCanonicalName(db);
+ DBRefEntry dbref = new DBRefEntry(db, getXRefVersion(), id);
result.add(dbref);
}
}
protected URL getUrl(String identifier)
{
String url = getDomain() + "/xrefs/id/" + identifier
- + "?content-type=application/json&all_levels=1";
+ + CONTENT_TYPE_JSON + "&all_levels=1";
try
{
return new URL(url);
*/
package jalview.ext.ensembl;
+import java.util.HashSet;
+import java.util.Set;
+
/**
* Selected species identifiers used by Ensembl
*
chimpanzee(false), cat(false), zebrafish(true), chicken(true),
dmelanogaster(true);
+ static Set<Species> modelOrganisms = new HashSet<>();
+
+ static
+ {
+ for (Species s : values())
+ {
+ if (s.isModelOrganism())
+ {
+ modelOrganisms.add(s);
+ }
+ }
+ }
boolean modelOrganism;
private Species(boolean model)
{
return modelOrganism;
}
+
+ public static Set<Species> getModelOrganisms()
+ {
+ return modelOrganisms;
+ }
}
import jalview.datamodel.HiddenColumns;
import jalview.datamodel.PDBEntry;
import jalview.datamodel.SequenceI;
+import jalview.gui.IProgressIndicator;
import jalview.io.DataSourceType;
import jalview.io.StructureFile;
import jalview.schemes.ColourSchemeI;
*/
private boolean associateNewStructs = false;
- Vector<String> atomsPicked = new Vector<String>();
+ Vector<String> atomsPicked = new Vector<>();
private List<String> chainNames;
}
if (modelFileNames == null)
{
- List<String> mset = new ArrayList<String>();
+ List<String> mset = new ArrayList<>();
_modelFileNameMap = new int[viewer.ms.mc];
String m = viewer.ms.getModelFileName(0);
if (m != null)
@Override
public synchronized String[] getStructureFiles()
{
- List<String> mset = new ArrayList<String>();
+ List<String> mset = new ArrayList<>();
if (viewer == null)
{
return new String[0];
notifyAtomPicked(((Integer) data[2]).intValue(), (String) data[1],
(String) data[0]);
// also highlight in alignment
+ // deliberate fall through
case HOVER:
notifyAtomHovered(((Integer) data[2]).intValue(), (String) data[1],
(String) data[0]);
fileLoadingError = null;
String[] oldmodels = modelFileNames;
modelFileNames = null;
- chainNames = new ArrayList<String>();
- chainFile = new Hashtable<String, String>();
+ chainNames = new ArrayList<>();
+ chainFile = new Hashtable<>();
boolean notifyLoaded = false;
String[] modelfilenames = getStructureFiles();
// first check if we've lost any structures
// see JAL-623 - need method of matching pasted data up
{
pdb = getSsm().setMapping(getSequence()[pe], getChains()[pe],
- pdbfile, DataSourceType.PASTE);
+ pdbfile, DataSourceType.PASTE,
+ getIProgressIndicator());
getPdbEntry(modelnum).setFile("INLINE" + pdb.getId());
matches = true;
foundEntry = true;
}
// Explicitly map to the filename used by Jmol ;
pdb = getSsm().setMapping(getSequence()[pe], getChains()[pe],
- fileName, protocol);
+ fileName, protocol, getIProgressIndicator());
// pdbentry[pe].getFile(), protocol);
}
return chainNames;
}
+ protected abstract IProgressIndicator getIProgressIndicator();
+
public void notifyNewPickingModeMeasurement(int iatom, String strMeasure)
{
notifyAtomPicked(iatom, strMeasure, null);
SequenceI sq, char[] secstr, char[] secstrcode, String chainId,
int firstResNum)
{
- char[] seq = sq.getSequence();
+ int length = sq.getLength();
boolean ssFound = false;
- Annotation asecstr[] = new Annotation[seq.length + firstResNum - 1];
- for (int p = 0; p < seq.length; p++)
+ Annotation asecstr[] = new Annotation[length + firstResNum - 1];
+ for (int p = 0; p < length; p++)
{
if (secstr[p] >= 'A' && secstr[p] <= 'z')
{
*/
package jalview.ext.rbvi.chimera;
-import jalview.util.RangeComparator;
+import jalview.util.IntRangeComparator;
import java.util.ArrayList;
import java.util.Collections;
for (String chain : modelData.keySet())
{
- chain = chain.trim();
+ chain = " ".equals(chain) ? chain : chain.trim();
List<int[]> rangeList = modelData.get(chain);
/*
* sort ranges into ascending start position order
*/
- Collections.sort(rangeList, new RangeComparator(true));
+ Collections.sort(rangeList, IntRangeComparator.ASCENDING);
int start = rangeList.isEmpty() ? 0 : rangeList.get(0)[0];
int end = rangeList.isEmpty() ? 0 : rangeList.get(0)[1];
{
sb.append(start).append("-").append(end);
}
- if (chain.length() > 0)
- {
- sb.append(".").append(chain);
+
+ sb.append(".");
+ if (!" ".equals(chain)) {
+ sb.append(chain);
}
}
}
StructureMapping mapping, SequenceI seq,
Map<String, Map<Object, AtomSpecModel>> theMap, int modelNumber)
{
- SequenceFeature[] sfs = seq.getSequenceFeatures();
- if (sfs == null)
- {
- return;
- }
-
+ List<SequenceFeature> sfs = seq.getFeatures().getPositionalFeatures(
+ visibleFeatures.toArray(new String[visibleFeatures.size()]));
for (SequenceFeature sf : sfs)
{
String type = sf.getType();
*/
boolean isFromViewer = JalviewChimeraBinding.CHIMERA_FEATURE_GROUP
.equals(sf.getFeatureGroup());
- if (isFromViewer || !visibleFeatures.contains(type))
+ if (isFromViewer)
{
continue;
}
* @return
*/
public String getCacheKey();
+
+ /**
+ *
+ * @return user preference name for configuring this FTS search's autosearch
+ * checkbox
+ */
+ public String getAutosearchPreference();
}
import javax.swing.ImageIcon;
import javax.swing.JButton;
+import javax.swing.JCheckBox;
import javax.swing.JComboBox;
import javax.swing.JFrame;
import javax.swing.JInternalFrame;
protected JInternalFrame mainFrame = new JInternalFrame(
getFTSFrameTitle());
+ protected JTabbedPane tabs = new JTabbedPane();
protected IProgressIndicator progressIndicator;
protected JComboBox<FTSDataColumnI> cmb_searchTarget = new JComboBox<FTSDataColumnI>();
protected JButton btn_cancel = new JButton();
+ protected JCheckBox btn_autosearch = new JCheckBox();
+
protected JvCacheableInputBox<String> txt_search;
protected SequenceFetcher seqFetcher;
public GFTSPanel()
{
+ this(null);
+ }
+
+ public GFTSPanel(SequenceFetcher fetcher)
+ {
try
{
+ if (fetcher == null)
+ {
+ tabs = null;
+ }
jbInit();
+ if (fetcher != null)
+ {
+ tabs.addTab(MessageManager.getString("label.retrieve_ids"),
+ fetcher);
+ fetcher.setDatabaseChooserVisible(false);
+ fetcher.embedWithFTSPanel(this);
+ }
mainFrame.setMinimumSize(new Dimension(MIN_WIDTH, MIN_HEIGHT));
+ final JPanel ftsPanel = this;
mainFrame.addFocusListener(new FocusAdapter()
{
@Override
public void focusGained(FocusEvent e)
{
- txt_search.requestFocusInWindow();
+ // TODO: make selected tab gain focus in correct widget
+ if (tabs != null
+ && tabs.getSelectedComponent() == ftsPanel)
+ {
+ txt_search.requestFocusInWindow();
+ }
}
});
mainFrame.invalidate();
}
});
+ btn_autosearch.setText(MessageManager.getString("option.autosearch"));
+ btn_autosearch.setToolTipText(
+ MessageManager.getString("option.enable_disable_autosearch"));
+ btn_autosearch.setSelected(
+ jalview.bin.Cache.getDefault(getAutosearchPreference(), true));
+ btn_autosearch.addActionListener(new java.awt.event.ActionListener()
+ {
+ @Override
+ public void actionPerformed(ActionEvent e)
+ {
+ jalview.bin.Cache.setProperty(getAutosearchPreference(),
+ Boolean.toString(btn_autosearch.isSelected()));
+ }
+ });
btn_back.setFont(new java.awt.Font("Verdana", 0, 12));
btn_back.setText(MessageManager.getString("action.back"));
btn_back.addActionListener(new java.awt.event.ActionListener()
if (primaryKeyName.equalsIgnoreCase(getCmbSearchTarget()
.getSelectedItem().toString()))
{
+ // TODO: nicer to show the list in the result set before
+ // viewing in Jalview perhaps ?
transferToSequenceFetcher(getTypedText());
}
+ else
+ {
+ performSearchAction();
+ }
}
}
});
@Override
public void actionPerformed(ActionEvent e)
{
- String typed = getTypedText();
- if (!typed.equalsIgnoreCase(lastSearchTerm))
+ if (btn_autosearch.isSelected()
+ || txt_search.wasEnterPressed())
{
- searchAction(true);
- paginatorCart.clear();
- lastSearchTerm = typed;
+ performSearchAction();
}
}
}, false);
}
});
+ txt_search.addActionListener(new ActionListener()
+ {
+
+ @Override
+ public void actionPerformed(ActionEvent e)
+ {
+ performSearchAction();
+ }
+ });
final String searchTabTitle = MessageManager
.getString("label.search_result");
final String configureCols = MessageManager
pnl_results.add(tabbedPane);
pnl_inputs.add(cmb_searchTarget);
pnl_inputs.add(txt_search);
+ pnl_inputs.add(btn_autosearch);
pnl_inputs.add(lbl_loading);
pnl_inputs.add(lbl_warning);
pnl_inputs.add(lbl_blank);
this.add(pnl_results, java.awt.BorderLayout.CENTER);
this.add(pnl_actions, java.awt.BorderLayout.SOUTH);
mainFrame.setVisible(true);
- mainFrame.setContentPane(this);
+ if (tabs != null)
+ {
+ tabs.setOpaque(true);
+ tabs.insertTab("Free Text Search", null, this, "", 0);
+ mainFrame.setContentPane(tabs);
+ tabs.setVisible(true);
+ }
+ else
+ {
+ mainFrame.setContentPane(this);
+ }
mainFrame.setDefaultCloseOperation(JFrame.DISPOSE_ON_CLOSE);
mainFrame.addInternalFrameListener(
new javax.swing.event.InternalFrameAdapter()
closeAction();
}
});
- mainFrame.setVisible(true);
- mainFrame.setContentPane(this);
mainFrame.setDefaultCloseOperation(JFrame.DISPOSE_ON_CLOSE);
Integer x = getTempUserPrefs().get("FTSPanel.x");
Integer y = getTempUserPrefs().get("FTSPanel.y");
}
+ void performSearchAction()
+ {
+ String typed = getTypedText();
+ if (typed != null && typed.length() > 0
+ && !typed.equalsIgnoreCase(lastSearchTerm))
+ {
+ searchAction(true);
+ paginatorCart.clear();
+ lastSearchTerm = typed;
+ }
+ }
+
public boolean wantedFieldsUpdated()
{
if (previousWantedFields == null)
}
}
- protected void btn_back_ActionPerformed()
+ public void btn_back_ActionPerformed()
{
closeAction();
new SequenceFetcher(progressIndicator);
btn_cancel.setEnabled(false);
}
- protected void btn_cancel_ActionPerformed()
+ public void btn_cancel_ActionPerformed()
{
closeAction();
}
private static final String PDB_FTS_CACHE_KEY = "CACHE.PDB_FTS";
- public PDBFTSPanel(SequenceFetcher seqFetcher)
+ private static final String PDB_AUTOSEARCH = "FTS.PDB.AUTOSEARCH";
+
+ public PDBFTSPanel(SequenceFetcher fetcher)
{
- super();
+ super(fetcher);
pageLimit = PDBFTSRestClient.getInstance().getDefaultResponsePageSize();
- this.seqFetcher = seqFetcher;
- this.progressIndicator = (seqFetcher == null) ? null
- : seqFetcher.getProgressIndicator();
+ this.seqFetcher = fetcher;
+ this.progressIndicator = (fetcher == null) ? null
+ : fetcher.getProgressIndicator();
}
@Override
request.setSearchTerm(searchTerm + ")");
request.setOffSet(offSet);
request.setWantedFields(wantedFields);
- FTSRestClientI pdbRestCleint = PDBFTSRestClient.getInstance();
+ FTSRestClientI pdbRestClient = PDBFTSRestClient.getInstance();
FTSRestResponse resultList;
try
{
- resultList = pdbRestCleint.executeRequest(request);
+ resultList = pdbRestClient.executeRequest(request);
} catch (Exception e)
{
setErrorMessage(e.getMessage());
checkForErrors();
+ setSearchInProgress(false);
return;
}
return PDB_FTS_CACHE_KEY;
}
-}
+ @Override
+ public String getAutosearchPreference()
+ {
+ return PDB_AUTOSEARCH;
+ }
+}
\ No newline at end of file
private static String defaultFTSFrameTitle = MessageManager
.getString("label.uniprot_sequence_fetcher");
- private static Map<String, Integer> tempUserPrefs = new HashMap<String, Integer>();
+ private static Map<String, Integer> tempUserPrefs = new HashMap<>();
private static final String UNIPROT_FTS_CACHE_KEY = "CACHE.UNIPROT_FTS";
- public UniprotFTSPanel(SequenceFetcher seqFetcher)
+ private static final String UNIPROT_AUTOSEARCH = "FTS.UNIPROT.AUTOSEARCH";
+
+ public UniprotFTSPanel(SequenceFetcher fetcher)
{
- super();
+ super(fetcher);
pageLimit = UniProtFTSRestClient.getInstance()
.getDefaultResponsePageSize();
- this.seqFetcher = seqFetcher;
- this.progressIndicator = (seqFetcher == null) ? null
- : seqFetcher.getProgressIndicator();
+ this.seqFetcher = fetcher;
+ this.progressIndicator = (fetcher == null) ? null
+ : fetcher.getProgressIndicator();
}
@Override
request.setSearchTerm(searchTerm);
request.setOffSet(offSet);
request.setWantedFields(wantedFields);
- FTSRestClientI uniProtRestCleint = UniProtFTSRestClient
+ FTSRestClientI uniProtRestClient = UniProtFTSRestClient
.getInstance();
FTSRestResponse resultList;
try
{
- resultList = uniProtRestCleint.executeRequest(request);
+ resultList = uniProtRestClient.executeRequest(request);
} catch (Exception e)
{
- e.printStackTrace();
setErrorMessage(e.getMessage());
checkForErrors();
+ setSearchInProgress(false);
return;
}
{
disableActionButtons();
StringBuilder selectedIds = new StringBuilder();
- HashSet<String> selectedIdsSet = new HashSet<String>();
+ HashSet<String> selectedIdsSet = new HashSet<>();
int primaryKeyColIndex = 0;
try
{
{
return UNIPROT_FTS_CACHE_KEY;
}
+
+ @Override
+ public String getAutosearchPreference()
+ {
+ return UNIPROT_AUTOSEARCH;
+ }
}
AlignViewport viewport;
- ViewportRanges vpRanges;
-
public AlignViewControllerI avc;
List<AlignmentPanel> alignPanels = new ArrayList<>();
progressBar = new ProgressBar(this.statusPanel, this.statusBar);
}
- vpRanges = viewport.getRanges();
avc = new jalview.controller.AlignViewController(this, viewport,
alignPanel);
if (viewport.getAlignmentConservationAnnotation() == null)
{ (viewport.cursorMode ? "on" : "off") }));
if (viewport.cursorMode)
{
- alignPanel.getSeqPanel().seqCanvas.cursorX = vpRanges
+ ViewportRanges ranges = viewport.getRanges();
+ alignPanel.getSeqPanel().seqCanvas.cursorX = ranges
.getStartRes();
- alignPanel.getSeqPanel().seqCanvas.cursorY = vpRanges
+ alignPanel.getSeqPanel().seqCanvas.cursorY = ranges
.getStartSeq();
}
alignPanel.getSeqPanel().seqCanvas.repaint();
break;
}
case KeyEvent.VK_PAGE_UP:
- vpRanges.pageUp();
+ viewport.getRanges().pageUp();
break;
case KeyEvent.VK_PAGE_DOWN:
- vpRanges.pageDown();
+ viewport.getRanges().pageDown();
break;
}
}
}
viewport.getAlignment().moveSelectedSequencesByOne(sg,
viewport.getHiddenRepSequences(), up);
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(true, false);
}
synchronized void slideSequences(boolean right, int size)
{
// propagate alignment changed.
- vpRanges.setEndSeq(alignment.getHeight());
+ viewport.getRanges().setEndSeq(alignment.getHeight());
if (annotationAdded)
{
// Duplicate sequence annotation in all views.
{
PaintRefresher.Refresh(this, viewport.getSequenceSetId());
alignPanel.updateAnnotation();
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(true, true);
}
}
// JAL-2034 - should delegate to
// alignPanel to decide if overview needs
// updating.
- alignPanel.paintAlignment(false);
+ alignPanel.paintAlignment(false, false);
PaintRefresher.Refresh(alignPanel, viewport.getSequenceSetId());
}
viewport.setSelectionGroup(null);
viewport.getColumnSelection().clear();
viewport.setSelectionGroup(null);
- alignPanel.getSeqPanel().seqCanvas.highlightSearchResults(null);
alignPanel.getIdPanel().getIdCanvas().searchResults = null;
// JAL-2034 - should delegate to
// alignPanel to decide if overview needs
// updating.
- alignPanel.paintAlignment(false);
+ alignPanel.paintAlignment(false, false);
PaintRefresher.Refresh(alignPanel, viewport.getSequenceSetId());
viewport.sendSelection();
}
// alignPanel to decide if overview needs
// updating.
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(true, false);
PaintRefresher.Refresh(alignPanel, viewport.getSequenceSetId());
viewport.sendSelection();
}
public void invertColSel_actionPerformed(ActionEvent e)
{
viewport.invertColumnSelection();
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(true, false);
viewport.sendSelection();
}
{
trimRegion = new TrimRegionCommand("Remove Left", true, seqs,
column, viewport.getAlignment());
- vpRanges.setStartRes(0);
+ viewport.getRanges().setStartRes(0);
}
else
{
// This is to maintain viewport position on first residue
// of first sequence
SequenceI seq = viewport.getAlignment().getSequenceAt(0);
- int startRes = seq.findPosition(vpRanges.getStartRes());
+ ViewportRanges ranges = viewport.getRanges();
+ int startRes = seq.findPosition(ranges.getStartRes());
// ShiftList shifts;
// viewport.getAlignment().removeGaps(shifts=new ShiftList());
// edit.alColumnChanges=shifts.getInverse();
// if (viewport.hasHiddenColumns)
// viewport.getColumnSelection().compensateForEdits(shifts);
- vpRanges.setStartRes(seq.findIndex(startRes) - 1);
+ ranges.setStartRes(seq.findIndex(startRes) - 1);
viewport.firePropertyChange("alignment", null,
viewport.getAlignment().getSequences());
// This is to maintain viewport position on first residue
// of first sequence
SequenceI seq = viewport.getAlignment().getSequenceAt(0);
- int startRes = seq.findPosition(vpRanges.getStartRes());
+ int startRes = seq.findPosition(viewport.getRanges().getStartRes());
addHistoryItem(new RemoveGapsCommand("Remove Gaps", seqs, start, end,
viewport.getAlignment()));
- vpRanges.setStartRes(seq.findIndex(startRes) - 1);
+ viewport.getRanges().setStartRes(seq.findIndex(startRes) - 1);
viewport.firePropertyChange("alignment", null,
viewport.getAlignment().getSequences());
/*
* Create a new AlignmentPanel (with its own, new Viewport)
*/
- AlignmentPanel newap = new Jalview2XML().copyAlignPanel(alignPanel,
- true);
+ AlignmentPanel newap = new Jalview2XML().copyAlignPanel(alignPanel);
if (!copyAnnotation)
{
/*
alignPanel.getIdPanel().getIdCanvas()
.setPreferredSize(alignPanel.calculateIdWidth());
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(true, false);
}
@Override
public void idRightAlign_actionPerformed(ActionEvent e)
{
viewport.setRightAlignIds(idRightAlign.isSelected());
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(false, false);
}
@Override
public void centreColumnLabels_actionPerformed(ActionEvent e)
{
viewport.setCentreColumnLabels(centreColumnLabelsMenuItem.getState());
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(false, false);
}
/*
protected void colourTextMenuItem_actionPerformed(ActionEvent e)
{
viewport.setColourText(colourTextMenuItem.isSelected());
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(false, false);
}
/**
public void showAllColumns_actionPerformed(ActionEvent e)
{
viewport.showAllHiddenColumns();
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(true, true);
viewport.sendSelection();
}
viewport.expandColSelection(sg, false);
viewport.hideAllSelectedSeqs();
viewport.hideSelectedColumns();
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(true, true);
viewport.sendSelection();
}
{
viewport.showAllHiddenColumns();
viewport.showAllHiddenSeqs();
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(true, true);
viewport.sendSelection();
}
public void hideSelColumns_actionPerformed(ActionEvent e)
{
viewport.hideSelectedColumns();
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(true, true);
viewport.sendSelection();
}
protected void scaleAbove_actionPerformed(ActionEvent e)
{
viewport.setScaleAboveWrapped(scaleAbove.isSelected());
- alignPanel.paintAlignment(true);
+ // TODO: do we actually need to update overview for scale above change ?
+ alignPanel.paintAlignment(true, false);
}
/**
protected void scaleLeft_actionPerformed(ActionEvent e)
{
viewport.setScaleLeftWrapped(scaleLeft.isSelected());
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(true, false);
}
/**
protected void scaleRight_actionPerformed(ActionEvent e)
{
viewport.setScaleRightWrapped(scaleRight.isSelected());
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(true, false);
}
/**
public void viewBoxesMenuItem_actionPerformed(ActionEvent e)
{
viewport.setShowBoxes(viewBoxesMenuItem.isSelected());
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(false, false);
}
/**
public void viewTextMenuItem_actionPerformed(ActionEvent e)
{
viewport.setShowText(viewTextMenuItem.isSelected());
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(false, false);
}
/**
protected void renderGapsMenuItem_actionPerformed(ActionEvent e)
{
viewport.setRenderGaps(renderGapsMenuItem.isSelected());
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(false, false);
}
public FeatureSettings featureSettings;
public void showSeqFeatures_actionPerformed(ActionEvent evt)
{
viewport.setShowSequenceFeatures(showSeqFeatures.isSelected());
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(true, true);
}
/**
viewport.setGlobalColourScheme(cs);
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(true, true);
}
/**
viewport.getAlignment().getSequenceAt(0));
addHistoryItem(new OrderCommand("Pairwise Sort", oldOrder,
viewport.getAlignment()));
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(true, false);
}
/**
AlignmentSorter.sortByID(viewport.getAlignment());
addHistoryItem(
new OrderCommand("ID Sort", oldOrder, viewport.getAlignment()));
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(true, false);
}
/**
AlignmentSorter.sortByLength(viewport.getAlignment());
addHistoryItem(new OrderCommand("Length Sort", oldOrder,
viewport.getAlignment()));
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(true, false);
}
/**
addHistoryItem(new OrderCommand("Group Sort", oldOrder,
viewport.getAlignment()));
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(true, false);
}
/**
addHistoryItem(new OrderCommand(order.getName(), oldOrder,
viewport.getAlignment()));
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(true, false);
}
});
}
viewport.getAlignment());// ,viewport.getSelectionGroup());
addHistoryItem(new OrderCommand("Sort by " + scoreLabel, oldOrder,
viewport.getAlignment()));
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(true, false);
}
});
}
addHistoryItem(new OrderCommand(undoname, oldOrder,
viewport.getAlignment()));
}
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(true, false);
return true;
}
// Java's Transferable for native dnd
evt.acceptDrop(DnDConstants.ACTION_COPY_OR_MOVE);
Transferable t = evt.getTransferable();
- List<String> files = new ArrayList<>();
+ final AlignFrame thisaf = this;
+ final List<String> files = new ArrayList<>();
List<DataSourceType> protocols = new ArrayList<>();
try
}
if (files != null)
{
- try
+ new Thread(new Runnable()
{
- // check to see if any of these files have names matching sequences in
- // the alignment
- SequenceIdMatcher idm = new SequenceIdMatcher(
- viewport.getAlignment().getSequencesArray());
- /**
- * Object[] { String,SequenceI}
- */
- ArrayList<Object[]> filesmatched = new ArrayList<>();
- ArrayList<String> filesnotmatched = new ArrayList<>();
- for (int i = 0; i < files.size(); i++)
+ @Override
+ public void run()
{
- String file = files.get(i).toString();
- String pdbfn = "";
- DataSourceType protocol = FormatAdapter.checkProtocol(file);
- if (protocol == DataSourceType.FILE)
- {
- File fl = new File(file);
- pdbfn = fl.getName();
- }
- else if (protocol == DataSourceType.URL)
- {
- URL url = new URL(file);
- pdbfn = url.getFile();
- }
- if (pdbfn.length() > 0)
+ try
{
- // attempt to find a match in the alignment
- SequenceI[] mtch = idm.findAllIdMatches(pdbfn);
- int l = 0, c = pdbfn.indexOf(".");
- while (mtch == null && c != -1)
+ // check to see if any of these files have names matching sequences
+ // in
+ // the alignment
+ SequenceIdMatcher idm = new SequenceIdMatcher(
+ viewport.getAlignment().getSequencesArray());
+ /**
+ * Object[] { String,SequenceI}
+ */
+ ArrayList<Object[]> filesmatched = new ArrayList<>();
+ ArrayList<String> filesnotmatched = new ArrayList<>();
+ for (int i = 0; i < files.size(); i++)
{
- do
- {
- l = c;
- } while ((c = pdbfn.indexOf(".", l)) > l);
- if (l > -1)
+ String file = files.get(i).toString();
+ String pdbfn = "";
+ DataSourceType protocol = FormatAdapter.checkProtocol(file);
+ if (protocol == DataSourceType.FILE)
{
- pdbfn = pdbfn.substring(0, l);
+ File fl = new File(file);
+ pdbfn = fl.getName();
}
- mtch = idm.findAllIdMatches(pdbfn);
- }
- if (mtch != null)
- {
- FileFormatI type = null;
- try
- {
- type = new IdentifyFile().identify(file, protocol);
- } catch (Exception ex)
+ else if (protocol == DataSourceType.URL)
{
- type = null;
+ URL url = new URL(file);
+ pdbfn = url.getFile();
}
- if (type != null && type.isStructureFile())
+ if (pdbfn.length() > 0)
{
- filesmatched.add(new Object[] { file, protocol, mtch });
- continue;
+ // attempt to find a match in the alignment
+ SequenceI[] mtch = idm.findAllIdMatches(pdbfn);
+ int l = 0, c = pdbfn.indexOf(".");
+ while (mtch == null && c != -1)
+ {
+ do
+ {
+ l = c;
+ } while ((c = pdbfn.indexOf(".", l)) > l);
+ if (l > -1)
+ {
+ pdbfn = pdbfn.substring(0, l);
+ }
+ mtch = idm.findAllIdMatches(pdbfn);
+ }
+ if (mtch != null)
+ {
+ FileFormatI type = null;
+ try
+ {
+ type = new IdentifyFile().identify(file, protocol);
+ } catch (Exception ex)
+ {
+ type = null;
+ }
+ if (type != null && type.isStructureFile())
+ {
+ filesmatched.add(new Object[] { file, protocol, mtch });
+ continue;
+ }
+ }
+ // File wasn't named like one of the sequences or wasn't a PDB
+ // file.
+ filesnotmatched.add(file);
}
}
- // File wasn't named like one of the sequences or wasn't a PDB file.
- filesnotmatched.add(file);
- }
- }
- int assocfiles = 0;
- if (filesmatched.size() > 0)
- {
- if (Cache.getDefault("AUTOASSOCIATE_PDBANDSEQS", false)
- || JvOptionPane.showConfirmDialog(this,
- MessageManager.formatMessage(
- "label.automatically_associate_structure_files_with_sequences_same_name",
- new Object[]
- { Integer.valueOf(filesmatched.size())
- .toString() }),
- MessageManager.getString(
- "label.automatically_associate_structure_files_by_name"),
- JvOptionPane.YES_NO_OPTION) == JvOptionPane.YES_OPTION)
-
- {
- for (Object[] fm : filesmatched)
+ int assocfiles = 0;
+ if (filesmatched.size() > 0)
{
- // try and associate
- // TODO: may want to set a standard ID naming formalism for
- // associating PDB files which have no IDs.
- for (SequenceI toassoc : (SequenceI[]) fm[2])
+ if (Cache.getDefault("AUTOASSOCIATE_PDBANDSEQS", false)
+ || JvOptionPane.showConfirmDialog(thisaf,
+ MessageManager.formatMessage(
+ "label.automatically_associate_structure_files_with_sequences_same_name",
+ new Object[]
+ { Integer.valueOf(filesmatched.size())
+ .toString() }),
+ MessageManager.getString(
+ "label.automatically_associate_structure_files_by_name"),
+ JvOptionPane.YES_NO_OPTION) == JvOptionPane.YES_OPTION)
+
{
- PDBEntry pe = new AssociatePdbFileWithSeq()
- .associatePdbWithSeq((String) fm[0],
- (DataSourceType) fm[1], toassoc, false,
- Desktop.instance);
- if (pe != null)
+ for (Object[] fm : filesmatched)
{
- System.err.println("Associated file : " + ((String) fm[0])
- + " with " + toassoc.getDisplayId(true));
- assocfiles++;
+ // try and associate
+ // TODO: may want to set a standard ID naming formalism for
+ // associating PDB files which have no IDs.
+ for (SequenceI toassoc : (SequenceI[]) fm[2])
+ {
+ PDBEntry pe = new AssociatePdbFileWithSeq()
+ .associatePdbWithSeq((String) fm[0],
+ (DataSourceType) fm[1], toassoc, false,
+ Desktop.instance);
+ if (pe != null)
+ {
+ System.err.println("Associated file : "
+ + ((String) fm[0]) + " with "
+ + toassoc.getDisplayId(true));
+ assocfiles++;
+ }
+ }
+ // TODO: do we need to update overview ? only if features are
+ // shown I guess
+ alignPanel.paintAlignment(true, false);
}
}
- alignPanel.paintAlignment(true);
}
- }
- }
- if (filesnotmatched.size() > 0)
- {
- if (assocfiles > 0 && (Cache.getDefault(
- "AUTOASSOCIATE_PDBANDSEQS_IGNOREOTHERS", false)
- || JvOptionPane.showConfirmDialog(this,
- "<html>" + MessageManager.formatMessage(
- "label.ignore_unmatched_dropped_files_info",
- new Object[]
- { Integer.valueOf(filesnotmatched.size())
- .toString() })
- + "</html>",
- MessageManager.getString(
- "label.ignore_unmatched_dropped_files"),
- JvOptionPane.YES_NO_OPTION) == JvOptionPane.YES_OPTION))
- {
- return;
- }
- for (String fn : filesnotmatched)
+ if (filesnotmatched.size() > 0)
+ {
+ if (assocfiles > 0 && (Cache.getDefault(
+ "AUTOASSOCIATE_PDBANDSEQS_IGNOREOTHERS", false)
+ || JvOptionPane.showConfirmDialog(thisaf,
+ "<html>" + MessageManager.formatMessage(
+ "label.ignore_unmatched_dropped_files_info",
+ new Object[]
+ { Integer.valueOf(
+ filesnotmatched.size())
+ .toString() })
+ + "</html>",
+ MessageManager.getString(
+ "label.ignore_unmatched_dropped_files"),
+ JvOptionPane.YES_NO_OPTION) == JvOptionPane.YES_OPTION))
+ {
+ return;
+ }
+ for (String fn : filesnotmatched)
+ {
+ loadJalviewDataFile(fn, null, null, null);
+ }
+
+ }
+ } catch (Exception ex)
{
- loadJalviewDataFile(fn, null, null, null);
+ ex.printStackTrace();
}
-
}
- } catch (Exception ex)
- {
- ex.printStackTrace();
- }
+ }).start();
}
}
{
if (parseFeaturesFile(file, sourceType))
{
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(true, true);
}
}
else
alignPanel.adjustAnnotationHeight();
viewport.updateSequenceIdColours();
buildSortByAnnotationScoresMenu();
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(true, true);
}
} catch (Exception ex)
{
protected void showUnconservedMenuItem_actionPerformed(ActionEvent e)
{
viewport.setShowUnconserved(showNonconservedMenuItem.getState());
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(false, false);
}
/*
{
PaintRefresher.Refresh(this, viewport.getSequenceSetId());
alignPanel.updateAnnotation();
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(true, true);
}
}
viewport.getAlignment().setSeqrep(null);
PaintRefresher.Refresh(this, viewport.getSequenceSetId());
alignPanel.updateAnnotation();
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(true, true);
}
}
this.alignPanel.av.setSortAnnotationsBy(getAnnotationSortOrder());
this.alignPanel.av
.setShowAutocalculatedAbove(isShowAutoCalculatedAbove());
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(false, false);
}
/**
{
Font font;
- TreeModel currentTree = null;
-
boolean cursorMode = false;
boolean antiAlias = false;
}
/**
- * DOCUMENT ME!
- *
- * @param tree
- * DOCUMENT ME!
- */
- public void setCurrentTree(TreeModel tree)
- {
- currentTree = tree;
- }
-
- /**
- * DOCUMENT ME!
- *
- * @return DOCUMENT ME!
- */
- public TreeModel getCurrentTree()
- {
- return currentTree;
- }
-
- /**
* returns the visible column regions of the alignment
*
* @param selectedRegionOnly
.getStructureSelectionManager(Desktop.instance);
}
- /**
- *
- * @param pdbEntries
- * @return an array of SequenceI arrays, one for each PDBEntry, listing which
- * sequences in the alignment hold a reference to it
- */
- public SequenceI[][] collateForPDB(PDBEntry[] pdbEntries)
- {
- List<SequenceI[]> seqvectors = new ArrayList<SequenceI[]>();
- for (PDBEntry pdb : pdbEntries)
- {
- List<SequenceI> choosenSeqs = new ArrayList<SequenceI>();
- for (SequenceI sq : alignment.getSequences())
- {
- Vector<PDBEntry> pdbRefEntries = sq.getDatasetSequence()
- .getAllPDBEntries();
- if (pdbRefEntries == null)
- {
- continue;
- }
- for (PDBEntry pdbRefEntry : pdbRefEntries)
- {
- if (pdbRefEntry.getId().equals(pdb.getId()))
- {
- if (pdbRefEntry.getChainCode() != null
- && pdb.getChainCode() != null)
- {
- if (pdbRefEntry.getChainCode().equalsIgnoreCase(
- pdb.getChainCode()) && !choosenSeqs.contains(sq))
- {
- choosenSeqs.add(sq);
- continue;
- }
- }
- else
- {
- if (!choosenSeqs.contains(sq))
- {
- choosenSeqs.add(sq);
- continue;
- }
- }
-
- }
- }
- }
- seqvectors
- .add(choosenSeqs.toArray(new SequenceI[choosenSeqs.size()]));
- }
- return seqvectors.toArray(new SequenceI[seqvectors.size()][]);
- }
-
@Override
public boolean isNormaliseSequenceLogo()
{
}
fr.setTransparency(featureSettings.getTransparency());
}
-
}
import jalview.datamodel.SequenceFeature;
import jalview.datamodel.SequenceGroup;
import jalview.datamodel.SequenceI;
+import jalview.io.HTMLOutput;
import jalview.jbgui.GAlignmentPanel;
import jalview.math.AlignmentDimension;
import jalview.schemes.ResidueProperties;
import jalview.structure.StructureSelectionManager;
+import jalview.util.Comparison;
import jalview.util.MessageManager;
import jalview.util.Platform;
import jalview.viewmodel.ViewportListenerI;
{
public AlignViewport av;
- ViewportRanges vpRanges;
-
OverviewPanel overviewPanel;
private SeqPanel seqPanel;
private AnnotationLabels alabels;
- // this value is set false when selection area being dragged
- boolean fastPaint = true;
-
private int hextent = 0;
private int vextent = 0;
{
alignFrame = af;
this.av = av;
- vpRanges = av.getRanges();
setSeqPanel(new SeqPanel(av, this));
setIdPanel(new IdPanel(av, this));
// reset the viewport ranges when the alignment panel is resized
// in particular, this initialises the end residue value when Jalview
// is initialised
+ ViewportRanges ranges = av.getRanges();
if (av.getWrapAlignment())
{
int widthInRes = getSeqPanel().seqCanvas.getWrappedCanvasWidth(
getSeqPanel().seqCanvas.getWidth());
- vpRanges.setViewportWidth(widthInRes);
+ ranges.setViewportWidth(widthInRes);
}
else
{
int heightInSeq = getSeqPanel().seqCanvas.getHeight()
/ av.getCharHeight();
- vpRanges.setViewportWidth(widthInRes);
- vpRanges.setViewportHeight(heightInSeq);
+ ranges.setViewportWidth(widthInRes);
+ ranges.setViewportHeight(heightInSeq);
}
}
alignFrame.updateEditMenuBar();
- paintAlignment(true);
+ // no idea if we need to update structure
+ paintAlignment(true, true);
}
getIdPanel().getIdCanvas().setPreferredSize(d);
hscrollFillerPanel.setPreferredSize(d);
- if (this.alignFrame.getSplitViewContainer() != null)
- {
- ((SplitFrame) this.alignFrame.getSplitViewContainer()).adjustLayout();
- }
-
repaint();
}
*/
public void highlightSearchResults(SearchResultsI results)
{
- scrollToPosition(results);
- getSeqPanel().seqCanvas.highlightSearchResults(results);
- }
+ boolean scrolled = scrollToPosition(results, 0, true, false);
- /**
- * Scroll the view to show the position of the highlighted region in results
- * (if any) and redraw the overview
- *
- * @param results
- */
- public boolean scrollToPosition(SearchResultsI results)
- {
- return scrollToPosition(results, 0, true, false);
+ boolean noFastPaint = scrolled && av.getWrapAlignment();
+
+ getSeqPanel().seqCanvas.highlightSearchResults(results, noFastPaint);
}
/**
}
/**
- * Scroll the view to show the position of the highlighted region in results
- * (if any)
+ * Scrolls the view (if necessary) to show the position of the first
+ * highlighted region in results (if any). Answers true if the view was
+ * scrolled, or false if no matched region was found, or it is already
+ * visible.
*
* @param results
* @param verticalOffset
* - when set, the overview will be recalculated (takes longer)
* @param centre
* if true, try to centre the search results horizontally in the view
- * @return false if results were not found
+ * @return
*/
- public boolean scrollToPosition(SearchResultsI results,
+ protected boolean scrollToPosition(SearchResultsI results,
int verticalOffset, boolean redrawOverview, boolean centre)
{
int startv, endv, starts, ends;
- // TODO: properly locate search results in view when large numbers of hidden
- // columns exist before highlighted region
- // do we need to scroll the panel?
- // TODO: tons of nullpointerexceptions raised here.
- if (results != null && results.getSize() > 0 && av != null
- && av.getAlignment() != null)
- {
- int seqIndex = av.getAlignment().findIndex(results);
- if (seqIndex == -1)
- {
- return false;
- }
- SequenceI seq = av.getAlignment().getSequenceAt(seqIndex);
+ ViewportRanges ranges = av.getRanges();
- int[] r = results.getResults(seq, 0, av.getAlignment().getWidth());
- if (r == null)
- {
- return false;
- }
- int start = r[0];
- int end = r[1];
+ if (results == null || results.isEmpty() || av == null
+ || av.getAlignment() == null)
+ {
+ return false;
+ }
+ int seqIndex = av.getAlignment().findIndex(results);
+ if (seqIndex == -1)
+ {
+ return false;
+ }
+ SequenceI seq = av.getAlignment().getSequenceAt(seqIndex);
- /*
- * To centre results, scroll to positions half the visible width
- * left/right of the start/end positions
- */
- if (centre)
- {
- int offset = (vpRanges.getEndRes() - vpRanges.getStartRes() + 1) / 2
- - 1;
- start = Math.max(start - offset, 0);
- end = end + offset - 1;
- }
- if (start < 0)
- {
- return false;
- }
- if (end == seq.getEnd())
- {
- return false;
- }
- if (av.hasHiddenColumns())
+ int[] r = results.getResults(seq, 0, av.getAlignment().getWidth());
+ if (r == null)
+ {
+ return false;
+ }
+ int start = r[0];
+ int end = r[1];
+
+ /*
+ * To centre results, scroll to positions half the visible width
+ * left/right of the start/end positions
+ */
+ if (centre)
+ {
+ int offset = (ranges.getEndRes() - ranges.getStartRes() + 1) / 2 - 1;
+ start = Math.max(start - offset, 0);
+ end = end + offset - 1;
+ }
+ if (start < 0)
+ {
+ return false;
+ }
+ if (end == seq.getEnd())
+ {
+ return false;
+ }
+
+ if (av.hasHiddenColumns())
+ {
+ HiddenColumns hidden = av.getAlignment().getHiddenColumns();
+ start = hidden.findColumnPosition(start);
+ end = hidden.findColumnPosition(end);
+ if (start == end)
{
- HiddenColumns hidden = av.getAlignment().getHiddenColumns();
- start = hidden.findColumnPosition(start);
- end = hidden.findColumnPosition(end);
- if (start == end)
+ if (!hidden.isVisible(r[0]))
{
- if (!hidden.isVisible(r[0]))
- {
- // don't scroll - position isn't visible
- return false;
- }
+ // don't scroll - position isn't visible
+ return false;
}
}
+ }
- /*
- * allow for offset of target sequence (actually scroll to one above it)
- */
- seqIndex = Math.max(0, seqIndex - verticalOffset);
+ /*
+ * allow for offset of target sequence (actually scroll to one above it)
+ */
+ seqIndex = Math.max(0, seqIndex - verticalOffset);
+ boolean scrollNeeded = true;
- if (!av.getWrapAlignment())
+ if (!av.getWrapAlignment())
+ {
+ if ((startv = ranges.getStartRes()) >= start)
{
- if ((startv = vpRanges.getStartRes()) >= start)
- {
- /*
- * Scroll left to make start of search results visible
- */
- setScrollValues(start, seqIndex);
- }
- else if ((endv = vpRanges.getEndRes()) <= end)
- {
- /*
- * Scroll right to make end of search results visible
- */
- setScrollValues(startv + end - endv, seqIndex);
- }
- else if ((starts = vpRanges.getStartSeq()) > seqIndex)
- {
- /*
- * Scroll up to make start of search results visible
- */
- setScrollValues(vpRanges.getStartRes(), seqIndex);
- }
- else if ((ends = vpRanges.getEndSeq()) <= seqIndex)
- {
- /*
- * Scroll down to make end of search results visible
- */
- setScrollValues(vpRanges.getStartRes(),
- starts + seqIndex - ends + 1);
- }
/*
- * Else results are already visible - no need to scroll
+ * Scroll left to make start of search results visible
*/
+ setScrollValues(start, seqIndex);
}
- else
+ else if ((endv = ranges.getEndRes()) <= end)
{
- vpRanges.scrollToWrappedVisible(start);
+ /*
+ * Scroll right to make end of search results visible
+ */
+ setScrollValues(startv + end - endv, seqIndex);
}
+ else if ((starts = ranges.getStartSeq()) > seqIndex)
+ {
+ /*
+ * Scroll up to make start of search results visible
+ */
+ setScrollValues(ranges.getStartRes(), seqIndex);
+ }
+ else if ((ends = ranges.getEndSeq()) <= seqIndex)
+ {
+ /*
+ * Scroll down to make end of search results visible
+ */
+ setScrollValues(ranges.getStartRes(), starts + seqIndex - ends
+ + 1);
+ }
+ /*
+ * Else results are already visible - no need to scroll
+ */
+ scrollNeeded = false;
+ }
+ else
+ {
+ scrollNeeded = ranges.scrollToWrappedVisible(start);
}
- paintAlignment(redrawOverview);
- return true;
+ paintAlignment(redrawOverview, false);
+
+ return scrollNeeded;
}
/**
}
validateAnnotationDimensions(true);
addNotify();
- paintAlignment(true);
+ // TODO: many places call this method and also paintAlignment with various
+ // different settings. this means multiple redraws are triggered...
+ paintAlignment(true, false);
}
/**
fontChanged();
setAnnotationVisible(av.isShowAnnotation());
boolean wrap = av.getWrapAlignment();
- vpRanges.setStartSeq(0);
+ ViewportRanges ranges = av.getRanges();
+ ranges.setStartSeq(0);
scalePanelHolder.setVisible(!wrap);
hscroll.setVisible(!wrap);
idwidthAdjuster.setVisible(!wrap);
{
int widthInRes = getSeqPanel().seqCanvas
.getWrappedCanvasWidth(canvasWidth);
- vpRanges.setViewportWidth(widthInRes);
+ ranges.setViewportWidth(widthInRes);
}
else
{
- int widthInRes = (canvasWidth / av.getCharWidth()) - 1;
+ int widthInRes = (canvasWidth / av.getCharWidth());
int heightInSeq = (getSeqPanel().seqCanvas.getHeight()
- / av.getCharHeight()) - 1;
+ / av.getCharHeight());
- vpRanges.setViewportWidth(widthInRes);
- vpRanges.setViewportHeight(heightInSeq);
+ ranges.setViewportWidth(widthInRes);
+ ranges.setViewportHeight(heightInSeq);
}
}
return;
}
+ ViewportRanges ranges = av.getRanges();
+
if (evt.getSource() == hscroll)
{
- int oldX = vpRanges.getStartRes();
- int oldwidth = vpRanges.getViewportWidth();
+ int oldX = ranges.getStartRes();
+ int oldwidth = ranges.getViewportWidth();
int x = hscroll.getValue();
int width = getSeqPanel().seqCanvas.getWidth() / av.getCharWidth();
{
return;
}
- vpRanges.setViewportStartAndWidth(x, width);
+ ranges.setViewportStartAndWidth(x, width);
}
else if (evt.getSource() == vscroll)
{
- int oldY = vpRanges.getStartSeq();
- int oldheight = vpRanges.getViewportHeight();
+ int oldY = ranges.getStartSeq();
+ int oldheight = ranges.getViewportHeight();
int y = vscroll.getValue();
int height = getSeqPanel().seqCanvas.getHeight() / av.getCharHeight();
{
return;
}
- vpRanges.setViewportStartAndHeight(y, height);
- }
- if (!fastPaint)
- {
- repaint();
+ ranges.setViewportStartAndHeight(y, height);
}
+ repaint();
}
/**
{
return; // no horizontal scroll when wrapped
}
+ final ViewportRanges ranges = av.getRanges();
+
if (evt.getSource() == vscroll)
{
int newY = vscroll.getValue();
* this prevents infinite recursion of events when the scroll/viewport
* ranges values are the same
*/
- int oldX = vpRanges.getStartRes();
- int oldY = vpRanges.getWrappedScrollPosition(oldX);
+ int oldX = ranges.getStartRes();
+ int oldY = ranges.getWrappedScrollPosition(oldX);
if (oldY == newY)
{
return;
/*
* limit page up/down to one width's worth of positions
*/
- int rowSize = vpRanges.getViewportWidth();
+ int rowSize = ranges.getViewportWidth();
int newX = newY > oldY ? oldX + rowSize : oldX - rowSize;
- vpRanges.setViewportStartAndWidth(Math.max(0, newX), rowSize);
+ ranges.setViewportStartAndWidth(Math.max(0, newX), rowSize);
}
}
else
"Unexpected path through code: Wrapped jar file opened with wrap alignment set in preferences");
// scroll to start of panel
- vpRanges.setStartRes(0);
- vpRanges.setStartSeq(0);
+ ranges.setStartRes(0);
+ ranges.setStartSeq(0);
}
});
}
repaint();
}
- /**
- * Repaint the alignment including the annotations and overview panels (if
- * shown).
+ /* (non-Javadoc)
+ * @see jalview.api.AlignmentViewPanel#paintAlignment(boolean)
*/
@Override
- public void paintAlignment(boolean updateOverview)
+ public void paintAlignment(boolean updateOverview,
+ boolean updateStructures)
{
final AnnotationSorter sorter = new AnnotationSorter(getAlignment(),
av.isShowAutocalculatedAbove());
av.getSortAnnotationsBy());
repaint();
- if (updateOverview)
+ if (updateStructures)
{
- // TODO: determine if this paintAlignment changed structure colours
av.getStructureSelectionManager().sequenceColoursChanged(this);
+ }
+ if (updateOverview)
+ {
if (overviewPanel != null)
{
/*
* set scroll bar positions
*/
- setScrollValues(vpRanges.getStartRes(), vpRanges.getStartSeq());
+ ViewportRanges ranges = av.getRanges();
+ setScrollValues(ranges.getStartRes(), ranges.getStartSeq());
}
/**
*/
private void setScrollingForWrappedPanel(int topLeftColumn)
{
- int scrollPosition = vpRanges.getWrappedScrollPosition(topLeftColumn);
- int maxScroll = vpRanges.getWrappedMaxScroll(topLeftColumn);
+ ViewportRanges ranges = av.getRanges();
+ int scrollPosition = ranges.getWrappedScrollPosition(topLeftColumn);
+ int maxScroll = ranges.getWrappedMaxScroll(topLeftColumn);
/*
* a scrollbar's value can be set to at most (maximum-extent)
{
try
{
- int s, sSize = av.getAlignment().getHeight(), res,
- alwidth = av.getAlignment().getWidth(), g, gSize, f, fSize,
- sy;
+ int sSize = av.getAlignment().getHeight();
+ int alwidth = av.getAlignment().getWidth();
PrintWriter out = new PrintWriter(new FileWriter(imgMapFile));
- out.println(jalview.io.HTMLOutput.getImageMapHTML());
+ out.println(HTMLOutput.getImageMapHTML());
out.println("<img src=\"" + imageName
+ "\" border=\"0\" usemap=\"#Map\" >"
+ "<map name=\"Map\">");
- for (s = 0; s < sSize; s++)
+ for (int s = 0; s < sSize; s++)
{
- sy = s * av.getCharHeight() + scaleHeight;
+ int sy = s * av.getCharHeight() + scaleHeight;
SequenceI seq = av.getAlignment().getSequenceAt(s);
- SequenceFeature[] features = seq.getSequenceFeatures();
SequenceGroup[] groups = av.getAlignment().findAllGroups(seq);
- for (res = 0; res < alwidth; res++)
+ for (int column = 0; column < alwidth; column++)
{
- StringBuilder text = new StringBuilder();
+ StringBuilder text = new StringBuilder(512);
String triplet = null;
if (av.getAlignment().isNucleotide())
{
- triplet = ResidueProperties.nucleotideName
- .get(seq.getCharAt(res) + "");
+ triplet = ResidueProperties.nucleotideName.get(seq
+ .getCharAt(column) + "");
}
else
{
- triplet = ResidueProperties.aa2Triplet
- .get(seq.getCharAt(res) + "");
+ triplet = ResidueProperties.aa2Triplet.get(seq.getCharAt(column)
+ + "");
}
if (triplet == null)
continue;
}
- int alIndex = seq.findPosition(res);
- gSize = groups.length;
- for (g = 0; g < gSize; g++)
+ int seqPos = seq.findPosition(column);
+ int gSize = groups.length;
+ for (int g = 0; g < gSize; g++)
{
if (text.length() < 1)
{
text.append("<area shape=\"rect\" coords=\"")
- .append((idWidth + res * av.getCharWidth()))
+ .append((idWidth + column * av.getCharWidth()))
.append(",").append(sy).append(",")
- .append((idWidth + (res + 1) * av.getCharWidth()))
+ .append((idWidth + (column + 1) * av.getCharWidth()))
.append(",").append((av.getCharHeight() + sy))
.append("\"").append(" onMouseOver=\"toolTip('")
- .append(alIndex).append(" ").append(triplet);
+ .append(seqPos).append(" ").append(triplet);
}
- if (groups[g].getStartRes() < res
- && groups[g].getEndRes() > res)
+ if (groups[g].getStartRes() < column
+ && groups[g].getEndRes() > column)
{
text.append("<br><em>").append(groups[g].getName())
.append("</em>");
}
}
- if (features != null)
+ if (text.length() < 1)
{
- if (text.length() < 1)
- {
- text.append("<area shape=\"rect\" coords=\"")
- .append((idWidth + res * av.getCharWidth()))
- .append(",").append(sy).append(",")
- .append((idWidth + (res + 1) * av.getCharWidth()))
- .append(",").append((av.getCharHeight() + sy))
- .append("\"").append(" onMouseOver=\"toolTip('")
- .append(alIndex).append(" ").append(triplet);
- }
- fSize = features.length;
- for (f = 0; f < fSize; f++)
+ text.append("<area shape=\"rect\" coords=\"")
+ .append((idWidth + column * av.getCharWidth()))
+ .append(",").append(sy).append(",")
+ .append((idWidth + (column + 1) * av.getCharWidth()))
+ .append(",").append((av.getCharHeight() + sy))
+ .append("\"").append(" onMouseOver=\"toolTip('")
+ .append(seqPos).append(" ").append(triplet);
+ }
+ if (!Comparison.isGap(seq.getCharAt(column)))
+ {
+ List<SequenceFeature> features = seq.findFeatures(column, column);
+ for (SequenceFeature sf : features)
{
-
- if ((features[f].getBegin() <= seq.findPosition(res))
- && (features[f].getEnd() >= seq.findPosition(res)))
+ if (sf.isContactFeature())
{
- if (features[f].isContactFeature())
- {
- if (features[f].getBegin() == seq.findPosition(res)
- || features[f].getEnd() == seq
- .findPosition(res))
- {
- text.append("<br>").append(features[f].getType())
- .append(" ").append(features[f].getBegin())
- .append(":").append(features[f].getEnd());
- }
- }
- else
+ text.append("<br>").append(sf.getType()).append(" ")
+ .append(sf.getBegin()).append(":")
+ .append(sf.getEnd());
+ }
+ else
+ {
+ text.append("<br>");
+ text.append(sf.getType());
+ String description = sf.getDescription();
+ if (description != null
+ && !sf.getType().equals(description))
{
- text.append("<br>");
- text.append(features[f].getType());
- if (features[f].getDescription() != null && !features[f]
- .getType().equals(features[f].getDescription()))
- {
- text.append(" ").append(features[f].getDescription());
- }
-
- if (features[f].getValue("status") != null)
- {
- text.append(" (")
- .append(features[f].getValue("status"))
- .append(")");
- }
+ description = description.replace("\"", """);
+ text.append(" ").append(description);
}
}
-
+ String status = sf.getStatus();
+ if (status != null && !"".equals(status))
+ {
+ text.append(" (").append(status).append(")");
+ }
+ }
+ if (text.length() > 1)
+ {
+ text.append("')\"; onMouseOut=\"toolTip()\"; href=\"#\">");
+ out.println(text.toString());
}
- }
- if (text.length() > 1)
- {
- text.append("')\"; onMouseOut=\"toolTip()\"; href=\"#\">");
- out.println(text.toString());
}
}
}
if (annotationPanel != null)
{
annotationPanel.dispose();
+ annotationPanel = null;
}
if (av != null)
{
av.removePropertyChangeListener(propertyChangeListener);
- jalview.structure.StructureSelectionManager ssm = av
- .getStructureSelectionManager();
+ propertyChangeListener = null;
+ StructureSelectionManager ssm = av.getStructureSelectionManager();
ssm.removeStructureViewerListener(getSeqPanel(), null);
ssm.removeSelectionListener(getSeqPanel());
ssm.removeCommandListener(av);
*/
protected void closeChildFrames()
{
+ if (overviewPanel != null)
+ {
+ overviewPanel.dispose();
+ overviewPanel = null;
+ }
if (calculationDialog != null)
{
calculationDialog.closeFrame();
+ calculationDialog = null;
}
}
* @param verticalOffset
* the number of visible sequences to show above the mapped region
*/
- public void scrollToCentre(SearchResultsI sr, int verticalOffset)
+ protected void scrollToCentre(SearchResultsI sr, int verticalOffset)
{
/*
* To avoid jumpy vertical scrolling (if some sequences are gapped or not
if (adjustHeight)
{
// sort, repaint, update overview
- paintAlignment(true);
+ paintAlignment(true, false);
}
else
{
public void propertyChange(PropertyChangeEvent evt)
{
// update this panel's scroll values based on the new viewport ranges values
- int x = vpRanges.getStartRes();
- int y = vpRanges.getStartSeq();
+ ViewportRanges ranges = av.getRanges();
+ int x = ranges.getStartRes();
+ int y = ranges.getStartSeq();
setScrollValues(x, y);
// now update any complementary alignment (its viewport ranges object
private boolean applyToUnselectedSequences;
// currently selected 'annotation type' checkboxes
- private Map<String, String> selectedTypes = new HashMap<String, String>();
+ private Map<String, String> selectedTypes = new HashMap<>();
/**
* Constructor.
// this.ap.alabels.setSize(this.ap.alabels.getSize().width,
// this.ap.annotationPanel.getSize().height);
// this.ap.validate();
- this.ap.paintAlignment(true);
+ this.ap.paintAlignment(true, false);
}
/**
// this.ap.alabels.setSize(this.ap.alabels.getSize().width,
// this.ap.annotationPanel.getSize().height);
// this.ap.validate();
- this.ap.paintAlignment(true);
+ this.ap.paintAlignment(true, false);
}
/**
this.ap.updateAnnotation();
// this.ap.annotationPanel.adjustPanelHeight();
- this.ap.paintAlignment(true);
+ this.ap.paintAlignment(true, false);
}
/**
public static List<String> getAnnotationTypes(AlignmentI alignment,
boolean sequenceSpecificOnly)
{
- List<String> result = new ArrayList<String>();
+ List<String> result = new ArrayList<>();
for (AlignmentAnnotation aa : alignment.getAlignmentAnnotation())
{
if (!sequenceSpecificOnly || aa.sequenceRef != null)
oldcs = av.getGlobalColourScheme();
if (av.getAlignment().getGroups() != null)
{
- oldgroupColours = new Hashtable<SequenceGroup, ColourSchemeI>();
+ oldgroupColours = new Hashtable<>();
for (SequenceGroup sg : ap.av.getAlignment().getGroups())
{
if (sg.getColourScheme() != null)
}
Vector<String> annotItems = getAnnotationItems(
seqAssociated.isSelected());
- annotations = new JComboBox<String>(annotItems);
+ annotations = new JComboBox<>(annotItems);
populateThresholdComboBox(threshold);
getCurrentAnnotation().threshold.value = slider.getValue() / 1000f;
propagateSeqAssociatedThreshold(updateAllAnnotation,
getCurrentAnnotation());
- ap.paintAlignment(false);
+ ap.paintAlignment(false, false);
}
}
colorAlignmentContaining(getCurrentAnnotation(), selectedThresholdItem);
ap.alignmentChanged();
- // ensure all associated views (overviews, structures, etc) are notified of
- // updated colours.
- ap.paintAlignment(true);
}
- protected boolean colorAlignmentContaining(AlignmentAnnotation currentAnn,
+ protected void colorAlignmentContaining(AlignmentAnnotation currentAnn,
int selectedThresholdOption)
{
acg.getInstance(sg, ap.av.getHiddenRepSequences()));
}
}
- return false;
}
}
av.getAlignment().setHiddenColumns(oldHidden);
}
av.sendSelection();
- ap.paintAlignment(true);
+ ap.paintAlignment(true, true);
}
}
updateView();
propagateSeqAssociatedThreshold(updateAllAnnotation,
getCurrentAnnotation());
- ap.paintAlignment(false);
+ ap.paintAlignment(false, false);
}
}
av.getColumnSelection().filterAnnotations(
getCurrentAnnotation().annotations, filterParams);
- if (getActionOption() == ACTION_OPTION_HIDE)
+ boolean hideCols = getActionOption() == ACTION_OPTION_HIDE;
+ if (hideCols)
{
av.hideSelectedColumns();
}
filterParams = null;
av.setAnnotationColumnSelectionState(this);
- ap.paintAlignment(true);
+ // only update overview and structures if columns were hidden
+ ap.paintAlignment(hideCols, hideCols);
}
public HiddenColumns getOldHiddenColumns()
import java.awt.FlowLayout;
import java.awt.event.ActionEvent;
import java.awt.event.ActionListener;
+import java.util.List;
import java.util.Map;
import javax.swing.BorderFactory;
.getString("label.no_features_on_alignment");
if (features)
{
- Map<String, FeatureColourI> displayedFeatureColours = ap
- .getFeatureRenderer().getDisplayedFeatureCols();
FeaturesFile formatter = new FeaturesFile();
SequenceI[] sequences = ap.av.getAlignment().getSequencesArray();
Map<String, FeatureColourI> featureColours = ap.getFeatureRenderer()
.getDisplayedFeatureCols();
+ List<String> featureGroups = ap.getFeatureRenderer()
+ .getDisplayedFeatureGroups();
boolean includeNonPositional = ap.av.isShowNPFeats();
if (GFFFormat.isSelected())
{
- text = new FeaturesFile().printGffFormat(
- ap.av.getAlignment().getDataset().getSequencesArray(),
- displayedFeatureColours, true, ap.av.isShowNPFeats());
- text = formatter.printGffFormat(sequences, featureColours, true,
- includeNonPositional);
+ text = formatter.printGffFormat(sequences, featureColours,
+ featureGroups, includeNonPositional);
}
else
{
- text = new FeaturesFile().printJalviewFormat(
- ap.av.getAlignment().getDataset().getSequencesArray(),
- displayedFeatureColours, true, ap.av.isShowNPFeats()); // ap.av.featuresDisplayed);
- text = formatter.printJalviewFormat(sequences, featureColours, true,
- includeNonPositional);
+ text = formatter.printJalviewFormat(sequences, featureColours,
+ featureGroups, includeNonPositional);
}
}
else
d = ap.annotationSpaceFillerHolder.getPreferredSize();
ap.annotationSpaceFillerHolder
.setPreferredSize(new Dimension(d.width, d.height - dif));
- ap.paintAlignment(true);
+ ap.paintAlignment(true, false);
}
ap.addNotify();
}
}
- ap.paintAlignment(false);
+ ap.paintAlignment(false, false);
PaintRefresher.Refresh(ap, ap.av.getSequenceSetId());
ap.av.sendSelection();
}
sg.addSequence(aa[selectedRow].sequenceRef, false);
}
ap.av.setSelectionGroup(sg);
- ap.paintAlignment(false);
+ ap.paintAlignment(false, false);
PaintRefresher.Refresh(ap, ap.av.getSequenceSetId());
ap.av.sendSelection();
}
}
graphStretchY = evt.getY();
adjustPanelHeight();
- ap.paintAlignment(true);
+ ap.paintAlignment(false, false);
}
else
{
{
fastPaint((int) evt.getNewValue() - (int) evt.getOldValue());
}
+ else if (evt.getPropertyName().equals(ViewportRanges.STARTRESANDSEQ))
+ {
+ fastPaint(((int[]) evt.getNewValue())[0]
+ - ((int[]) evt.getOldValue())[0]);
+ }
+ else if (evt.getPropertyName().equals(ViewportRanges.MOVE_VIEWPORT))
+ {
+ repaint();
+ }
}
}
*/
protected boolean sliderDragging = false;
- protected JComboBox<String> threshold = new JComboBox<String>();
+ protected JComboBox<String> threshold = new JComboBox<>();
protected JComboBox<String> annotations;
sliderDragging = false;
valueChanged(true);
}
- ap.paintAlignment(true);
}
});
}
*/
public Vector<String> getAnnotationItems(boolean isSeqAssociated)
{
- annotationLabels = new HashMap<AlignmentAnnotation, String>();
+ annotationLabels = new HashMap<>();
- Vector<String> list = new Vector<String>();
+ Vector<String> list = new Vector<>();
int index = 1;
int[] anmap = new int[av.getAlignment()
.getAlignmentAnnotation().length];
public void cancel_actionPerformed()
{
reset();
- ap.paintAlignment(true);
+ ap.paintAlignment(true, true);
try
{
frame.setClosed(true);
this.currentAnnotation = annotation;
}
+ /**
+ * update associated view model and trigger any necessary repaints.
+ *
+ * @param updateAllAnnotation
+ */
protected abstract void valueChanged(boolean updateAllAnnotation);
protected abstract void updateView();
IProgressIndicator progressBar = null;
+ @Override
+ protected IProgressIndicator getIProgressIndicator()
+ {
+ return progressBar;
+ }
/**
* add a single PDB structure to a new or existing Jmol view
*
@Override
protected List<StructureViewerBase> getViewersFor(AlignmentPanel apanel)
{
- List<StructureViewerBase> result = new ArrayList<StructureViewerBase>();
+ List<StructureViewerBase> result = new ArrayList<>();
JInternalFrame[] frames = Desktop.instance.getAllFrames();
for (JInternalFrame frame : frames)
@Override
void showSelectedChains()
{
- Vector<String> toshow = new Vector<String>();
+ Vector<String> toshow = new Vector<>();
for (int i = 0; i < chainMenu.getItemCount(); i++)
{
if (chainMenu.getItem(i) instanceof JCheckBoxMenuItem)
// todo - record which pdbids were successfully imported.
StringBuilder errormsgs = new StringBuilder();
- List<String> files = new ArrayList<String>();
+ List<String> files = new ArrayList<>();
String pdbid = "";
try
{
}
@Override
+ protected IProgressIndicator getIProgressIndicator()
+ {
+ return appJmolWindow.progressBar;
+ }
+
+ @Override
public SequenceRenderer getSequenceRenderer(AlignmentViewPanel alignment)
{
return new SequenceRenderer(((AlignmentPanel) alignment).av);
ShiftList offset = new ShiftList();
int ofstart = -1;
int sleng = seq.getLength();
- char[] seqChars = seq.getSequence();
for (int i = 0; i < sleng; i++)
{
- if (Comparison.isGap(seqChars[i]))
+ if (Comparison.isGap(seq.getCharAt(i)))
{
if (ofstart == -1)
{
--- /dev/null
+/*
+ * Copyright (c) 2011, 2012, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation. Oracle designates this
+ * particular file as subject to the "Classpath" exception as provided
+ * by Oracle in the LICENSE file that accompanied this code.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ */
+
+package jalview.gui;
+
+import java.awt.Container;
+import java.beans.PropertyVetoException;
+import java.util.Vector;
+
+import javax.swing.DefaultDesktopManager;
+import javax.swing.DesktopManager;
+import javax.swing.JInternalFrame;
+
+/**
+ * Based on AquaInternalFrameManager
+ *
+ * DesktopManager implementation for Aqua
+ *
+ * Mac is more like Windows than it's like Motif/Basic
+ *
+ * From WindowsDesktopManager:
+ *
+ * This class implements a DesktopManager which more closely follows the MDI
+ * model than the DefaultDesktopManager. Unlike the DefaultDesktopManager
+ * policy, MDI requires that the selected and activated child frames are the
+ * same, and that that frame always be the top-most window.
+ * <p>
+ * The maximized state is managed by the DesktopManager with MDI, instead of
+ * just being a property of the individual child frame. This means that if the
+ * currently selected window is maximized and another window is selected, that
+ * new window will be maximized.
+ *
+ * Downloaded from
+ * https://raw.githubusercontent.com/frohoff/jdk8u-jdk/master/src/macosx/classes/com/apple/laf/AquaInternalFrameManager.java
+ *
+ * Patch from Jim Procter - when the most recently opened frame is closed,
+ * correct behaviour is to go to the next most recent frame, rather than wrap
+ * around to the bottom of the window stack (as the original implementation
+ * does)
+ *
+ * @see com.sun.java.swing.plaf.windows.WindowsDesktopManager
+ */
+public class AquaInternalFrameManager extends DefaultDesktopManager
+{
+ // Variables
+
+ /* The frame which is currently selected/activated.
+ * We store this value to enforce Mac's single-selection model.
+ */
+ JInternalFrame fCurrentFrame;
+
+ JInternalFrame fInitialFrame;
+
+ /* The list of frames, sorted by order of creation.
+ * This list is necessary because by default the order of
+ * child frames in the JDesktopPane changes during frame
+ * activation (the activated frame is moved to index 0).
+ * We preserve the creation order so that "next" and "previous"
+ * frame actions make sense.
+ */
+ Vector<JInternalFrame> fChildFrames = new Vector<>(1);
+
+ /**
+ * keep a reference to the original LAF manager so we can iconise/de-iconise
+ * correctly
+ */
+ private DesktopManager ourManager;
+
+ public AquaInternalFrameManager(DesktopManager desktopManager)
+ {
+ ourManager = desktopManager;
+ }
+
+ @Override
+ public void closeFrame(final JInternalFrame f)
+ {
+ if (f == fCurrentFrame)
+ {
+ boolean mostRecentFrame = fChildFrames
+ .indexOf(f) == fChildFrames.size() - 1;
+ if (!mostRecentFrame)
+ {
+ activateNextFrame();
+ }
+ else
+ {
+ activatePreviousFrame();
+ }
+ }
+ fChildFrames.removeElement(f);
+ super.closeFrame(f);
+ }
+
+ @Override
+ public void deiconifyFrame(final JInternalFrame f)
+ {
+ JInternalFrame.JDesktopIcon desktopIcon;
+
+ desktopIcon = f.getDesktopIcon();
+ // If the icon moved, move the frame to that spot before expanding it
+ // reshape does delta checks for us
+ f.reshape(desktopIcon.getX(), desktopIcon.getY(), f.getWidth(),
+ f.getHeight());
+ ourManager.deiconifyFrame(f);
+ }
+
+ void addIcon(final Container c,
+ final JInternalFrame.JDesktopIcon desktopIcon)
+ {
+ c.add(desktopIcon);
+ }
+
+ /**
+ * Removes the frame from its parent and adds its desktopIcon to the parent.
+ */
+ @Override
+ public void iconifyFrame(final JInternalFrame f)
+ {
+ ourManager.iconifyFrame(f);
+ }
+
+ // WindowsDesktopManager code
+ @Override
+ public void activateFrame(final JInternalFrame f)
+ {
+ try
+ {
+ if (f != null)
+ {
+ super.activateFrame(f);
+ }
+
+ // If this is the first activation, add to child list.
+ if (fChildFrames.indexOf(f) == -1)
+ {
+ fChildFrames.addElement(f);
+ }
+
+ if (fCurrentFrame != null && f != fCurrentFrame)
+ {
+ if (fCurrentFrame.isSelected())
+ {
+ fCurrentFrame.setSelected(false);
+ }
+ }
+
+ if (f != null && !f.isSelected())
+ {
+ f.setSelected(true);
+ }
+
+ fCurrentFrame = f;
+ } catch (final PropertyVetoException e)
+ {
+ }
+ }
+
+ private void switchFrame(final boolean next)
+ {
+ if (fCurrentFrame == null)
+ {
+ // initialize first frame we find
+ if (fInitialFrame != null)
+ {
+ activateFrame(fInitialFrame);
+ }
+ return;
+ }
+
+ final int count = fChildFrames.size();
+ if (count <= 1)
+ {
+ // No other child frames.
+ return;
+ }
+
+ final int currentIndex = fChildFrames.indexOf(fCurrentFrame);
+ if (currentIndex == -1)
+ {
+ // the "current frame" is no longer in the list
+ fCurrentFrame = null;
+ return;
+ }
+
+ int nextIndex;
+ if (next)
+ {
+ nextIndex = currentIndex + 1;
+ if (nextIndex == count)
+ {
+ nextIndex = 0;
+ }
+ }
+ else
+ {
+ nextIndex = currentIndex - 1;
+ if (nextIndex == -1)
+ {
+ nextIndex = count - 1;
+ }
+ }
+ final JInternalFrame f = fChildFrames.elementAt(nextIndex);
+ activateFrame(f);
+ fCurrentFrame = f;
+ }
+
+ /**
+ * Activate the next child JInternalFrame, as determined by the frames'
+ * Z-order. If there is only one child frame, it remains activated. If there
+ * are no child frames, nothing happens.
+ */
+ public void activateNextFrame()
+ {
+ switchFrame(true);
+ }
+
+ /**
+ * same as above but will activate a frame if none have been selected
+ */
+ public void activateNextFrame(final JInternalFrame f)
+ {
+ fInitialFrame = f;
+ switchFrame(true);
+ }
+
+ /**
+ * Activate the previous child JInternalFrame, as determined by the frames'
+ * Z-order. If there is only one child frame, it remains activated. If there
+ * are no child frames, nothing happens.
+ */
+ public void activatePreviousFrame()
+ {
+ switchFrame(false);
+ }
+}
\ No newline at end of file
List<String> tips = new ArrayList<String>();
+ /*
+ * the most recently opened PCA results panel
+ */
+ private PCAPanel pcaPanel;
+
/**
* Constructor
*
JvOptionPane.WARNING_MESSAGE);
return;
}
- new PCAPanel(af.alignPanel, modelName, params);
+ pcaPanel = new PCAPanel(af.alignPanel, modelName, params);
}
/**
{
}
}
+
+ public PCAPanel getPcaPanel()
+ {
+ return pcaPanel;
+ }
}
@Override
protected List<StructureViewerBase> getViewersFor(AlignmentPanel ap)
{
- List<StructureViewerBase> result = new ArrayList<StructureViewerBase>();
+ List<StructureViewerBase> result = new ArrayList<>();
JInternalFrame[] frames = Desktop.instance.getAllFrames();
for (JInternalFrame frame : frames)
@Override
void showSelectedChains()
{
- List<String> toshow = new ArrayList<String>();
+ List<String> toshow = new ArrayList<>();
for (int i = 0; i < chainMenu.getItemCount(); i++)
{
if (chainMenu.getItem(i) instanceof JCheckBoxMenuItem)
// todo - record which pdbids were successfully imported.
StringBuilder errormsgs = new StringBuilder(128);
StringBuilder files = new StringBuilder(128);
- List<PDBEntry> filePDB = new ArrayList<PDBEntry>();
- List<Integer> filePDBpos = new ArrayList<Integer>();
+ List<PDBEntry> filePDB = new ArrayList<>();
+ List<Integer> filePDBpos = new ArrayList<>();
PDBEntry thePdbEntry = null;
StructureFile pdb = null;
try
stopProgressBar("", startTime);
}
// Explicitly map to the filename used by Chimera ;
+
pdb = jmb.getSsm().setMapping(jmb.getSequence()[pos],
- jmb.getChains()[pos], pe.getFile(), protocol);
+ jmb.getChains()[pos], pe.getFile(), protocol,
+ progressBar);
stashFoundChains(pdb, pe.getFile());
+
} catch (OutOfMemoryError oomerror)
{
new OOMWarning(
/**
* Fetch PDB data and save to a local file. Returns the full path to the file,
- * or null if fetch fails.
+ * or null if fetch fails. TODO: refactor to common with Jmol ? duplication
*
* @param processingEntry
* @return
}
return reply;
}
+
+ @Override
+ protected IProgressIndicator getIProgressIndicator()
+ {
+ return progressBar;
+ }
}
String linkedTitle = MessageManager
.getString("label.linked_view_title");
Desktop.addInternalFrame(sf, linkedTitle, -1, -1);
- sf.adjustDivider();
+ sf.adjustInitialLayout();
// finally add the top, then bottom frame to the view list
xrefViews.add(dna ? copyThis.alignPanel : newFrame.alignPanel);
AlignFrame.DEFAULT_WIDTH, AlignFrame.DEFAULT_HEIGHT);
af.getViewport().setShowSequenceFeatures(showSeqFeatures);
af.getViewport().setFeaturesDisplayed(fd);
- ColourSchemeI cs = ColourSchemeMapper
- .getJalviewColourScheme(colourSchemeName, al);
+ af.setMenusForViewport();
+ ColourSchemeI cs = ColourSchemeMapper.getJalviewColourScheme(
+ colourSchemeName, al);
if (cs != null)
{
af.changeColour(cs);
import java.awt.dnd.DropTargetListener;
import java.awt.event.ActionEvent;
import java.awt.event.ActionListener;
-import java.awt.event.FocusEvent;
-import java.awt.event.FocusListener;
import java.awt.event.KeyEvent;
import java.awt.event.MouseAdapter;
import java.awt.event.MouseEvent;
public void endDraggingFrame(JComponent f)
{
delegate.endDraggingFrame(f);
+ desktop.repaint();
}
@Override
public void endResizingFrame(JComponent f)
{
delegate.endResizingFrame(f);
+ desktop.repaint();
}
@Override
boolean showjconsole = jalview.bin.Cache.getDefault("SHOW_JAVA_CONSOLE",
false);
desktop = new MyDesktopPane(selmemusage);
- if (Platform.isAMac())
- {
- desktop.setDoubleBuffered(false);
- }
showMemusage.setSelected(selmemusage);
desktop.setBackground(Color.white);
getContentPane().setLayout(new BorderLayout());
// This line prevents Windows Look&Feel resizing all new windows to maximum
// if previous window was maximised
desktop.setDesktopManager(
- new MyDesktopManager(new DefaultDesktopManager()));
+ new MyDesktopManager(
+ (Platform.isWindows() ? new DefaultDesktopManager()
+ : Platform.isAMac()
+ ? new AquaInternalFrameManager(
+ desktop.getDesktopManager())
+ : desktop.getDesktopManager())));
Rectangle dims = getLastKnownDimensions("");
if (dims != null)
});
desktop.addMouseListener(ma);
- this.addFocusListener(new FocusListener()
- {
-
- @Override
- public void focusLost(FocusEvent e)
- {
- // TODO Auto-generated method stub
-
- }
-
- @Override
- public void focusGained(FocusEvent e)
- {
- Cache.log.debug("Relaying windows after focus gain");
- // make sure that we sort windows properly after we gain focus
- instance.relayerWindows();
- }
- });
this.setDropTarget(new java.awt.dnd.DropTarget(desktop, this));
// Spawn a thread that shows the splashscreen
SwingUtilities.invokeLater(new Runnable()
frame.setResizable(resizable);
frame.setMaximizable(resizable);
frame.setIconifiable(resizable);
- if (Platform.isAMac())
- {
- frame.setIconifiable(false);
- frame.setFrameIcon(null);
- // frame.setDesktopIcon(null);
- frame.setDoubleBuffered(false);
- }
+
if (frame.getX() < 1 && frame.getY() < 1)
{
frame.setLocation(xOffset * openFrameCount,
JInternalFrame itf = desktop.getSelectedFrame();
if (itf != null)
{
+ if (itf instanceof AlignFrame)
+ {
+ Jalview.setCurrentAlignFrame((AlignFrame) itf);
+ }
itf.requestFocus();
}
}
menuItem.removeActionListener(menuItem.getActionListeners()[0]);
}
windowMenu.remove(menuItem);
- JInternalFrame itf = desktop.getSelectedFrame();
- if (itf != null)
- {
- itf.requestFocus();
- if (itf instanceof AlignFrame)
- {
- Jalview.setCurrentAlignFrame((AlignFrame) itf);
- }
- }
+
System.gc();
};
});
// Java's Transferable for native dnd
evt.acceptDrop(DnDConstants.ACTION_COPY_OR_MOVE);
Transferable t = evt.getTransferable();
- List<String> files = new ArrayList<String>();
- List<DataSourceType> protocols = new ArrayList<DataSourceType>();
+ List<String> files = new ArrayList<>();
+ List<DataSourceType> protocols = new ArrayList<>();
try
{
JPanel progressPanel;
- ArrayList<JPanel> fileLoadingPanels = new ArrayList<JPanel>();
+ ArrayList<JPanel> fileLoadingPanels = new ArrayList<>();
public void startLoading(final String fileName)
{
// TODO: verify that frames are recoverable when in headless mode
return null;
}
- List<AlignmentPanel> aps = new ArrayList<AlignmentPanel>();
+ List<AlignmentPanel> aps = new ArrayList<>();
AlignFrame[] frames = getAlignFrames();
if (frames == null)
{
*/
public static AlignmentViewport[] getViewports(String sequenceSetId)
{
- List<AlignmentViewport> viewp = new ArrayList<AlignmentViewport>();
+ List<AlignmentViewport> viewp = new ArrayList<>();
if (desktop != null)
{
AlignFrame[] frames = Desktop.getAlignFrames();
// SEQUENCE_ID which is not the default EMBL_EBI link
ListIterator<String> li = links.listIterator();
boolean check = false;
- List<JLabel> urls = new ArrayList<JLabel>();
+ List<JLabel> urls = new ArrayList<>();
while (li.hasNext())
{
String link = li.next();
if (link.contains(SEQUENCE_ID)
- && !link.equals(UrlConstants.DEFAULT_STRING))
+ && !UrlConstants.isDefaultString(link))
{
check = true;
int barPos = link.indexOf("|");
Thread worker = new Thread(this);
worker.start();
}
+ repaint();
}
public boolean isShowMemoryUsage()
}
}
- /**
- * fixes stacking order after a modal dialog to ensure windows that should be
- * on top actually are
- */
- public void relayerWindows()
- {
-
- }
/**
* Accessor method to quickly get all the AlignmentFrames loaded.
{
return null;
}
- List<AlignFrame> avp = new ArrayList<AlignFrame>();
+ List<AlignFrame> avp = new ArrayList<>();
// REVERSE ORDER
for (int i = frames.length - 1; i > -1; i--)
{
{
return null;
}
- List<GStructureViewer> avp = new ArrayList<GStructureViewer>();
+ List<GStructureViewer> avp = new ArrayList<>();
// REVERSE ORDER
for (int i = frames.length - 1; i > -1; i--)
{
{
if (progressBars == null)
{
- progressBars = new Hashtable<Long, JPanel>();
- progressBarHandlers = new Hashtable<Long, IProgressIndicatorHandler>();
+ progressBars = new Hashtable<>();
+ progressBarHandlers = new Hashtable<>();
}
if (progressBars.get(new Long(id)) != null)
import java.awt.FlowLayout;
import java.awt.event.ActionEvent;
import java.awt.event.ActionListener;
+import java.awt.event.FocusAdapter;
+import java.awt.event.FocusEvent;
import java.awt.event.MouseAdapter;
import java.awt.event.MouseEvent;
*/
if (ap != null)
{
- ap.paintAlignment(true);
+ ap.paintAlignment(true, true);
}
}
});
thresholdValue_actionPerformed();
}
});
+ thresholdValue.addFocusListener(new FocusAdapter()
+ {
+ @Override
+ public void focusLost(FocusEvent e)
+ {
+ thresholdValue_actionPerformed();
+ }
+ });
slider.setPaintLabels(false);
slider.setPaintTicks(true);
slider.setBackground(Color.white);
* feature type, and repaints the alignment, and optionally the Overview
* and/or structure viewer if open
*
- * @param updateOverview
+ * @param updateStructsAndOverview
*/
- void changeColour(boolean updateOverview)
+ void changeColour(boolean updateStructsAndOverview)
{
// Check if combobox is still adjusting
if (adjusting)
}
fr.setColour(type, acg);
cs = acg;
- ap.paintAlignment(updateOverview);
+ ap.paintAlignment(updateStructsAndOverview, updateStructsAndOverview);
}
@Override
void reset()
{
fr.setColour(type, oldcs);
- ap.paintAlignment(true);
+ ap.paintAlignment(true, true);
cs = null;
}
/*
* force repaint of any Overview window or structure
*/
- ap.paintAlignment(true);
+ ap.paintAlignment(true, true);
} catch (NumberFormatException ex)
{
}
import java.awt.event.ItemListener;
import java.awt.event.MouseAdapter;
import java.awt.event.MouseEvent;
+import java.util.ArrayList;
import java.util.Arrays;
import java.util.Comparator;
import java.util.List;
if (!create && features.size() > 1)
{
/*
- * more than one feature at selected position - add a drop-down
- * to choose the feature to amend
+ * more than one feature at selected position -
+ * add a drop-down to choose the feature to amend
+ * space pad text if necessary to make entries distinct
*/
gridPanel = new JPanel(new GridLayout(4, 1));
JPanel choosePanel = new JPanel();
choosePanel.add(new JLabel(
MessageManager.getString("label.select_feature") + ":"));
- final JComboBox<String> overlaps = new JComboBox<String>();
+ final JComboBox<String> overlaps = new JComboBox<>();
+ List<String> added = new ArrayList<>();
for (SequenceFeature sf : features)
{
- String text = sf.getType() + "/" + sf.getBegin() + "-" + sf.getEnd()
- + " (" + sf.getFeatureGroup() + ")";
+ String text = String.format("%s/%d-%d (%s)", sf.getType(),
+ sf.getBegin(), sf.getEnd(), sf.getFeatureGroup());
+ while (added.contains(text))
+ {
+ text += " ";
+ }
overlaps.addItem(text);
+ added.add(text);
}
choosePanel.add(overlaps);
highlight.addResult(sequences.get(0), sf.getBegin(),
sf.getEnd());
- alignPanel.getSeqPanel().seqCanvas
- .highlightSearchResults(highlight);
-
+ alignPanel.getSeqPanel().seqCanvas.highlightSearchResults(
+ highlight, false);
}
FeatureColourI col = getFeatureStyle(name.getText());
if (col == null)
FeaturesFile ffile = new FeaturesFile();
- String enteredType = name.getText().trim();
+ final String enteredType = name.getText().trim();
+ final String enteredGroup = group.getText().trim();
+ final String enteredDescription = description.getText().replaceAll("\n", " ");
+
if (reply == JvOptionPane.OK_OPTION && enteredType.length() > 0)
{
/*
if (useLastDefaults)
{
lastFeatureAdded = enteredType;
- lastFeatureGroupAdded = group.getText().trim();
+ lastFeatureGroupAdded = enteredGroup;
// TODO: determine if the null feature group is valid
if (lastFeatureGroupAdded.length() < 1)
{
{
/*
* YES_OPTION corresponds to the Amend button
- * need to refresh Feature Settings if type, group or colour changed
+ * need to refresh Feature Settings if type, group or colour changed;
+ * note we don't force the feature to be visible - the user has been
+ * warned if a hidden feature type or group was entered
*/
- sf.type = enteredType;
- sf.featureGroup = group.getText().trim();
- sf.description = description.getText().replaceAll("\n", " ");
- boolean refreshSettings = (!featureType.equals(sf.type)
- || !featureGroup.equals(sf.featureGroup));
+ boolean refreshSettings = (!featureType.equals(enteredType) || !featureGroup
+ .equals(enteredGroup));
refreshSettings |= (fcol != oldcol);
-
- setColour(sf.type, fcol);
-
+ setColour(enteredType, fcol);
+ int newBegin = sf.begin;
+ int newEnd = sf.end;
try
{
- sf.begin = ((Integer) start.getValue()).intValue();
- sf.end = ((Integer) end.getValue()).intValue();
+ newBegin = ((Integer) start.getValue()).intValue();
+ newEnd = ((Integer) end.getValue()).intValue();
} catch (NumberFormatException ex)
{
+ // JSpinner doesn't accept invalid format data :-)
}
- ffile.parseDescriptionHTML(sf, false);
+ /*
+ * replace the feature by deleting it and adding a new one
+ * (to ensure integrity of SequenceFeatures data store)
+ */
+ sequences.get(0).deleteFeature(sf);
+ SequenceFeature newSf = new SequenceFeature(sf, enteredType,
+ newBegin, newEnd, enteredGroup, sf.getScore());
+ newSf.setDescription(enteredDescription);
+ ffile.parseDescriptionHTML(newSf, false);
+ // amend features dialog only updates one sequence at a time
+ sequences.get(0).addSequenceFeature(newSf);
+
if (refreshSettings)
{
featuresAdded();
for (int i = 0; i < sequences.size(); i++)
{
SequenceFeature sf = features.get(i);
- sf.type = enteredType;
- // fix for JAL-1538 - always set feature group here
- sf.featureGroup = group.getText().trim();
- sf.description = description.getText().replaceAll("\n", " ");
- sequences.get(i).addSequenceFeature(sf);
- ffile.parseDescriptionHTML(sf, false);
+ SequenceFeature sf2 = new SequenceFeature(enteredType,
+ enteredDescription, sf.getBegin(), sf.getEnd(),
+ enteredGroup);
+ ffile.parseDescriptionHTML(sf2, false);
+ sequences.get(i).addSequenceFeature(sf2);
}
setColour(enteredType, fcol);
featuresAdded();
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(true, true);
return true;
}
}
}
- alignPanel.paintAlignment(true);
+ alignPanel.paintAlignment(true, true);
return true;
}
import jalview.api.FeatureColourI;
import jalview.api.FeatureSettingsControllerI;
import jalview.bin.Cache;
-import jalview.datamodel.SequenceFeature;
+import jalview.datamodel.AlignmentI;
import jalview.datamodel.SequenceI;
import jalview.gui.Help.HelpId;
import jalview.io.JalviewFileChooser;
private static final int MIN_WIDTH = 400;
private static final int MIN_HEIGHT = 400;
+
+ /**
+ * when true, constructor is still executing - so ignore UI events
+ */
+ protected volatile boolean inConstruction = true;
/**
* Constructor
};
});
frame.setLayer(JLayeredPane.PALETTE_LAYER);
+ inConstruction = false;
}
protected void popupSort(final int selectedRow, final String type,
private boolean handlingUpdate = false;
/**
- * contains a float[3] for each feature type string. created by setTableData
+ * holds {featureCount, totalExtent} for each feature type
*/
Map<String, float[]> typeWidth = null;
@Override
synchronized public void discoverAllFeatureData()
{
- Vector<String> allFeatures = new Vector<String>();
- Vector<String> allGroups = new Vector<String>();
- SequenceFeature[] tmpfeatures;
- String group;
- for (int i = 0; i < af.getViewport().getAlignment().getHeight(); i++)
- {
- tmpfeatures = af.getViewport().getAlignment().getSequenceAt(i)
- .getSequenceFeatures();
- if (tmpfeatures == null)
- {
- continue;
- }
+ Set<String> allGroups = new HashSet<>();
+ AlignmentI alignment = af.getViewport().getAlignment();
- int index = 0;
- while (index < tmpfeatures.length)
+ for (int i = 0; i < alignment.getHeight(); i++)
+ {
+ SequenceI seq = alignment.getSequenceAt(i);
+ for (String group : seq.getFeatures().getFeatureGroups(true))
{
- if (tmpfeatures[index].begin == 0 && tmpfeatures[index].end == 0)
+ if (group != null && !allGroups.contains(group))
{
- index++;
- continue;
+ allGroups.add(group);
+ checkGroupState(group);
}
-
- if (tmpfeatures[index].getFeatureGroup() != null)
- {
- group = tmpfeatures[index].featureGroup;
- if (!allGroups.contains(group))
- {
- allGroups.addElement(group);
- checkGroupState(group);
- }
- }
-
- if (!allFeatures.contains(tmpfeatures[index].getType()))
- {
- allFeatures.addElement(tmpfeatures[index].getType());
- }
- index++;
}
}
final String grp = group;
final JCheckBox check = new JCheckBox(group, visible);
check.setFont(new Font("Serif", Font.BOLD, 12));
+ check.setToolTipText(group);
check.addItemListener(new ItemListener()
{
@Override
public void itemStateChanged(ItemEvent evt)
{
fr.setGroupVisibility(check.getText(), check.isSelected());
- af.alignPanel.getSeqPanel().seqCanvas.repaint();
- if (af.alignPanel.overviewPanel != null)
- {
- af.alignPanel.overviewPanel.updateOverviewImage();
- }
-
resetTable(new String[] { grp });
+ af.alignPanel.paintAlignment(true, true);
}
});
groupPanel.add(check);
synchronized void resetTable(String[] groupChanged)
{
- if (resettingTable == true)
+ if (resettingTable)
{
return;
}
resettingTable = true;
- typeWidth = new Hashtable<String, float[]>();
+ typeWidth = new Hashtable<>();
// TODO: change avWidth calculation to 'per-sequence' average and use long
// rather than float
- float[] avWidth = null;
- SequenceFeature[] tmpfeatures;
- String group = null, type;
- Vector<String> visibleChecks = new Vector<String>();
- Set<String> foundGroups = new HashSet<String>();
-
- // Find out which features should be visible depending on which groups
- // are selected / deselected
- // and recompute average width ordering
+
+ Set<String> displayableTypes = new HashSet<>();
+ Set<String> foundGroups = new HashSet<>();
+
+ /*
+ * determine which feature types may be visible depending on
+ * which groups are selected, and recompute average width data
+ */
for (int i = 0; i < af.getViewport().getAlignment().getHeight(); i++)
{
- tmpfeatures = af.getViewport().getAlignment().getSequenceAt(i)
- .getSequenceFeatures();
- if (tmpfeatures == null)
- {
- continue;
- }
+ SequenceI seq = af.getViewport().getAlignment().getSequenceAt(i);
- int index = 0;
- while (index < tmpfeatures.length)
+ /*
+ * get the sequence's groups for positional features
+ * and keep track of which groups are visible
+ */
+ Set<String> groups = seq.getFeatures().getFeatureGroups(true);
+ Set<String> visibleGroups = new HashSet<>();
+ for (String group : groups)
{
- group = tmpfeatures[index].featureGroup;
- foundGroups.add(group);
-
- if (tmpfeatures[index].begin == 0 && tmpfeatures[index].end == 0)
- {
- index++;
- continue;
- }
-
if (group == null || checkGroupState(group))
{
- type = tmpfeatures[index].getType();
- if (!visibleChecks.contains(type))
- {
- visibleChecks.addElement(type);
- }
- }
- if (!typeWidth.containsKey(tmpfeatures[index].getType()))
- {
- typeWidth.put(tmpfeatures[index].getType(),
- avWidth = new float[3]);
+ visibleGroups.add(group);
}
- else
- {
- avWidth = typeWidth.get(tmpfeatures[index].getType());
- }
- avWidth[0]++;
- if (tmpfeatures[index].getBegin() > tmpfeatures[index].getEnd())
- {
- avWidth[1] += 1 + tmpfeatures[index].getBegin()
- - tmpfeatures[index].getEnd();
- }
- else
+ }
+ foundGroups.addAll(groups);
+
+ /*
+ * get distinct feature types for visible groups
+ * record distinct visible types, and their count and total length
+ */
+ Set<String> types = seq.getFeatures().getFeatureTypesForGroups(true,
+ visibleGroups.toArray(new String[visibleGroups.size()]));
+ for (String type : types)
+ {
+ displayableTypes.add(type);
+ float[] avWidth = typeWidth.get(type);
+ if (avWidth == null)
{
- avWidth[1] += 1 + tmpfeatures[index].getEnd()
- - tmpfeatures[index].getBegin();
+ avWidth = new float[2];
+ typeWidth.put(type, avWidth);
}
- index++;
+ // todo this could include features with a non-visible group
+ // - do we greatly care?
+ // todo should we include non-displayable features here, and only
+ // update when features are added?
+ avWidth[0] += seq.getFeatures().getFeatureCount(true, type);
+ avWidth[1] += seq.getFeatures().getTotalFeatureLength(type);
}
}
- int fSize = visibleChecks.size();
- Object[][] data = new Object[fSize][3];
+ Object[][] data = new Object[displayableTypes.size()][3];
int dataIndex = 0;
if (fr.hasRenderOrder())
List<String> frl = fr.getRenderOrder();
for (int ro = frl.size() - 1; ro > -1; ro--)
{
- type = frl.get(ro);
+ String type = frl.get(ro);
- if (!visibleChecks.contains(type))
+ if (!displayableTypes.contains(type))
{
continue;
}
data[dataIndex][2] = new Boolean(
af.getViewport().getFeaturesDisplayed().isVisible(type));
dataIndex++;
- visibleChecks.removeElement(type);
+ displayableTypes.remove(type);
}
}
- fSize = visibleChecks.size();
- for (int i = 0; i < fSize; i++)
+ /*
+ * process any extra features belonging only to
+ * a group which was just selected
+ */
+ while (!displayableTypes.isEmpty())
{
- // These must be extra features belonging to the group
- // which was just selected
- type = visibleChecks.elementAt(i).toString();
+ String type = displayableTypes.iterator().next();
data[dataIndex][0] = type;
data[dataIndex][1] = fr.getFeatureStyle(type);
data[dataIndex][2] = new Boolean(true);
dataIndex++;
+ displayableTypes.remove(type);
}
if (originalData == null)
{
if (fr.setFeaturePriority(data, visibleNew))
{
- af.alignPanel.paintAlignment(true);
+ af.alignPanel.paintAlignment(true, true);
}
}
@Override
public void stateChanged(ChangeEvent evt)
{
- fr.setTransparency((100 - transparency.getValue()) / 100f);
- af.alignPanel.paintAlignment(true);
+ if (!inConstruction)
+ {
+ fr.setTransparency((100 - transparency.getValue()) / 100f);
+ af.alignPanel.paintAlignment(true,true);
+ }
}
});
for (SearchResultMatchI match : searchResults.getResults())
{
seqs.add(match.getSequence().getDatasetSequence());
- features.add(new SequenceFeature(searchString, desc, null,
- match.getStart(), match.getEnd(), desc));
+ features.add(new SequenceFeature(searchString, desc,
+ match
+ .getStart(), match.getEnd(), desc));
}
if (ap.getSeqPanel().seqCanvas.getFeatureRenderer().amendFeatures(seqs,
{
ap.av.antiAlias = smoothFont.isSelected();
ap.getAnnotationPanel().image = null;
- ap.paintAlignment(true);
+ ap.paintAlignment(true, false);
if (ap.av.getCodingComplement() != null && ap.av.isProteinFontAsCdna())
{
((AlignViewport) ap.av
ap.av.setScaleProteinAsCdna(oldProteinScale);
ap.av.setProteinFontAsCdna(oldMirrorFont);
ap.av.antiAlias = oldSmoothFont;
- ap.paintAlignment(true);
+ ap.fontChanged();
if (scaleAsCdna.isVisible() && scaleAsCdna.isEnabled())
{
* is removed with a second call with same ID.
*
* @param message
- * - displayed message for operation
+ * - displayed message for operation. Please ensure message is
+ * internationalised.
* @param id
* - unique handle for this indicator
*/
{
fastPaint((int) evt.getNewValue() - (int) evt.getOldValue());
}
+ else if (propertyName.equals(ViewportRanges.STARTRESANDSEQ))
+ {
+ fastPaint(((int[]) evt.getNewValue())[1]
+ - ((int[]) evt.getOldValue())[1]);
+ }
+ else if (propertyName.equals(ViewportRanges.MOVE_VIEWPORT))
+ {
+ repaint();
+ }
}
}
}
lastid = seq;
- alignPanel.paintAlignment(false);
+ alignPanel.paintAlignment(false, false);
}
/**
{
av.getRanges().scrollRight(true);
}
- else if (!av.getWrapAlignment())
+ else
{
av.getRanges().scrollUp(false);
}
{
av.getRanges().scrollRight(false);
}
- else if (!av.getWrapAlignment())
+ else
{
av.getRanges().scrollUp(true);
}
av.isSelectionGroupChanged(true);
- alignPanel.paintAlignment(false);
+ alignPanel.paintAlignment(false, false);
}
/**
{
int seq2 = alignPanel.getSeqPanel().findSeq(e);
Sequence sq = (Sequence) av.getAlignment().getSequenceAt(seq2);
- // build a new links menu based on the current links + any non-positional
- // features
+
+ /*
+ * build a new links menu based on the current links
+ * and any non-positional features
+ */
List<String> nlinks = Preferences.sequenceUrlLinks.getLinksForMenu();
- SequenceFeature sfs[] = sq == null ? null : sq.getSequenceFeatures();
- if (sfs != null)
+ for (SequenceFeature sf : sq.getFeatures().getNonPositionalFeatures())
{
- for (SequenceFeature sf : sfs)
+ if (sf.links != null)
{
- if (sf.begin == sf.end && sf.begin == 0)
+ for (String link : sf.links)
{
- if (sf.links != null && sf.links.size() > 0)
- {
- for (int l = 0, lSize = sf.links.size(); l < lSize; l++)
- {
- nlinks.add(sf.links.elementAt(l));
- }
- }
+ nlinks.add(link);
}
}
}
running = false;
}
- alignPanel.paintAlignment(false);
+ alignPanel.paintAlignment(false, false);
try
{
* @param evt
* DOCUMENT ME!
*/
+ @Override
public void mousePressed(MouseEvent evt)
{
oldX = evt.getX();
* @param evt
* DOCUMENT ME!
*/
+ @Override
public void mouseReleased(MouseEvent evt)
{
active = false;
* @param evt
* DOCUMENT ME!
*/
+ @Override
public void mouseEntered(MouseEvent evt)
{
active = true;
* @param evt
* DOCUMENT ME!
*/
+ @Override
public void mouseExited(MouseEvent evt)
{
active = false;
* @param evt
* DOCUMENT ME!
*/
+ @Override
public void mouseDragged(MouseEvent evt)
{
active = true;
{
viewport.setIdWidth(newWidth);
- ap.paintAlignment(true);
+ ap.paintAlignment(true, false);
}
oldX = evt.getX();
* @param evt
* DOCUMENT ME!
*/
+ @Override
public void mouseMoved(MouseEvent evt)
{
}
* @param evt
* DOCUMENT ME!
*/
+ @Override
public void mouseClicked(MouseEvent evt)
{
}
* @param g
* DOCUMENT ME!
*/
+ @Override
public void paintComponent(Graphics g)
{
g.setColor(Color.white);
import jalview.datamodel.GraphLine;
import jalview.datamodel.PDBEntry;
import jalview.datamodel.RnaViewerModel;
+import jalview.datamodel.SequenceFeature;
import jalview.datamodel.SequenceGroup;
import jalview.datamodel.SequenceI;
import jalview.datamodel.StructureViewerModel;
}
}
- void clearSeqRefs()
- {
- if (_cleartables)
- {
- if (seqRefIds != null)
- {
- seqRefIds.clear();
- }
- if (seqsToIds != null)
- {
- seqsToIds.clear();
- }
- if (incompleteSeqs != null)
- {
- incompleteSeqs.clear();
- }
- // seqRefIds = null;
- // seqsToIds = null;
- }
- else
- {
- // do nothing
- warn("clearSeqRefs called when _cleartables was not set. Doing nothing.");
- // seqRefIds = new Hashtable();
- // seqsToIds = new IdentityHashMap();
- }
- }
-
void initSeqRefs()
{
if (seqsToIds == null)
// TODO: omit sequence features from each alignment view's XML dump if we
// are storing dataset
- if (jds.getSequenceFeatures() != null)
+ List<jalview.datamodel.SequenceFeature> sfs = jds
+ .getSequenceFeatures();
+ for (SequenceFeature sf : sfs)
{
- jalview.datamodel.SequenceFeature[] sf = jds.getSequenceFeatures();
- int index = 0;
- while (index < sf.length)
- {
- Features features = new Features();
+ Features features = new Features();
- features.setBegin(sf[index].getBegin());
- features.setEnd(sf[index].getEnd());
- features.setDescription(sf[index].getDescription());
- features.setType(sf[index].getType());
- features.setFeatureGroup(sf[index].getFeatureGroup());
- features.setScore(sf[index].getScore());
- if (sf[index].links != null)
+ features.setBegin(sf.getBegin());
+ features.setEnd(sf.getEnd());
+ features.setDescription(sf.getDescription());
+ features.setType(sf.getType());
+ features.setFeatureGroup(sf.getFeatureGroup());
+ features.setScore(sf.getScore());
+ if (sf.links != null)
+ {
+ for (int l = 0; l < sf.links.size(); l++)
{
- for (int l = 0; l < sf[index].links.size(); l++)
- {
- OtherData keyValue = new OtherData();
- keyValue.setKey("LINK_" + l);
- keyValue.setValue(sf[index].links.elementAt(l).toString());
- features.addOtherData(keyValue);
- }
+ OtherData keyValue = new OtherData();
+ keyValue.setKey("LINK_" + l);
+ keyValue.setValue(sf.links.elementAt(l).toString());
+ features.addOtherData(keyValue);
}
- if (sf[index].otherDetails != null)
+ }
+ if (sf.otherDetails != null)
+ {
+ String key;
+ Iterator<String> keys = sf.otherDetails.keySet().iterator();
+ while (keys.hasNext())
{
- String key;
- Iterator<String> keys = sf[index].otherDetails.keySet()
- .iterator();
- while (keys.hasNext())
- {
- key = keys.next();
- OtherData keyValue = new OtherData();
- keyValue.setKey(key);
- keyValue.setValue(sf[index].otherDetails.get(key).toString());
- features.addOtherData(keyValue);
- }
+ key = keys.next();
+ OtherData keyValue = new OtherData();
+ keyValue.setKey(key);
+ keyValue.setValue(sf.otherDetails.get(key).toString());
+ features.addOtherData(keyValue);
}
-
- jseq.addFeatures(features);
- index++;
}
+
+ jseq.addFeatures(features);
}
if (jdatasq.getAllPDBEntries() != null)
// SAVE TREES
// /////////////////////////////////
- if (!storeDS && av.currentTree != null)
+ if (!storeDS && av.getCurrentTree() != null)
{
// FIND ANY ASSOCIATED TREES
// NOT IMPLEMENTED FOR HEADLESS STATE AT PRESENT
{
Tree tree = new Tree();
tree.setTitle(tp.getTitle());
- tree.setCurrentTree((av.currentTree == tp.getTree()));
+ tree.setCurrentTree((av.getCurrentTree() == tp.getTree()));
tree.setNewick(tp.getTree().print());
tree.setThreshold(tp.treeCanvas.threshold);
jarInputStreamProvider jprovider = createjarInputStreamProvider(file);
af = loadJalviewAlign(jprovider);
+ af.setMenusForViewport();
} catch (MalformedURLException e)
{
Features[] features = jseqs[i].getFeatures();
for (int f = 0; f < features.length; f++)
{
- jalview.datamodel.SequenceFeature sf = new jalview.datamodel.SequenceFeature(
- features[f].getType(), features[f].getDescription(),
- features[f].getStatus(), features[f].getBegin(),
- features[f].getEnd(), features[f].getFeatureGroup());
-
- sf.setScore(features[f].getScore());
+ SequenceFeature sf = new SequenceFeature(features[f].getType(),
+ features[f].getDescription(), features[f].getBegin(),
+ features[f].getEnd(), features[f].getScore(),
+ features[f].getFeatureGroup());
+ sf.setStatus(features[f].getStatus());
for (int od = 0; od < features[f].getOtherDataCount(); od++)
{
OtherData keyValue = features[f].getOtherData(od);
StructureData filedat = oldFiles.get(id);
String pdbFile = filedat.getFilePath();
SequenceI[] seq = filedat.getSeqList().toArray(new SequenceI[0]);
- binding.getSsm().setMapping(seq, null, pdbFile, DataSourceType.FILE);
+ binding.getSsm().setMapping(seq, null, pdbFile, DataSourceType.FILE,
+ null);
binding.addSequenceForStructFile(pdbFile, seq);
}
// and add the AlignmentPanel's reference to the view panel
}
- public jalview.gui.AlignmentPanel copyAlignPanel(AlignmentPanel ap,
- boolean keepSeqRefs)
+ /**
+ * Provides a 'copy' of an alignment view (on action New View) by 'saving' the
+ * view as XML (but not to file), and then reloading it
+ *
+ * @param ap
+ * @return
+ */
+ public AlignmentPanel copyAlignPanel(AlignmentPanel ap)
{
initSeqRefs();
JalviewModel jm = saveState(ap, null, null, null);
- if (!keepSeqRefs)
- {
- clearSeqRefs();
- jm.getJalviewModelSequence().getViewport(0).setSequenceSetId(null);
- }
- else
- {
- uniqueSetSuffix = "";
- jm.getJalviewModelSequence().getViewport(0).setId(null); // we don't
- // overwrite the
- // view we just
- // copied
- }
+ uniqueSetSuffix = "";
+ jm.getJalviewModelSequence().getViewport(0).setId(null);
+ // we don't overwrite the view we just copied
+
if (this.frefedSequence == null)
{
- frefedSequence = new Vector();
+ frefedSequence = new Vector<SeqFref>();
}
viewportsAdded.clear();
return af.alignPanel;
}
- /**
- * flag indicating if hashtables should be cleared on finalization TODO this
- * flag may not be necessary
- */
- private final boolean _cleartables = true;
-
private Hashtable jvids2vobj;
- /*
- * (non-Javadoc)
- *
- * @see java.lang.Object#finalize()
- */
- @Override
- protected void finalize() throws Throwable
- {
- // really make sure we have no buried refs left.
- if (_cleartables)
- {
- clearSeqRefs();
- }
- this.seqRefIds = null;
- this.seqsToIds = null;
- super.finalize();
- }
-
private void warn(String msg)
{
warn(msg, null);
import jalview.binding.UserColours;
import jalview.binding.Viewport;
import jalview.datamodel.PDBEntry;
+import jalview.datamodel.SequenceFeature;
import jalview.io.FileFormat;
import jalview.schemes.ColourSchemeI;
import jalview.schemes.ColourSchemeProperty;
Features[] features = JSEQ[i].getFeatures();
for (int f = 0; f < features.length; f++)
{
- jalview.datamodel.SequenceFeature sf = new jalview.datamodel.SequenceFeature(
- features[f].getType(), features[f].getDescription(),
- features[f].getStatus(), features[f].getBegin(),
+ SequenceFeature sf = new SequenceFeature(features[f].getType(),
+ features[f].getDescription(), features[f].getBegin(),
features[f].getEnd(), null);
-
+ sf.setStatus(features[f].getStatus());
al.getSequenceAt(i).getDatasetSequence().addSequenceFeature(sf);
}
}
@Override
public void paintComponent(Graphics g)
{
+ // super.paintComponent(g);
+
if (restart)
{
if (lastMiniMe == null)
&& ((getWidth() != od.getWidth())
|| (getHeight() != od.getHeight())))
{
- // if there is annotation, scale the alignment and annotation separately
+ // if there is annotation, scale the alignment and annotation
+ // separately
if (od.getGraphHeight() > 0)
{
BufferedImage topImage = lastMiniMe.getSubimage(0, 0,
od.setHeight(getHeight());
}
- // scale lastMiniMe to the new size
- g.drawImage(lastMiniMe, 0, 0, getWidth(), getHeight(), this);
-
// make sure the box is in the right place
od.setBoxPosition(av.getAlignment().getHiddenSequences(),
av.getAlignment().getHiddenColumns());
}
- else // not a resize
- {
- // fall back to normal behaviour
- g.drawImage(lastMiniMe, 0, 0, getWidth(), getHeight(), this);
- }
+ // fall back to normal behaviour
+ g.drawImage(lastMiniMe, 0, 0, getWidth(), getHeight(), this);
}
-
+ else
+ {
+ g.drawImage(lastMiniMe, 0, 0, getWidth(), getHeight(), this);
+ }
+
// draw the box
g.setColor(Color.red);
od.drawBox(g);
}
+
public void dispose()
{
dispose = true;
import java.awt.event.MouseEvent;
import java.awt.event.MouseMotionAdapter;
import java.beans.PropertyChangeEvent;
+import java.beans.PropertyVetoException;
import javax.swing.JCheckBoxMenuItem;
+import javax.swing.JInternalFrame;
import javax.swing.JPanel;
import javax.swing.JPopupMenu;
import javax.swing.SwingUtilities;
* changed
*
*/
+ private void setBoxPositionOnly()
+ {
+ if (od != null)
+ {
+ int oldX = od.getBoxX();
+ int oldY = od.getBoxY();
+ int oldWidth = od.getBoxWidth();
+ int oldHeight = od.getBoxHeight();
+ od.setBoxPosition(av.getAlignment().getHiddenSequences(),
+ av.getAlignment().getHiddenColumns());
+ repaint(oldX - 1, oldY - 1, oldWidth + 2, oldHeight + 2);
+ repaint(od.getBoxX(), od.getBoxY(), od.getBoxWidth(),
+ od.getBoxHeight());
+ }
+ }
+
private void setBoxPosition()
{
if (od != null)
@Override
public void propertyChange(PropertyChangeEvent evt)
{
- setBoxPosition();
+ setBoxPositionOnly();
}
/**
{
try
{
- av.getRanges().removePropertyChangeListener(this);
+ if (av != null)
+ {
+ av.getRanges().removePropertyChangeListener(this);
+ }
+
oviewCanvas.dispose();
+
+ /*
+ * close the parent frame (which also removes it from the
+ * Desktop Windows menu)
+ */
+ ((JInternalFrame) SwingUtilities.getAncestorOfClass(
+ JInternalFrame.class, (this))).setClosed(true);
+ } catch (PropertyVetoException e)
+ {
+ // ignore
} finally
{
progressPanel = null;
int top = 0;
+ private boolean working;
+
/**
* Creates a new PCAPanel object using default score model and parameters
*
message = MessageManager.getString("label.pca_calculating");
}
progress.setProgressBar(message, progId);
+ working = true;
try
{
calcSettings.setEnabled(false);
} catch (OutOfMemoryError er)
{
new OOMWarning("calculating PCA", er);
+ working = false;
return;
} finally
{
.getString("label.principal_component_analysis"), 475, 450);
this.setMinimumSize(new Dimension(MIN_WIDTH, MIN_HEIGHT));
}
+ working = false;
}
@Override
top = t;
zCombobox.setSelectedIndex(2);
}
+
+ /**
+ * Answers true if PCA calculation is in progress, else false
+ *
+ * @return
+ */
+ public boolean isWorking()
+ {
+ return working;
+ }
}
import java.awt.Component;
import java.util.ArrayList;
import java.util.HashMap;
+import java.util.Iterator;
import java.util.List;
import java.util.Map;
-import java.util.Map.Entry;
/**
* Route datamodel/view update events for a sequence set to any display
*/
public static void RemoveComponent(Component comp)
{
- List<String> emptied = new ArrayList<String>();
- for (Entry<String, List<Component>> registered : components.entrySet())
+ if (components == null)
{
- String id = registered.getKey();
- List<Component> comps = components.get(id);
+ return;
+ }
+
+ Iterator<String> it = components.keySet().iterator();
+ while (it.hasNext())
+ {
+ List<Component> comps = components.get(it.next());
comps.remove(comp);
if (comps.isEmpty())
{
- emptied.add(id);
+ it.remove();
}
}
-
- /*
- * Remove now empty ids after the above (to avoid
- * ConcurrentModificationException).
- */
- for (String id : emptied)
- {
- components.remove(id);
- }
}
public static void Refresh(Component source, String id)
import jalview.analysis.AlignSeq;
import jalview.datamodel.Alignment;
-import jalview.datamodel.Sequence;
+import jalview.datamodel.AlignmentView;
+import jalview.datamodel.SequenceGroup;
import jalview.datamodel.SequenceI;
import jalview.jbgui.GPairwiseAlignPanel;
import jalview.util.MessageManager;
public class PairwiseAlignPanel extends GPairwiseAlignPanel
{
+ private static final String DASHES = "---------------------\n";
+
AlignmentViewport av;
- Vector sequences;
+ Vector<SequenceI> sequences;
/**
* Creates a new PairwiseAlignPanel object.
*
- * @param av
+ * @param viewport
* DOCUMENT ME!
*/
- public PairwiseAlignPanel(AlignmentViewport av)
+ public PairwiseAlignPanel(AlignmentViewport viewport)
{
super();
- this.av = av;
+ this.av = viewport;
- sequences = new Vector();
+ sequences = new Vector<SequenceI>();
- SequenceI[] seqs;
- String[] seqStrings = av.getViewAsString(true);
+ SequenceGroup selectionGroup = viewport.getSelectionGroup();
+ boolean isSelection = selectionGroup != null
+ && selectionGroup.getSize() > 0;
+ AlignmentView view = viewport.getAlignmentView(isSelection);
+ // String[] seqStrings = viewport.getViewAsString(true);
+ String[] seqStrings = view.getSequenceStrings(viewport
+ .getGapCharacter());
- if (av.getSelectionGroup() == null)
+ SequenceI[] seqs;
+ if (isSelection)
{
- seqs = av.getAlignment().getSequencesArray();
+ seqs = (SequenceI[]) view.getAlignmentAndHiddenColumns(viewport
+ .getGapCharacter())[0];
}
else
{
- seqs = av.getSelectionGroup().getSequencesInOrder(av.getAlignment());
+ seqs = av.getAlignment().getSequencesArray();
}
- String type = (av.getAlignment().isNucleotide()) ? AlignSeq.DNA
+ String type = (viewport.getAlignment().isNucleotide()) ? AlignSeq.DNA
: AlignSeq.PEP;
float[][] scores = new float[seqs.length][seqs.length];
- double totscore = 0;
+ double totscore = 0D;
int count = seqs.length;
-
- Sequence seq;
+ boolean first = true;
for (int i = 1; i < count; i++)
{
for (int j = 0; j < i; j++)
{
-
AlignSeq as = new AlignSeq(seqs[i], seqStrings[i], seqs[j],
seqStrings[j], type);
as.calcScoreMatrix();
as.traceAlignment();
+ if (!first)
+ {
+ System.out.println(DASHES);
+ textarea.append(DASHES);
+ }
+ first = false;
as.printAlignment(System.out);
- scores[i][j] = (float) as.getMaxScore()
- / (float) as.getASeq1().length;
+ scores[i][j] = as.getMaxScore()
+ / as.getASeq1().length;
totscore = totscore + scores[i][j];
textarea.append(as.getOutput());
if (count > 2)
{
- System.out.println(
- "Pairwise alignment scaled similarity score matrix\n");
+ printScoreMatrix(seqs, scores, totscore);
+ }
+ }
- for (int i = 0; i < count; i++)
- {
- jalview.util.Format.print(System.out, "%s \n",
- ("" + i) + " " + seqs[i].getName());
- }
+ /**
+ * Prints a matrix of seqi-seqj pairwise alignment scores to sysout
+ *
+ * @param seqs
+ * @param scores
+ * @param totscore
+ */
+ protected void printScoreMatrix(SequenceI[] seqs, float[][] scores,
+ double totscore)
+ {
+ System.out
+ .println("Pairwise alignment scaled similarity score matrix\n");
- System.out.println("\n");
+ for (int i = 0; i < seqs.length; i++)
+ {
+ System.out.println(String.format("%3d %s", i + 1,
+ seqs[i].getDisplayId(true)));
+ }
+
+ /*
+ * table heading columns for sequences 1, 2, 3...
+ */
+ System.out.print("\n ");
+ for (int i = 0; i < seqs.length; i++)
+ {
+ System.out.print(String.format("%7d", i + 1));
+ }
+ System.out.println();
- for (int i = 0; i < count; i++)
+ for (int i = 0; i < seqs.length; i++)
+ {
+ System.out.print(String.format("%3d", i + 1));
+ for (int j = 0; j < i; j++)
{
- for (int j = 0; j < i; j++)
- {
- jalview.util.Format.print(System.out, "%7.3f",
- scores[i][j] / totscore);
- }
+ /*
+ * as a fraction of tot score, outputs are 0 <= score <= 1
+ */
+ System.out.print(String.format("%7.3f", scores[i][j] / totscore));
}
-
- System.out.println("\n");
+ System.out.println();
}
+
+ System.out.println("\n");
}
/**
* @param e
* DOCUMENT ME!
*/
+ @Override
protected void viewInEditorButton_actionPerformed(ActionEvent e)
{
- Sequence[] seq = new Sequence[sequences.size()];
+ SequenceI[] seq = new SequenceI[sequences.size()];
for (int i = 0; i < sequences.size(); i++)
{
- seq[i] = (Sequence) sequences.elementAt(i);
+ seq[i] = sequences.elementAt(i);
}
AlignFrame af = new AlignFrame(new Alignment(seq),
}
sequence.setName(dialog.getName().replace(' ', '_'));
- ap.paintAlignment(false);
+ ap.paintAlignment(false, false);
}
sequence.setDescription(dialog.getDescription());
if (start <= end)
{
seqs.add(sg.getSequenceAt(i).getDatasetSequence());
- features.add(
- new SequenceFeature(null, null, null, start, end, null));
+ features.add(new SequenceFeature(null, null, start, end, null));
}
}
.amendFeatures(seqs, features, true, ap))
{
ap.alignFrame.setShowSeqFeatures(true);
- ap.highlightSearchResults(null);
+ ap.av.setSearchResults(null); // clear highlighting
+ ap.repaint(); // draw new/amended features
}
}
}
}
this.statusPanel = container;
this.statusBar = statusBar;
- this.progressBars = new Hashtable<Long, JPanel>();
- this.progressBarHandlers = new Hashtable<Long, IProgressIndicatorHandler>();
+ this.progressBars = new Hashtable<>();
+ this.progressBarHandlers = new Hashtable<>();
}
* execution.
*/
@Override
- public void setProgressBar(String message, long id)
+ public void setProgressBar(final String message, final long id)
{
- Long longId = Long.valueOf(id);
-
- JPanel progressPanel = progressBars.get(longId);
- if (progressPanel != null)
+ SwingUtilities.invokeLater(new Runnable()
{
- /*
- * Progress bar is displayed for this id - remove it now, and any handler
- */
- progressBars.remove(id);
- if (message != null && statusBar != null)
- {
- statusBar.setText(message);
- }
- if (progressBarHandlers.containsKey(longId))
+ @Override
+ public void run()
{
- progressBarHandlers.remove(longId);
- }
- removeRow(progressPanel);
- }
- else
- {
- /*
- * No progress bar for this id - add one now
- */
- progressPanel = new JPanel(new BorderLayout(10, 5));
+ JPanel progressPanel = progressBars.get(id);
+ if (progressPanel != null)
+ {
+ /*
+ * Progress bar is displayed for this id - remove it now, and any handler
+ */
+ progressBars.remove(id);
+ if (message != null && statusBar != null)
+ {
+ statusBar.setText(message);
+ }
+ if (progressBarHandlers.containsKey(id))
+ {
+ progressBarHandlers.remove(id);
+ }
+ removeRow(progressPanel);
+ }
+ else
+ {
+ /*
+ * No progress bar for this id - add one now
+ */
+ progressPanel = new JPanel(new BorderLayout(10, 5));
- JProgressBar progressBar = new JProgressBar();
- progressBar.setIndeterminate(true);
+ JProgressBar progressBar = new JProgressBar();
+ progressBar.setIndeterminate(true);
- progressPanel.add(new JLabel(message), BorderLayout.WEST);
- progressPanel.add(progressBar, BorderLayout.CENTER);
+ progressPanel.add(new JLabel(message), BorderLayout.WEST);
+ progressPanel.add(progressBar, BorderLayout.CENTER);
- addRow(progressPanel);
+ addRow(progressPanel);
- progressBars.put(longId, progressPanel);
- }
+ progressBars.put(id, progressPanel);
+ }
+
+ refreshLayout();
+ }
+ });
- refreshLayout();
}
/**
public void registerHandler(final long id,
final IProgressIndicatorHandler handler)
{
- Long longId = Long.valueOf(id);
- final JPanel progressPanel = progressBars.get(longId);
- if (progressPanel == null)
- {
- System.err.println(
- "call setProgressBar before registering the progress bar's handler.");
- return;
- }
-
- /*
- * Nothing useful to do if not a Cancel handler
- */
- if (!handler.canCancel())
- {
- return;
- }
-
- progressBarHandlers.put(longId, handler);
- JButton cancel = new JButton(MessageManager.getString("action.cancel"));
final IProgressIndicator us = this;
- cancel.addActionListener(new ActionListener()
- {
+ SwingUtilities.invokeLater(new Runnable()
+ {
@Override
- public void actionPerformed(ActionEvent e)
+ public void run()
{
- handler.cancelActivity(id);
- us.setProgressBar(MessageManager
- .formatMessage("label.cancelled_params", new Object[]
- { ((JLabel) progressPanel.getComponent(0)).getText() }),
- id);
+ final JPanel progressPanel = progressBars.get(id);
+ if (progressPanel == null)
+ {
+ System.err.println(
+ "call setProgressBar before registering the progress bar's handler.");
+ return;
+ }
+
+ /*
+ * Nothing useful to do if not a Cancel handler
+ */
+ if (!handler.canCancel())
+ {
+ return;
+ }
+
+ progressBarHandlers.put(id, handler);
+ JButton cancel = new JButton(
+ MessageManager.getString("action.cancel"));
+ cancel.addActionListener(new ActionListener()
+ {
+
+ @Override
+ public void actionPerformed(ActionEvent e)
+ {
+ handler.cancelActivity(id);
+ us.setProgressBar(MessageManager
+ .formatMessage("label.cancelled_params", new Object[]
+ { ((JLabel) progressPanel.getComponent(0)).getText() }),
+ id);
+ }
+ });
+ progressPanel.add(cancel, BorderLayout.EAST);
+ refreshLayout();
+
}
});
- progressPanel.add(cancel, BorderLayout.EAST);
- refreshLayout();
}
}
import java.awt.Component;
-import javax.swing.JOptionPane;
-
public class PromptUserConfig implements Runnable
{
/**
this.allowCancel = allowCancel;
}
+ @Override
public void run()
{
if (property == null)
(allowCancel) ? JvOptionPane.YES_NO_CANCEL_OPTION
: JvOptionPane.YES_NO_OPTION,
JvOptionPane.QUESTION_MESSAGE);
- // now, ask the desktop to relayer any external windows that might have
- // been obsured
- if (Desktop.instance != null)
- {
- Desktop.instance.relayerWindows();
- }
+
// and finish parsing the result
jalview.bin.Cache.log.debug("Got response : " + reply);
if (reply == JvOptionPane.YES_OPTION)
AlignmentPanel ap;
- Stack<CommandI> historyList = new Stack<CommandI>();
+ Stack<CommandI> historyList = new Stack<>();
// simpler than synching with alignFrame.
}
float value = slider.getValue();
- List<SequenceI> redundantSequences = new ArrayList<SequenceI>();
+ List<SequenceI> redundantSequences = new ArrayList<>();
for (int i = 0; i < redundancy.length; i++)
{
if (value <= redundancy[i])
af.updateEditMenuBar();
}
- ap.paintAlignment(true);
+ ap.paintAlignment(true, true);
if (historyList.size() == 0)
{
{
av.showColumn(reveal[0]);
reveal = null;
- ap.paintAlignment(true);
+ ap.paintAlignment(true, true);
av.sendSelection();
}
});
{
av.showAllHiddenColumns();
reveal = null;
- ap.paintAlignment(true);
+ ap.paintAlignment(true, true);
av.sendSelection();
}
});
av.setSelectionGroup(null);
}
- ap.paintAlignment(true);
+ ap.paintAlignment(true, true);
av.sendSelection();
}
});
sg.setEndRes(max);
}
av.setSelectionGroup(sg);
- ap.paintAlignment(false);
+ ap.paintAlignment(false, false);
av.sendSelection();
}
}
else
{
- ap.paintAlignment(false);
+ ap.paintAlignment(false, false);
}
return;
}
}
}
stretchingGroup = false;
- ap.paintAlignment(false);
+ ap.paintAlignment(false, false);
av.sendSelection();
}
{
stretchingGroup = true;
cs.stretchGroup(res, sg, min, max);
- ap.paintAlignment(false);
+ ap.paintAlignment(false, false);
}
}
// Here we only want to fastpaint on a scroll, with resize using a normal
// paint, so scroll events are identified as changes to the horizontal or
// vertical start value.
- if (evt.getPropertyName().equals(ViewportRanges.STARTRES))
+ if (evt.getPropertyName().equals(ViewportRanges.STARTRES)
+ || evt.getPropertyName().equals(ViewportRanges.STARTRESANDSEQ)
+ || evt.getPropertyName().equals(ViewportRanges.MOVE_VIEWPORT))
{
// scroll event, repaint panel
repaint();
import jalview.datamodel.SequenceI;
import jalview.renderer.ScaleRenderer;
import jalview.renderer.ScaleRenderer.ScaleMark;
+import jalview.util.Comparison;
import jalview.viewmodel.ViewportListenerI;
import jalview.viewmodel.ViewportRanges;
import javax.swing.JComponent;
/**
- * DOCUMENT ME!
+ * The Swing component on which the alignment sequences, and annotations (if
+ * shown), are drawn. This includes scales above, left and right (if shown) in
+ * Wrapped mode, but not the scale above in Unwrapped mode.
*
- * @author $author$
- * @version $Revision$
*/
public class SeqCanvas extends JComponent implements ViewportListenerI
{
- final FeatureRenderer fr;
+ private static final String ZEROS = "0000000000";
- final SequenceRenderer seqRdr;
+ final FeatureRenderer fr;
BufferedImage img;
- Graphics2D gg;
-
AlignViewport av;
- boolean fastPaint = false;
+ int cursorX = 0;
+
+ int cursorY = 0;
- int LABEL_WEST;
+ private final SequenceRenderer seqRdr;
- int LABEL_EAST;
+ private boolean fastPaint = false;
- int cursorX = 0;
+ private boolean fastpainting = false;
- int cursorY = 0;
+ private AnnotationPanel annotations;
- int charHeight = 0;
+ /*
+ * measurements for drawing a wrapped alignment
+ */
+ private int labelWidthEast; // label right width in pixels if shown
+
+ private int labelWidthWest; // label left width in pixels if shown
+
+ private int wrappedSpaceAboveAlignment; // gap between widths
- int charWidth = 0;
+ private int wrappedRepeatHeightPx; // height in pixels of wrapped width
- boolean fastpainting = false;
+ private int wrappedVisibleWidths; // number of wrapped widths displayed
- AnnotationPanel annotations;
+ private Graphics2D gg;
/**
* Creates a new SeqCanvas object.
*
- * @param av
- * DOCUMENT ME!
+ * @param ap
*/
public SeqCanvas(AlignmentPanel ap)
{
this.av = ap.av;
- updateViewport();
fr = new FeatureRenderer(ap);
seqRdr = new SequenceRenderer(av);
setLayout(new BorderLayout());
return fr;
}
- private void updateViewport()
- {
- charHeight = av.getCharHeight();
- charWidth = av.getCharWidth();
- }
-
/**
- * DOCUMENT ME!
+ * Draws the scale above a region of a wrapped alignment, consisting of a
+ * column number every major interval (10 columns).
*
* @param g
- * DOCUMENT ME!
+ * the graphics context to draw on, positioned at the start (bottom
+ * left) of the line on which to draw any scale marks
* @param startx
- * DOCUMENT ME!
+ * start alignment column (0..)
* @param endx
- * DOCUMENT ME!
+ * end alignment column (0..)
* @param ypos
- * DOCUMENT ME!
+ * y offset to draw at
*/
private void drawNorthScale(Graphics g, int startx, int endx, int ypos)
{
- updateViewport();
- for (ScaleMark mark : new ScaleRenderer().calculateMarks(av, startx,
- endx))
+ int charHeight = av.getCharHeight();
+ int charWidth = av.getCharWidth();
+
+ /*
+ * white fill the scale space (for the fastPaint case)
+ */
+ g.setColor(Color.white);
+ g.fillRect(0, ypos - charHeight - charHeight / 2, getWidth(),
+ charHeight * 3 / 2 + 2);
+ g.setColor(Color.black);
+
+ List<ScaleMark> marks = new ScaleRenderer().calculateMarks(av, startx,
+ endx);
+ for (ScaleMark mark : marks)
{
int mpos = mark.column; // (i - startx - 1)
if (mpos < 0)
{
g.drawString(mstring, mpos * charWidth, ypos - (charHeight / 2));
}
- g.drawLine((mpos * charWidth) + (charWidth / 2),
- (ypos + 2) - (charHeight / 2),
- (mpos * charWidth) + (charWidth / 2), ypos - 2);
+
+ /*
+ * draw a tick mark below the column number, centred on the column;
+ * height of tick mark is 4 pixels less than half a character
+ */
+ int xpos = (mpos * charWidth) + (charWidth / 2);
+ g.drawLine(xpos, (ypos + 2) - (charHeight / 2), xpos, ypos - 2);
}
}
}
/**
- * DOCUMENT ME!
+ * Draw the scale to the left or right of a wrapped alignment
*
* @param g
- * DOCUMENT ME!
+ * graphics context, positioned at the start of the scale to be drawn
* @param startx
- * DOCUMENT ME!
+ * first column of wrapped width (0.. excluding any hidden columns)
* @param endx
- * DOCUMENT ME!
+ * last column of wrapped width (0.. excluding any hidden columns)
* @param ypos
- * DOCUMENT ME!
+ * vertical offset at which to begin the scale
+ * @param left
+ * if true, scale is left of residues, if false, scale is right
*/
- void drawWestScale(Graphics g, int startx, int endx, int ypos)
+ void drawVerticalScale(Graphics g, final int startx, final int endx,
+ final int ypos, final boolean left)
{
- FontMetrics fm = getFontMetrics(av.getFont());
- ypos += charHeight;
+ int charHeight = av.getCharHeight();
+ int charWidth = av.getCharWidth();
- if (av.hasHiddenColumns())
- {
- startx = av.getAlignment().getHiddenColumns()
- .adjustForHiddenColumns(startx);
- endx = av.getAlignment().getHiddenColumns()
- .adjustForHiddenColumns(endx);
- }
+ int yPos = ypos + charHeight;
+ int startX = startx;
+ int endX = endx;
- int maxwidth = av.getAlignment().getWidth();
if (av.hasHiddenColumns())
{
- maxwidth = av.getAlignment().getHiddenColumns()
- .findColumnPosition(maxwidth) - 1;
+ HiddenColumns hiddenColumns = av.getAlignment().getHiddenColumns();
+ startX = hiddenColumns.adjustForHiddenColumns(startx);
+ endX = hiddenColumns.adjustForHiddenColumns(endx);
}
+ FontMetrics fm = getFontMetrics(av.getFont());
- // WEST SCALE
for (int i = 0; i < av.getAlignment().getHeight(); i++)
{
SequenceI seq = av.getAlignment().getSequenceAt(i);
- int index = startx;
- int value = -1;
- while (index < endx)
+ /*
+ * find sequence position of first non-gapped position -
+ * to the right if scale left, to the left if scale right
+ */
+ int index = left ? startX : endX;
+ int value = -1;
+ while (index >= startX && index <= endX)
{
- if (jalview.util.Comparison.isGap(seq.getCharAt(index)))
+ if (!Comparison.isGap(seq.getCharAt(index)))
+ {
+ value = seq.findPosition(index);
+ break;
+ }
+ if (left)
{
index++;
-
- continue;
}
-
- value = av.getAlignment().getSequenceAt(i).findPosition(index);
-
- break;
- }
-
- if (value != -1)
- {
- int x = LABEL_WEST - fm.stringWidth(String.valueOf(value))
- - charWidth / 2;
- g.drawString(value + "", x,
- (ypos + (i * charHeight)) - (charHeight / 5));
- }
- }
- }
-
- /**
- * DOCUMENT ME!
- *
- * @param g
- * DOCUMENT ME!
- * @param startx
- * DOCUMENT ME!
- * @param endx
- * DOCUMENT ME!
- * @param ypos
- * DOCUMENT ME!
- */
- void drawEastScale(Graphics g, int startx, int endx, int ypos)
- {
- ypos += charHeight;
-
- if (av.hasHiddenColumns())
- {
- endx = av.getAlignment().getHiddenColumns()
- .adjustForHiddenColumns(endx);
- }
-
- SequenceI seq;
- // EAST SCALE
- for (int i = 0; i < av.getAlignment().getHeight(); i++)
- {
- seq = av.getAlignment().getSequenceAt(i);
- int index = endx;
- int value = -1;
-
- while (index > startx)
- {
- if (jalview.util.Comparison.isGap(seq.getCharAt(index)))
+ else
{
index--;
-
- continue;
}
-
- value = seq.findPosition(index);
-
- break;
}
+ /*
+ * white fill the space for the scale
+ */
+ g.setColor(Color.white);
+ int y = (yPos + (i * charHeight)) - (charHeight / 5);
+ // fillRect origin is top left of rectangle
+ g.fillRect(0, y - charHeight, left ? labelWidthWest : labelWidthEast,
+ charHeight + 1);
+
if (value != -1)
{
- g.drawString(String.valueOf(value), 0,
- (ypos + (i * charHeight)) - (charHeight / 5));
+ /*
+ * draw scale value, right justified within its width less half a
+ * character width padding on the right
+ */
+ int labelSpace = left ? labelWidthWest : labelWidthEast;
+ labelSpace -= charWidth / 2; // leave space to the right
+ String valueAsString = String.valueOf(value);
+ int labelLength = fm.stringWidth(valueAsString);
+ int xOffset = labelSpace - labelLength;
+ g.setColor(Color.black);
+ g.drawString(valueAsString, xOffset, y);
}
}
}
-
/**
- * need to make this thread safe move alignment rendering in response to
- * slider adjustment
+ * Does a fast paint of an alignment in response to a scroll. Most of the
+ * visible region is simply copied and shifted, and then any newly visible
+ * columns or rows are drawn. The scroll may be horizontal or vertical, but
+ * not both at once. Scrolling may be the result of
+ * <ul>
+ * <li>dragging a scroll bar</li>
+ * <li>clicking in the scroll bar</li>
+ * <li>scrolling by trackpad, middle mouse button, or other device</li>
+ * <li>by moving the box in the Overview window</li>
+ * <li>programmatically to make a highlighted position visible</li>
+ * </ul>
*
* @param horizontal
- * shift along
+ * columns to shift right (positive) or left (negative)
* @param vertical
- * shift up or down in repaint
+ * rows to shift down (positive) or up (negative)
*/
public void fastPaint(int horizontal, int vertical)
{
}
fastpainting = true;
fastPaint = true;
- updateViewport();
- ViewportRanges ranges = av.getRanges();
- int sr = ranges.getStartRes();
- int er = ranges.getEndRes();
- int ss = ranges.getStartSeq();
- int es = ranges.getEndSeq();
- int transX = 0;
- int transY = 0;
-
- gg.copyArea(horizontal * charWidth, vertical * charHeight,
- img.getWidth(), img.getHeight(), -horizontal * charWidth,
- -vertical * charHeight);
-
- if (horizontal > 0) // scrollbar pulled right, image to the left
- {
- transX = (er - sr - horizontal) * charWidth;
- sr = er - horizontal;
- }
- else if (horizontal < 0)
- {
- er = sr - horizontal;
- }
- else if (vertical > 0) // scroll down
+ try
{
- ss = es - vertical;
-
- if (ss < ranges.getStartSeq())
- { // ie scrolling too fast, more than a page at a time
- ss = ranges.getStartSeq();
+ int charHeight = av.getCharHeight();
+ int charWidth = av.getCharWidth();
+
+ ViewportRanges ranges = av.getRanges();
+ int startRes = ranges.getStartRes();
+ int endRes = ranges.getEndRes();
+ int startSeq = ranges.getStartSeq();
+ int endSeq = ranges.getEndSeq();
+ int transX = 0;
+ int transY = 0;
+
+ gg.copyArea(horizontal * charWidth, vertical * charHeight,
+ img.getWidth(), img.getHeight(), -horizontal * charWidth,
+ -vertical * charHeight);
+
+ if (horizontal > 0) // scrollbar pulled right, image to the left
+ {
+ transX = (endRes - startRes - horizontal) * charWidth;
+ startRes = endRes - horizontal;
}
- else
+ else if (horizontal < 0)
{
- transY = img.getHeight() - ((vertical + 1) * charHeight);
+ endRes = startRes - horizontal;
}
- }
- else if (vertical < 0)
- {
- es = ss - vertical;
- if (es > ranges.getEndSeq())
+ if (vertical > 0) // scroll down
+ {
+ startSeq = endSeq - vertical;
+
+ if (startSeq < ranges.getStartSeq())
+ { // ie scrolling too fast, more than a page at a time
+ startSeq = ranges.getStartSeq();
+ }
+ else
+ {
+ transY = img.getHeight() - ((vertical + 1) * charHeight);
+ }
+ }
+ else if (vertical < 0)
{
- es = ranges.getEndSeq();
+ endSeq = startSeq - vertical;
+
+ if (endSeq > ranges.getEndSeq())
+ {
+ endSeq = ranges.getEndSeq();
+ }
}
- }
- gg.translate(transX, transY);
- drawPanel(gg, sr, er, ss, es, 0);
- gg.translate(-transX, -transY);
+ gg.translate(transX, transY);
+ drawPanel(gg, startRes, endRes, startSeq, endSeq, 0);
+ gg.translate(-transX, -transY);
- repaint();
- fastpainting = false;
+ repaint();
+ } finally
+ {
+ fastpainting = false;
+ }
}
- /**
- * Definitions of startx and endx (hopefully): SMJS This is what I'm working
- * towards! startx is the first residue (starting at 0) to display. endx is
- * the last residue to display (starting at 0). starty is the first sequence
- * to display (starting at 0). endy is the last sequence to display (starting
- * at 0). NOTE 1: The av limits are set in setFont in this class and in the
- * adjustment listener in SeqPanel when the scrollbars move.
- */
-
- // Set this to false to force a full panel paint
@Override
public void paintComponent(Graphics g)
{
- super.paintComponent(g);
-
- updateViewport();
+ super.paintComponent(g);
+
+ int charHeight = av.getCharHeight();
+ int charWidth = av.getCharWidth();
ViewportRanges ranges = av.getRanges();
// lcimg is a local *copy* of img which we'll draw selectImage on top of
BufferedImage lcimg = buildLocalImage(selectImage);
g.drawImage(lcimg, 0, 0, this);
+
}
- }
+ if (av.cursorMode)
+ {
+ drawCursor(g, ranges.getStartRes(), ranges.getEndRes(),
+ ranges.getStartSeq(), ranges.getEndSeq());
+ }
+ }
+
/**
* Draw an alignment panel for printing
*
AlphaComposite.getInstance(AlphaComposite.SRC_OVER));
g2d.drawImage(selectImage, 0, 0, this);
}
+
g2d.dispose();
return lcimg;
{
BufferedImage lcimg = null;
+ int charWidth = av.getCharWidth();
+ int charHeight = av.getCharHeight();
+
int width = getWidth();
int height = getHeight();
}
/**
- * DOCUMENT ME!
+ * Returns the visible width of the canvas in residues, after allowing for
+ * East or West scales (if shown)
*
- * @param cwidth
- * DOCUMENT ME!
+ * @param canvasWidth
+ * the width in pixels (possibly including scales)
*
- * @return DOCUMENT ME!
+ * @return
*/
- public int getWrappedCanvasWidth(int cwidth)
+ public int getWrappedCanvasWidth(int canvasWidth)
{
- FontMetrics fm = getFontMetrics(av.getFont());
+ int charWidth = av.getCharWidth();
- LABEL_EAST = 0;
- LABEL_WEST = 0;
+ FontMetrics fm = getFontMetrics(av.getFont());
- if (av.getScaleRightWrapped())
+ int labelWidth = 0;
+
+ if (av.getScaleRightWrapped() || av.getScaleLeftWrapped())
{
- LABEL_EAST = fm.stringWidth(getMask());
+ labelWidth = getLabelWidth(fm);
}
- if (av.getScaleLeftWrapped())
- {
- LABEL_WEST = fm.stringWidth(getMask());
- }
+ labelWidthEast = av.getScaleRightWrapped() ? labelWidth : 0;
- return (cwidth - LABEL_EAST - LABEL_WEST) / charWidth;
+ labelWidthWest = av.getScaleLeftWrapped() ? labelWidth : 0;
+
+ return (canvasWidth - labelWidthEast - labelWidthWest) / charWidth;
}
/**
- * Generates a string of zeroes.
+ * Returns a pixel width sufficient to show the largest sequence coordinate
+ * (end position) in the alignment, calculated as the FontMetrics width of
+ * zeroes "0000000" limited to the number of decimal digits to be shown (3 for
+ * 1-10, 4 for 11-99 etc). One character width is added to this, to allow for
+ * half a character width space on either side.
*
- * @return String
+ * @param fm
+ * @return
*/
- String getMask()
+ protected int getLabelWidth(FontMetrics fm)
{
- String mask = "00";
+ /*
+ * find the biggest sequence end position we need to show
+ * (note this is not necessarily the sequence length)
+ */
int maxWidth = 0;
- int tmp;
- for (int i = 0; i < av.getAlignment().getHeight(); i++)
+ AlignmentI alignment = av.getAlignment();
+ for (int i = 0; i < alignment.getHeight(); i++)
{
- tmp = av.getAlignment().getSequenceAt(i).getEnd();
- if (tmp > maxWidth)
- {
- maxWidth = tmp;
- }
+ maxWidth = Math.max(maxWidth, alignment.getSequenceAt(i).getEnd());
}
+ int length = 0;
for (int i = maxWidth; i > 0; i /= 10)
{
- mask += "0";
+ length++;
}
- return mask;
+
+ return fm.stringWidth(ZEROS.substring(0, length)) + av.getCharWidth();
}
/**
- * DOCUMENT ME!
+ * Draws as many widths of a wrapped alignment as can fit in the visible
+ * window
*
* @param g
- * DOCUMENT ME!
* @param canvasWidth
- * DOCUMENT ME!
+ * available width in pixels
* @param canvasHeight
- * DOCUMENT ME!
- * @param startRes
- * DOCUMENT ME!
+ * available height in pixels
+ * @param startColumn
+ * the first column (0...) of the alignment to draw
*/
- private void drawWrappedPanel(Graphics g, int canvasWidth,
- int canvasHeight, int startRes)
+ public void drawWrappedPanel(Graphics g, int canvasWidth,
+ int canvasHeight, final int startColumn)
{
- updateViewport();
- AlignmentI al = av.getAlignment();
-
- FontMetrics fm = getFontMetrics(av.getFont());
+ int wrappedWidthInResidues = calculateWrappedGeometry(canvasWidth,
+ canvasHeight);
- LABEL_EAST = 0;
- LABEL_WEST = 0;
+ av.setWrappedWidth(wrappedWidthInResidues);
- if (av.getScaleRightWrapped())
+ ViewportRanges ranges = av.getRanges();
+ ranges.setViewportStartAndWidth(startColumn, wrappedWidthInResidues);
+
+ /*
+ * draw one width at a time (including any scales or annotation shown),
+ * until we have run out of either alignment or vertical space available
+ */
+ int ypos = wrappedSpaceAboveAlignment;
+ int maxWidth = ranges.getVisibleAlignmentWidth();
+
+ int start = startColumn;
+ int currentWidth = 0;
+ while ((currentWidth < wrappedVisibleWidths) && (start < maxWidth))
{
- LABEL_EAST = fm.stringWidth(getMask());
+ int endColumn = Math
+ .min(maxWidth, start + wrappedWidthInResidues - 1);
+ drawWrappedWidth(g, ypos, start, endColumn, canvasHeight);
+ ypos += wrappedRepeatHeightPx;
+ start += wrappedWidthInResidues;
+ currentWidth++;
}
- if (av.getScaleLeftWrapped())
+ drawWrappedDecorators(g, startColumn);
+ }
+
+ /**
+ * Calculates and saves values needed when rendering a wrapped alignment.
+ * These depend on many factors, including
+ * <ul>
+ * <li>canvas width and height</li>
+ * <li>number of visible sequences, and height of annotations if shown</li>
+ * <li>font and character width</li>
+ * <li>whether scales are shown left, right or above the alignment</li>
+ * </ul>
+ *
+ * @param canvasWidth
+ * @param canvasHeight
+ * @return the number of residue columns in each width
+ */
+ protected int calculateWrappedGeometry(int canvasWidth, int canvasHeight)
+ {
+ int charHeight = av.getCharHeight();
+
+ /*
+ * vertical space in pixels between wrapped widths of alignment
+ * - one character height, or two if scale above is drawn
+ */
+ wrappedSpaceAboveAlignment = charHeight
+ * (av.getScaleAboveWrapped() ? 2 : 1);
+
+ /*
+ * height in pixels of the wrapped widths
+ */
+ wrappedRepeatHeightPx = wrappedSpaceAboveAlignment;
+ // add sequences
+ wrappedRepeatHeightPx += av.getRanges().getViewportHeight()
+ * charHeight;
+ // add annotations panel height if shown
+ wrappedRepeatHeightPx += getAnnotationHeight();
+
+ /*
+ * number of visible widths (the last one may be part height),
+ * ensuring a part height includes at least one sequence
+ */
+ ViewportRanges ranges = av.getRanges();
+ wrappedVisibleWidths = canvasHeight / wrappedRepeatHeightPx;
+ int remainder = canvasHeight % wrappedRepeatHeightPx;
+ if (remainder >= (wrappedSpaceAboveAlignment + charHeight))
{
- LABEL_WEST = fm.stringWidth(getMask());
+ wrappedVisibleWidths++;
}
- int hgap = charHeight;
- if (av.getScaleAboveWrapped())
+ /*
+ * compute width in residues; this also sets East and West label widths
+ */
+ int wrappedWidthInResidues = getWrappedCanvasWidth(canvasWidth);
+
+ /*
+ * limit visibleWidths to not exceed width of alignment
+ */
+ int xMax = ranges.getVisibleAlignmentWidth();
+ int startToEnd = xMax - ranges.getStartRes();
+ int maxWidths = startToEnd / wrappedWidthInResidues;
+ if (startToEnd % wrappedWidthInResidues > 0)
{
- hgap += charHeight;
+ maxWidths++;
}
+ wrappedVisibleWidths = Math.min(wrappedVisibleWidths, maxWidths);
- int cWidth = (canvasWidth - LABEL_EAST - LABEL_WEST) / charWidth;
- int cHeight = av.getAlignment().getHeight() * charHeight;
+ return wrappedWidthInResidues;
+ }
- av.setWrappedWidth(cWidth);
+ /**
+ * Draws one width of a wrapped alignment, including sequences and
+ * annnotations, if shown, but not scales or hidden column markers
+ *
+ * @param g
+ * @param ypos
+ * @param startColumn
+ * @param endColumn
+ * @param canvasHeight
+ */
+ protected void drawWrappedWidth(Graphics g, int ypos, int startColumn,
+ int endColumn, int canvasHeight)
+ {
+ ViewportRanges ranges = av.getRanges();
+ int viewportWidth = ranges.getViewportWidth();
+
+ int endx = Math.min(startColumn + viewportWidth - 1, endColumn);
+
+ /*
+ * move right before drawing by the width of the scale left (if any)
+ * plus column offset from left margin (usually zero, but may be non-zero
+ * when fast painting is drawing just a few columns)
+ */
+ int charWidth = av.getCharWidth();
+ int xOffset = labelWidthWest
+ + ((startColumn - ranges.getStartRes()) % viewportWidth)
+ * charWidth;
+ g.translate(xOffset, 0);
+
+ // When printing we have an extra clipped region,
+ // the Printable page which we need to account for here
+ Shape clip = g.getClip();
+
+ if (clip == null)
+ {
+ g.setClip(0, 0, viewportWidth * charWidth, canvasHeight);
+ }
+ else
+ {
+ g.setClip(0, (int) clip.getBounds().getY(),
+ viewportWidth * charWidth, (int) clip.getBounds().getHeight());
+ }
- av.getRanges().setViewportStartAndWidth(startRes, cWidth);
+ /*
+ * white fill the region to be drawn (so incremental fast paint doesn't
+ * scribble over an existing image)
+ */
+ g.setColor(Color.white);
+ g.fillRect(0, ypos, (endx - startColumn + 1) * charWidth,
+ wrappedRepeatHeightPx);
- int endx;
- int ypos = hgap;
- int maxwidth = av.getAlignment().getWidth();
+ drawPanel(g, startColumn, endx, 0, av.getAlignment().getHeight() - 1,
+ ypos);
- if (av.hasHiddenColumns())
- {
- maxwidth = av.getAlignment().getHiddenColumns()
- .findColumnPosition(maxwidth);
- }
+ int cHeight = av.getAlignment().getHeight() * av.getCharHeight();
- while ((ypos <= canvasHeight) && (startRes < maxwidth))
+ if (av.isShowAnnotation())
{
- endx = startRes + cWidth - 1;
-
- if (endx > maxwidth)
+ g.translate(0, cHeight + ypos + 3);
+ if (annotations == null)
{
- endx = maxwidth;
+ annotations = new AnnotationPanel(av);
}
- g.setFont(av.getFont());
- g.setColor(Color.black);
+ annotations.renderer.drawComponent(annotations, av, g, -1,
+ startColumn, endx + 1);
+ g.translate(0, -cHeight - ypos - 3);
+ }
+ g.setClip(clip);
+ g.translate(-xOffset, 0);
+ }
+
+ /**
+ * Draws scales left, right and above (if shown), and any hidden column
+ * markers, on all widths of the wrapped alignment
+ *
+ * @param g
+ * @param startColumn
+ */
+ protected void drawWrappedDecorators(Graphics g, final int startColumn)
+ {
+ int charWidth = av.getCharWidth();
+
+ g.setFont(av.getFont());
+ g.setColor(Color.black);
+
+ int ypos = wrappedSpaceAboveAlignment;
+ ViewportRanges ranges = av.getRanges();
+ int viewportWidth = ranges.getViewportWidth();
+ int maxWidth = ranges.getVisibleAlignmentWidth();
+ int widthsDrawn = 0;
+ int startCol = startColumn;
+
+ while (widthsDrawn < wrappedVisibleWidths)
+ {
+ int endColumn = Math.min(maxWidth, startCol + viewportWidth - 1);
if (av.getScaleLeftWrapped())
{
- drawWestScale(g, startRes, endx, ypos);
+ drawVerticalScale(g, startCol, endColumn - 1, ypos, true);
}
if (av.getScaleRightWrapped())
{
- g.translate(canvasWidth - LABEL_EAST, 0);
- drawEastScale(g, startRes, endx, ypos);
- g.translate(-(canvasWidth - LABEL_EAST), 0);
+ int x = labelWidthWest + viewportWidth * charWidth;
+ g.translate(x, 0);
+ drawVerticalScale(g, startCol, endColumn, ypos, false);
+ g.translate(-x, 0);
}
- g.translate(LABEL_WEST, 0);
+ /*
+ * white fill region of scale above and hidden column markers
+ * (to support incremental fast paint of image)
+ */
+ g.translate(labelWidthWest, 0);
+ g.setColor(Color.white);
+ g.fillRect(0, ypos - wrappedSpaceAboveAlignment, viewportWidth
+ * charWidth + labelWidthWest, wrappedSpaceAboveAlignment);
+ g.setColor(Color.black);
+ g.translate(-labelWidthWest, 0);
+
+ g.translate(labelWidthWest, 0);
if (av.getScaleAboveWrapped())
{
- drawNorthScale(g, startRes, endx, ypos);
+ drawNorthScale(g, startCol, endColumn, ypos);
}
if (av.hasHiddenColumns() && av.getShowHiddenMarkers())
{
- g.setColor(Color.blue);
- int res;
- HiddenColumns hidden = av.getAlignment().getHiddenColumns();
- List<Integer> positions = hidden.findHiddenRegionPositions();
- for (int pos : positions)
- {
- res = pos - startRes;
-
- if (res < 0 || res > endx - startRes)
- {
- continue;
- }
-
- gg.fillPolygon(
- new int[]
- { res * charWidth - charHeight / 4,
- res * charWidth + charHeight / 4, res * charWidth },
- new int[]
- { ypos - (charHeight / 2), ypos - (charHeight / 2),
- ypos - (charHeight / 2) + 8 },
- 3);
-
- }
+ drawHiddenColumnMarkers(g, ypos, startCol, endColumn);
}
- // When printing we have an extra clipped region,
- // the Printable page which we need to account for here
- Shape clip = g.getClip();
+ g.translate(-labelWidthWest, 0);
- if (clip == null)
- {
- g.setClip(0, 0, cWidth * charWidth, canvasHeight);
- }
- else
- {
- g.setClip(0, (int) clip.getBounds().getY(), cWidth * charWidth,
- (int) clip.getBounds().getHeight());
- }
+ ypos += wrappedRepeatHeightPx;
+ startCol += viewportWidth;
+ widthsDrawn++;
+ }
+ }
- drawPanel(g, startRes, endx, 0, al.getHeight() - 1, ypos);
+ /**
+ * Draws markers (triangles) above hidden column positions between startColumn
+ * and endColumn.
+ *
+ * @param g
+ * @param ypos
+ * @param startColumn
+ * @param endColumn
+ */
+ protected void drawHiddenColumnMarkers(Graphics g, int ypos,
+ int startColumn, int endColumn)
+ {
+ int charHeight = av.getCharHeight();
+ int charWidth = av.getCharWidth();
- if (av.isShowAnnotation())
- {
- g.translate(0, cHeight + ypos + 3);
- if (annotations == null)
- {
- annotations = new AnnotationPanel(av);
- }
+ g.setColor(Color.blue);
+ HiddenColumns hidden = av.getAlignment().getHiddenColumns();
+ List<Integer> positions = hidden.findHiddenRegionPositions();
+ for (int pos : positions)
+ {
+ int res = pos - startColumn;
- annotations.renderer.drawComponent(annotations, av, g, -1, startRes,
- endx + 1);
- g.translate(0, -cHeight - ypos - 3);
+ if (res < 0 || res > endColumn - startColumn + 1)
+ {
+ continue;
}
- g.setClip(clip);
- g.translate(-LABEL_WEST, 0);
- ypos += cHeight + getAnnotationHeight() + hgap;
-
- startRes += cWidth;
+ /*
+ * draw a downward-pointing triangle at the hidden columns location
+ * (before the following visible column)
+ */
+ int xMiddle = res * charWidth;
+ int[] xPoints = new int[] { xMiddle - charHeight / 4,
+ xMiddle + charHeight / 4, xMiddle };
+ int yTop = ypos - (charHeight / 2);
+ int[] yPoints = new int[] { yTop, yTop, yTop + 8 };
+ g.fillPolygon(xPoints, yPoints, 3);
}
}
int canvasWidth,
int canvasHeight, int startRes)
{
+ int charHeight = av.getCharHeight();
+ int charWidth = av.getCharWidth();
+
// height gap above each panel
int hgap = charHeight;
if (av.getScaleAboveWrapped())
hgap += charHeight;
}
- int cWidth = (canvasWidth - LABEL_EAST - LABEL_WEST) / charWidth;
+ int cWidth = (canvasWidth - labelWidthEast - labelWidthWest)
+ / charWidth;
int cHeight = av.getAlignment().getHeight() * charHeight;
int startx = startRes;
endx = maxwidth;
}
- g.translate(LABEL_WEST, 0);
+ g.translate(labelWidthWest, 0);
drawUnwrappedSelection(g, group, startx, endx, 0,
av.getAlignment().getHeight() - 1,
ypos);
- g.translate(-LABEL_WEST, 0);
+ g.translate(-labelWidthWest, 0);
// update vertical offset
ypos += cHeight + getAnnotationHeight() + hgap;
return annotations.adjustPanelHeight();
}
- /*
- * Draw an alignment panel for printing
+ /**
+ * Draws the visible region of the alignment on the graphics context. If there
+ * are hidden column markers in the visible region, then each sub-region
+ * between the markers is drawn separately, followed by the hidden column
+ * marker.
*
* @param g1
- * Graphics object to draw with
+ * the graphics context, positioned at the first residue to be drawn
* @param startRes
- * start residue of print area
+ * offset of the first column to draw (0..)
* @param endRes
- * end residue of print area
+ * offset of the last column to draw (0..)
* @param startSeq
- * start sequence of print area
+ * offset of the first sequence to draw (0..)
* @param endSeq
- * end sequence of print area
- * @param offset
- * vertical offset
+ * offset of the last sequence to draw (0..)
+ * @param yOffset
+ * vertical offset at which to draw (for wrapped alignments)
*/
- private void drawPanel(Graphics g1, int startRes, int endRes,
- int startSeq, int endSeq, int offset)
+ public void drawPanel(Graphics g1, final int startRes, final int endRes,
+ final int startSeq, final int endSeq, final int yOffset)
{
- updateViewport();
+ int charHeight = av.getCharHeight();
+ int charWidth = av.getCharWidth();
+
if (!av.hasHiddenColumns())
{
- draw(g1, startRes, endRes, startSeq, endSeq, offset);
+ draw(g1, startRes, endRes, startSeq, endSeq, yOffset);
}
else
{
int screenY = 0;
+ final int screenYMax = endRes - startRes;
int blockStart = startRes;
int blockEnd = endRes;
continue;
}
- blockEnd = hideStart - 1;
+ /*
+ * draw up to just before the next hidden region, or the end of
+ * the visible region, whichever comes first
+ */
+ blockEnd = Math.min(hideStart - 1, blockStart + screenYMax
+ - screenY);
g1.translate(screenY * charWidth, 0);
- draw(g1, blockStart, blockEnd, startSeq, endSeq, offset);
+ draw(g1, blockStart, blockEnd, startSeq, endSeq, yOffset);
- if (av.getShowHiddenMarkers())
+ /*
+ * draw the downline of the hidden column marker (ScalePanel draws the
+ * triangle on top) if we reached it
+ */
+ if (av.getShowHiddenMarkers() && blockEnd == hideStart - 1)
{
g1.setColor(Color.blue);
g1.drawLine((blockEnd - blockStart + 1) * charWidth - 1,
- 0 + offset, (blockEnd - blockStart + 1) * charWidth - 1,
- (endSeq - startSeq + 1) * charHeight + offset);
+ 0 + yOffset, (blockEnd - blockStart + 1) * charWidth - 1,
+ (endSeq - startSeq + 1) * charHeight + yOffset);
}
g1.translate(-screenY * charWidth, 0);
screenY += blockEnd - blockStart + 1;
blockStart = hideEnd + 1;
- if (screenY > (endRes - startRes))
+ if (screenY > screenYMax)
{
// already rendered last block
return;
}
}
- if (screenY <= (endRes - startRes))
+ if (screenY <= screenYMax)
{
// remaining visible region to render
- blockEnd = blockStart + (endRes - startRes) - screenY;
+ blockEnd = blockStart + screenYMax - screenY;
g1.translate(screenY * charWidth, 0);
- draw(g1, blockStart, blockEnd, startSeq, endSeq, offset);
+ draw(g1, blockStart, blockEnd, startSeq, endSeq, yOffset);
g1.translate(-screenY * charWidth, 0);
}
}
+ /**
+ * Draws a region of the visible alignment
+ *
+ * @param g1
+ * @param startRes
+ * offset of the first column in the visible region (0..)
+ * @param endRes
+ * offset of the last column in the visible region (0..)
+ * @param startSeq
+ * offset of the first sequence in the visible region (0..)
+ * @param endSeq
+ * offset of the last sequence in the visible region (0..)
+ * @param yOffset
+ * vertical offset at which to draw (for wrapped alignments)
+ */
private void draw(Graphics g, int startRes, int endRes, int startSeq,
int endSeq, int offset)
{
+ int charHeight = av.getCharHeight();
+ int charWidth = av.getCharWidth();
+
g.setFont(av.getFont());
seqRdr.prepare(g, av.isRenderGaps());
offset + ((i - startSeq) * charHeight), false);
}
- // / Highlight search Results once all sequences have been drawn
- // ////////////////////////////////////////////////////////
+ /*
+ * highlight search Results once sequence has been drawn
+ */
if (av.hasSearchResults())
{
- int[] visibleResults = av.getSearchResults().getResults(nextSeq,
+ SearchResultsI searchResults = av.getSearchResults();
+ int[] visibleResults = searchResults.getResults(nextSeq,
startRes, endRes);
if (visibleResults != null)
{
}
}
}
-
- if (av.cursorMode && cursorY == i && cursorX >= startRes
- && cursorX <= endRes)
- {
- seqRdr.drawCursor(nextSeq, cursorX, (cursorX - startRes) * charWidth,
- offset + ((i - startSeq) * charHeight));
- }
}
if (av.getSelectionGroup() != null
return selectionImage;
}
- /*
- * Set up graphics for selection group
+ /**
+ * Draw the cursor as a separate image and overlay
+ *
+ * @param startRes
+ * start residue of area to draw cursor in
+ * @param endRes
+ * end residue of area to draw cursor in
+ * @param startSeq
+ * start sequence of area to draw cursor in
+ * @param endSeq
+ * end sequence of are to draw cursor in
+ * @return a transparent image of the same size as the sequence canvas, with
+ * the cursor drawn on it, if any
*/
- private void setupSelectionGroup(Graphics2D g,
- BufferedImage selectionImage)
+ private void drawCursor(Graphics g, int startRes, int endRes,
+ int startSeq,
+ int endSeq)
{
- // set background to transparent
- g.setComposite(AlphaComposite.getInstance(AlphaComposite.CLEAR, 0.0f));
- g.fillRect(0, 0, selectionImage.getWidth(), selectionImage.getHeight());
+ // convert the cursorY into a position on the visible alignment
+ int cursor_ypos = cursorY;
- // set up foreground to draw red dashed line
- g.setComposite(AlphaComposite.Src);
- g.setStroke(new BasicStroke(1, BasicStroke.CAP_BUTT,
- BasicStroke.JOIN_ROUND, 3f, new float[]
- { 5f, 3f }, 0f));
- g.setColor(Color.RED);
- }
+ // don't do work unless we have to
+ if (cursor_ypos >= startSeq && cursor_ypos <= endSeq)
+ {
+ int yoffset = 0;
+ int xoffset = 0;
+ int startx = startRes;
+ int endx = endRes;
- /*
- * Draw a selection group over an unwrapped alignment
- * @param g graphics object to draw with
- * @param group selection group
- * @param startRes start residue of area to draw
- * @param endRes end residue of area to draw
- * @param startSeq start sequence of area to draw
- * @param endSeq end sequence of area to draw
- * @param offset vertical offset (used when called from wrapped alignment code)
- */
+ // convert the cursorX into a position on the visible alignment
+ int cursor_xpos = av.getAlignment().getHiddenColumns()
+ .findColumnPosition(cursorX);
+
+ if (av.getAlignment().getHiddenColumns().isVisible(cursorX))
+ {
+
+ if (av.getWrapAlignment())
+ {
+ // work out the correct offsets for the cursor
+ int charHeight = av.getCharHeight();
+ int charWidth = av.getCharWidth();
+ int canvasWidth = getWidth();
+ int canvasHeight = getHeight();
+
+ // height gap above each panel
+ int hgap = charHeight;
+ if (av.getScaleAboveWrapped())
+ {
+ hgap += charHeight;
+ }
+
+ int cWidth = (canvasWidth - labelWidthEast - labelWidthWest)
+ / charWidth;
+ int cHeight = av.getAlignment().getHeight() * charHeight;
+
+ endx = startx + cWidth - 1;
+ int ypos = hgap; // vertical offset
+
+ // iterate down the wrapped panels
+ while ((ypos <= canvasHeight) && (endx < cursor_xpos))
+ {
+ // update vertical offset
+ ypos += cHeight + getAnnotationHeight() + hgap;
+
+ // update horizontal offset
+ startx += cWidth;
+ endx = startx + cWidth - 1;
+ }
+ yoffset = ypos;
+ xoffset = labelWidthWest;
+ }
+
+ // now check if cursor is within range for x values
+ if (cursor_xpos >= startx && cursor_xpos <= endx)
+ {
+ // get the character the cursor is drawn at
+ SequenceI seq = av.getAlignment().getSequenceAt(cursorY);
+ char s = seq.getCharAt(cursorX);
+
+ seqRdr.drawCursor(g, s,
+ xoffset + (cursor_xpos - startx) * av.getCharWidth(),
+ yoffset + (cursor_ypos - startSeq) * av.getCharHeight());
+ }
+ }
+ }
+ }
+
+
+ /*
+ * Set up graphics for selection group
+ */
+ private void setupSelectionGroup(Graphics2D g,
+ BufferedImage selectionImage)
+ {
+ // set background to transparent
+ g.setComposite(AlphaComposite.getInstance(AlphaComposite.CLEAR, 0.0f));
+ g.fillRect(0, 0, selectionImage.getWidth(), selectionImage.getHeight());
+
+ // set up foreground to draw red dashed line
+ g.setComposite(AlphaComposite.Src);
+ g.setStroke(new BasicStroke(1, BasicStroke.CAP_BUTT,
+ BasicStroke.JOIN_ROUND, 3f, new float[]
+ { 5f, 3f }, 0f));
+ g.setColor(Color.RED);
+ }
+
+ /*
+ * Draw a selection group over an unwrapped alignment
+ * @param g graphics object to draw with
+ * @param group selection group
+ * @param startRes start residue of area to draw
+ * @param endRes end residue of area to draw
+ * @param startSeq start sequence of area to draw
+ * @param endSeq end sequence of area to draw
+ * @param offset vertical offset (used when called from wrapped alignment code)
+ */
private void drawUnwrappedSelection(Graphics2D g, SequenceGroup group,
int startRes, int endRes, int startSeq, int endSeq, int offset)
{
+ int charWidth = av.getCharWidth();
+
if (!av.hasHiddenColumns())
{
drawPartialGroupOutline(g, group, startRes, endRes, startSeq, endSeq,
int startRes, int endRes, int startSeq, int endSeq,
int verticalOffset)
{
+ int charHeight = av.getCharHeight();
+ int charWidth = av.getCharWidth();
int visWidth = (endRes - startRes + 1) * charWidth;
int oldY = -1;
boolean inGroup = false;
int top = -1;
int bottom = -1;
-
- int sx = -1;
int sy = -1;
- int xwidth = -1;
- for (i = startSeq; i <= endSeq; i++)
- {
- // position of start residue of group relative to startRes, in pixels
- sx = (group.getStartRes() - startRes) * charWidth;
+ List<SequenceI> seqs = group.getSequences(null);
- // width of group in pixels
- xwidth = (((group.getEndRes() + 1) - group.getStartRes()) * charWidth)
- - 1;
+ // position of start residue of group relative to startRes, in pixels
+ int sx = (group.getStartRes() - startRes) * charWidth;
- sy = verticalOffset + (i - startSeq) * charHeight;
+ // width of group in pixels
+ int xwidth = (((group.getEndRes() + 1) - group.getStartRes())
+ * charWidth) - 1;
- if (sx + xwidth < 0 || sx > visWidth)
- {
- continue;
- }
-
- if ((sx <= (endRes - startRes) * charWidth)
- && group.getSequences(null)
- .contains(av.getAlignment().getSequenceAt(i)))
+ if (!(sx + xwidth < 0 || sx > visWidth))
+ {
+ for (i = startSeq; i <= endSeq; i++)
{
- if ((bottom == -1) && !group.getSequences(null)
- .contains(av.getAlignment().getSequenceAt(i + 1)))
- {
- bottom = sy + charHeight;
- }
-
- if (!inGroup)
- {
- if (((top == -1) && (i == 0)) || !group.getSequences(null)
- .contains(av.getAlignment().getSequenceAt(i - 1)))
- {
- top = sy;
- }
+ sy = verticalOffset + (i - startSeq) * charHeight;
- oldY = sy;
- inGroup = true;
- }
- }
- else
- {
- if (inGroup)
+ if ((sx <= (endRes - startRes) * charWidth)
+ && seqs.contains(av.getAlignment().getSequenceAt(i)))
{
- // if start position is visible, draw vertical line to left of
- // group
- if (sx >= 0 && sx < visWidth)
- {
- g.drawLine(sx, oldY, sx, sy);
- }
-
- // if end position is visible, draw vertical line to right of
- // group
- if (sx + xwidth < visWidth)
- {
- g.drawLine(sx + xwidth, oldY, sx + xwidth, sy);
- }
-
- if (sx < 0)
- {
- xwidth += sx;
- sx = 0;
- }
-
- // don't let width extend beyond current block, or group extent
- // fixes JAL-2672
- if (sx + xwidth >= (endRes - startRes + 1) * charWidth)
+ if ((bottom == -1)
+ && !seqs.contains(av.getAlignment().getSequenceAt(i + 1)))
{
- xwidth = (endRes - startRes + 1) * charWidth - sx;
- }
-
- // draw horizontal line at top of group
- if (top != -1)
- {
- g.drawLine(sx, top, sx + xwidth, top);
- top = -1;
+ bottom = sy + charHeight;
}
- // draw horizontal line at bottom of group
- if (bottom != -1)
+ if (!inGroup)
{
- g.drawLine(sx, bottom, sx + xwidth, bottom);
- bottom = -1;
+ if (((top == -1) && (i == 0)) || !seqs
+ .contains(av.getAlignment().getSequenceAt(i - 1)))
+ {
+ top = sy;
+ }
+
+ oldY = sy;
+ inGroup = true;
}
+ }
+ else if (inGroup)
+ {
+ drawVerticals(g, sx, xwidth, visWidth, oldY, sy);
+ drawHorizontals(g, sx, xwidth, visWidth, top, bottom);
+ // reset top and bottom
+ top = -1;
+ bottom = -1;
inGroup = false;
}
}
+ if (inGroup)
+ {
+ sy = verticalOffset + ((i - startSeq) * charHeight);
+ drawVerticals(g, sx, xwidth, visWidth, oldY, sy);
+ drawHorizontals(g, sx, xwidth, visWidth, top, bottom);
+ }
}
+ }
- if (inGroup)
+ /**
+ * Draw horizontal selection group boundaries at top and bottom positions
+ *
+ * @param g
+ * graphics object to draw on
+ * @param sx
+ * start x position
+ * @param xwidth
+ * width of gap
+ * @param visWidth
+ * visWidth maximum available width
+ * @param top
+ * position to draw top of group at
+ * @param bottom
+ * position to draw bottom of group at
+ */
+ private void drawHorizontals(Graphics2D g, int sx, int xwidth,
+ int visWidth, int top, int bottom)
+ {
+ int width = xwidth;
+ int startx = sx;
+ if (startx < 0)
{
- sy = verticalOffset + ((i - startSeq) * charHeight);
- if (sx >= 0 && sx < visWidth)
- {
- g.drawLine(sx, oldY, sx, sy);
- }
+ width += startx;
+ startx = 0;
+ }
- if (sx + xwidth < visWidth)
- {
- g.drawLine(sx + xwidth, oldY, sx + xwidth, sy);
- }
+ // don't let width extend beyond current block, or group extent
+ // fixes JAL-2672
+ if (startx + width >= visWidth)
+ {
+ width = visWidth - startx;
+ }
- if (sx < 0)
- {
- xwidth += sx;
- sx = 0;
- }
+ if (top != -1)
+ {
+ g.drawLine(startx, top, startx + width, top);
+ }
+
+ if (bottom != -1)
+ {
+ g.drawLine(startx, bottom - 1, startx + width, bottom - 1);
+ }
+ }
- if (sx + xwidth > visWidth)
+ /**
+ * Draw vertical lines at sx and sx+xwidth providing they lie within
+ * [0,visWidth)
+ *
+ * @param g
+ * graphics object to draw on
+ * @param sx
+ * start x position
+ * @param xwidth
+ * width of gap
+ * @param visWidth
+ * visWidth maximum available width
+ * @param oldY
+ * top y value
+ * @param sy
+ * bottom y value
+ */
+ private void drawVerticals(Graphics2D g, int sx, int xwidth, int visWidth,
+ int oldY, int sy)
+ {
+ // if start position is visible, draw vertical line to left of
+ // group
+ if (sx >= 0 && sx < visWidth)
+ {
+ g.drawLine(sx, oldY, sx, sy);
+ }
+
+ // if end position is visible, draw vertical line to right of
+ // group
+ if (sx + xwidth < visWidth)
+ {
+ g.drawLine(sx + xwidth, oldY, sx + xwidth, sy);
+ }
+ }
+
+ /**
+ * Highlights search results in the visible region by rendering as white text
+ * on a black background. Any previous highlighting is removed. Answers true
+ * if any highlight was left on the visible alignment (so status bar should be
+ * set to match), else false.
+ * <p>
+ * Currently fastPaint is not implemented for wrapped alignments. If a wrapped
+ * alignment had to be scrolled to show the highlighted region, then it should
+ * be fully redrawn, otherwise a fast paint can be performed. This argument
+ * could be removed if fast paint of scrolled wrapped alignment is coded in
+ * future (JAL-2609).
+ *
+ * @param results
+ * @param noFastPaint
+ * @return
+ */
+ public boolean highlightSearchResults(SearchResultsI results,
+ boolean noFastPaint)
+ {
+ if (fastpainting)
+ {
+ return false;
+ }
+ boolean wrapped = av.getWrapAlignment();
+ try
+ {
+ fastPaint = !noFastPaint;
+ fastpainting = fastPaint;
+
+ /*
+ * to avoid redrawing the whole visible region, we instead
+ * redraw just the minimal regions to remove previous highlights
+ * and add new ones
+ */
+ SearchResultsI previous = av.getSearchResults();
+ av.setSearchResults(results);
+ boolean redrawn = false;
+ boolean drawn = false;
+ if (wrapped)
{
- xwidth = visWidth;
+ redrawn = drawMappedPositionsWrapped(previous);
+ drawn = drawMappedPositionsWrapped(results);
+ redrawn |= drawn;
}
- else if (sx + xwidth >= (endRes - startRes + 1) * charWidth)
+ else
{
- xwidth = (endRes - startRes + 1) * charWidth;
+ redrawn = drawMappedPositions(previous);
+ drawn = drawMappedPositions(results);
+ redrawn |= drawn;
}
- if (top != -1)
+ /*
+ * if highlights were either removed or added, repaint
+ */
+ if (redrawn)
{
- g.drawLine(sx, top, sx + xwidth, top);
- top = -1;
+ repaint();
}
- if (bottom != -1)
- {
- g.drawLine(sx, bottom - 1, sx + xwidth, bottom - 1);
- bottom = -1;
- }
+ /*
+ * return true only if highlights were added
+ */
+ return drawn;
- inGroup = false;
+ } finally
+ {
+ fastpainting = false;
}
}
-
+
/**
- * DOCUMENT ME!
+ * Redraws the minimal rectangle in the visible region (if any) that includes
+ * mapped positions of the given search results. Whether or not positions are
+ * highlighted depends on the SearchResults set on the Viewport. This allows
+ * this method to be called to either clear or set highlighting. Answers true
+ * if any positions were drawn (in which case a repaint is still required),
+ * else false.
*
* @param results
- * DOCUMENT ME!
+ * @return
*/
- public void highlightSearchResults(SearchResultsI results)
+ protected boolean drawMappedPositions(SearchResultsI results)
{
- img = null;
+ if ((results == null) || (gg == null)) // JAL-2784 check gg is not null
+ {
+ return false;
+ }
- av.setSearchResults(results);
+ /*
+ * calculate the minimal rectangle to redraw that
+ * includes both new and existing search results
+ */
+ int firstSeq = Integer.MAX_VALUE;
+ int lastSeq = -1;
+ int firstCol = Integer.MAX_VALUE;
+ int lastCol = -1;
+ boolean matchFound = false;
+
+ ViewportRanges ranges = av.getRanges();
+ int firstVisibleColumn = ranges.getStartRes();
+ int lastVisibleColumn = ranges.getEndRes();
+ AlignmentI alignment = av.getAlignment();
+ if (av.hasHiddenColumns())
+ {
+ firstVisibleColumn = alignment.getHiddenColumns()
+ .adjustForHiddenColumns(firstVisibleColumn);
+ lastVisibleColumn = alignment.getHiddenColumns()
+ .adjustForHiddenColumns(lastVisibleColumn);
+ }
+
+ for (int seqNo = ranges.getStartSeq(); seqNo <= ranges
+ .getEndSeq(); seqNo++)
+ {
+ SequenceI seq = alignment.getSequenceAt(seqNo);
+
+ int[] visibleResults = results.getResults(seq, firstVisibleColumn,
+ lastVisibleColumn);
+ if (visibleResults != null)
+ {
+ for (int i = 0; i < visibleResults.length - 1; i += 2)
+ {
+ int firstMatchedColumn = visibleResults[i];
+ int lastMatchedColumn = visibleResults[i + 1];
+ if (firstMatchedColumn <= lastVisibleColumn
+ && lastMatchedColumn >= firstVisibleColumn)
+ {
+ /*
+ * found a search results match in the visible region -
+ * remember the first and last sequence matched, and the first
+ * and last visible columns in the matched positions
+ */
+ matchFound = true;
+ firstSeq = Math.min(firstSeq, seqNo);
+ lastSeq = Math.max(lastSeq, seqNo);
+ firstMatchedColumn = Math.max(firstMatchedColumn,
+ firstVisibleColumn);
+ lastMatchedColumn = Math.min(lastMatchedColumn,
+ lastVisibleColumn);
+ firstCol = Math.min(firstCol, firstMatchedColumn);
+ lastCol = Math.max(lastCol, lastMatchedColumn);
+ }
+ }
+ }
+ }
+
+ if (matchFound)
+ {
+ if (av.hasHiddenColumns())
+ {
+ firstCol = alignment.getHiddenColumns()
+ .findColumnPosition(firstCol);
+ lastCol = alignment.getHiddenColumns().findColumnPosition(lastCol);
+ }
+ int transX = (firstCol - ranges.getStartRes()) * av.getCharWidth();
+ int transY = (firstSeq - ranges.getStartSeq()) * av.getCharHeight();
+ gg.translate(transX, transY);
+ drawPanel(gg, firstCol, lastCol, firstSeq, lastSeq, 0);
+ gg.translate(-transX, -transY);
+ }
- repaint();
+ return matchFound;
}
@Override
{
fastPaint = true;
repaint();
+ return;
}
- else if (av.getWrapAlignment())
+ else if (eventName.equals(ViewportRanges.MOVE_VIEWPORT))
{
- if (eventName.equals(ViewportRanges.STARTRES))
- {
- repaint();
- }
+ fastPaint = false;
+ repaint();
+ return;
}
- else
+
+ int scrollX = 0;
+ if (eventName.equals(ViewportRanges.STARTRES)
+ || eventName.equals(ViewportRanges.STARTRESANDSEQ))
{
- int scrollX = 0;
+ // Make sure we're not trying to draw a panel
+ // larger than the visible window
if (eventName.equals(ViewportRanges.STARTRES))
{
- // Make sure we're not trying to draw a panel
- // larger than the visible window
- ViewportRanges vpRanges = av.getRanges();
scrollX = (int) evt.getNewValue() - (int) evt.getOldValue();
- int range = vpRanges.getEndRes() - vpRanges.getStartRes();
- if (scrollX > range)
- {
- scrollX = range;
- }
- else if (scrollX < -range)
- {
- scrollX = -range;
- }
+ }
+ else
+ {
+ scrollX = ((int[]) evt.getNewValue())[0]
+ - ((int[]) evt.getOldValue())[0];
+ }
+ ViewportRanges vpRanges = av.getRanges();
+
+ int range = vpRanges.getEndRes() - vpRanges.getStartRes();
+ if (scrollX > range)
+ {
+ scrollX = range;
+ }
+ else if (scrollX < -range)
+ {
+ scrollX = -range;
}
// Both scrolling and resizing change viewport ranges: scrolling changes
// vertical start value.
if (eventName.equals(ViewportRanges.STARTRES))
{
- // scroll - startres and endres both change
- fastPaint(scrollX, 0);
+ if (av.getWrapAlignment())
+ {
+ fastPaintWrapped(scrollX);
+ }
+ else
+ {
+ fastPaint(scrollX, 0);
+ }
}
else if (eventName.equals(ViewportRanges.STARTSEQ))
{
// scroll
fastPaint(0, (int) evt.getNewValue() - (int) evt.getOldValue());
}
+ else if (eventName.equals(ViewportRanges.STARTRESANDSEQ))
+ {
+ if (av.getWrapAlignment())
+ {
+ fastPaintWrapped(scrollX);
+ }
+ else
+ {
+ fastPaint(scrollX, 0);
+ }
+ // bizarrely, we only need to scroll on the x value here as fastpaint
+ // copies the full height of the image anyway. Passing in the y value
+ // causes nasty repaint artefacts, which only disappear on a full
+ // repaint.
+ }
+ }
+ }
+
+ /**
+ * Does a minimal update of the image for a scroll movement. This method
+ * handles scroll movements of up to one width of the wrapped alignment (one
+ * click in the vertical scrollbar). Larger movements (for example after a
+ * scroll to highlight a mapped position) trigger a full redraw instead.
+ *
+ * @param scrollX
+ * number of positions scrolled (right if positive, left if negative)
+ */
+ protected void fastPaintWrapped(int scrollX)
+ {
+ ViewportRanges ranges = av.getRanges();
+
+ // if (Math.abs(scrollX) > ranges.getViewportWidth())
+ // JAL-2836, 2836 temporarily removed wrapped fastpaint for release 2.10.3
+ if (true)
+ {
+ /*
+ * shift of more than one view width is
+ * overcomplicated to handle in this method
+ */
+ fastPaint = false;
+ repaint();
+ return;
+ }
+
+ if (fastpainting || gg == null)
+ {
+ return;
+ }
+
+ fastPaint = true;
+ fastpainting = true;
+
+ try
+ {
+ calculateWrappedGeometry(getWidth(), getHeight());
+
+ /*
+ * relocate the regions of the alignment that are still visible
+ */
+ shiftWrappedAlignment(-scrollX);
+
+ /*
+ * add new columns (sequence, annotation)
+ * - at top left if scrollX < 0
+ * - at right of last two widths if scrollX > 0
+ */
+ if (scrollX < 0)
+ {
+ int startRes = ranges.getStartRes();
+ drawWrappedWidth(gg, wrappedSpaceAboveAlignment, startRes, startRes
+ - scrollX - 1, getHeight());
+ }
+ else
+ {
+ fastPaintWrappedAddRight(scrollX);
+ }
+
+ /*
+ * draw all scales (if shown) and hidden column markers
+ */
+ drawWrappedDecorators(gg, ranges.getStartRes());
+
+ repaint();
+ } finally
+ {
+ fastpainting = false;
+ }
+ }
+
+ /**
+ * Draws the specified number of columns at the 'end' (bottom right) of a
+ * wrapped alignment view, including sequences and annotations if shown, but
+ * not scales. Also draws the same number of columns at the right hand end of
+ * the second last width shown, if the last width is not full height (so
+ * cannot simply be copied from the graphics image).
+ *
+ * @param columns
+ */
+ protected void fastPaintWrappedAddRight(int columns)
+ {
+ if (columns == 0)
+ {
+ return;
+ }
+
+ ViewportRanges ranges = av.getRanges();
+ int viewportWidth = ranges.getViewportWidth();
+ int charWidth = av.getCharWidth();
+
+ /**
+ * draw full height alignment in the second last row, last columns, if the
+ * last row was not full height
+ */
+ int visibleWidths = wrappedVisibleWidths;
+ int canvasHeight = getHeight();
+ boolean lastWidthPartHeight = (wrappedVisibleWidths * wrappedRepeatHeightPx) > canvasHeight;
+
+ if (lastWidthPartHeight)
+ {
+ int widthsAbove = Math.max(0, visibleWidths - 2);
+ int ypos = wrappedRepeatHeightPx * widthsAbove
+ + wrappedSpaceAboveAlignment;
+ int endRes = ranges.getEndRes();
+ endRes += widthsAbove * viewportWidth;
+ int startRes = endRes - columns;
+ int xOffset = ((startRes - ranges.getStartRes()) % viewportWidth)
+ * charWidth;
+
+ /*
+ * white fill first to erase annotations
+ */
+ gg.translate(xOffset, 0);
+ gg.setColor(Color.white);
+ gg.fillRect(labelWidthWest, ypos,
+ (endRes - startRes + 1) * charWidth, wrappedRepeatHeightPx);
+ gg.translate(-xOffset, 0);
+
+ drawWrappedWidth(gg, ypos, startRes, endRes, canvasHeight);
+ }
+
+ /*
+ * draw newly visible columns in last wrapped width (none if we
+ * have reached the end of the alignment)
+ * y-offset for drawing last width is height of widths above,
+ * plus one gap row
+ */
+ int widthsAbove = visibleWidths - 1;
+ int ypos = wrappedRepeatHeightPx * widthsAbove
+ + wrappedSpaceAboveAlignment;
+ int endRes = ranges.getEndRes();
+ endRes += widthsAbove * viewportWidth;
+ int startRes = endRes - columns + 1;
+
+ /*
+ * white fill first to erase annotations
+ */
+ int xOffset = ((startRes - ranges.getStartRes()) % viewportWidth)
+ * charWidth;
+ gg.translate(xOffset, 0);
+ gg.setColor(Color.white);
+ int width = viewportWidth * charWidth - xOffset;
+ gg.fillRect(labelWidthWest, ypos, width, wrappedRepeatHeightPx);
+ gg.translate(-xOffset, 0);
+
+ gg.setFont(av.getFont());
+ gg.setColor(Color.black);
+
+ if (startRes < ranges.getVisibleAlignmentWidth())
+ {
+ drawWrappedWidth(gg, ypos, startRes, endRes, canvasHeight);
+ }
+
+ /*
+ * and finally, white fill any space below the visible alignment
+ */
+ int heightBelow = canvasHeight - visibleWidths * wrappedRepeatHeightPx;
+ if (heightBelow > 0)
+ {
+ gg.setColor(Color.white);
+ gg.fillRect(0, canvasHeight - heightBelow, getWidth(), heightBelow);
+ }
+ }
+
+ /**
+ * Shifts the visible alignment by the specified number of columns - left if
+ * negative, right if positive. Copies and moves sequences and annotations (if
+ * shown). Scales, hidden column markers and any newly visible columns must be
+ * drawn separately.
+ *
+ * @param positions
+ */
+ protected void shiftWrappedAlignment(int positions)
+ {
+ if (positions == 0)
+ {
+ return;
+ }
+ int charWidth = av.getCharWidth();
+
+ int canvasHeight = getHeight();
+ ViewportRanges ranges = av.getRanges();
+ int viewportWidth = ranges.getViewportWidth();
+ int widthToCopy = (ranges.getViewportWidth() - Math.abs(positions))
+ * charWidth;
+ int heightToCopy = wrappedRepeatHeightPx - wrappedSpaceAboveAlignment;
+ int xMax = ranges.getVisibleAlignmentWidth();
+
+ if (positions > 0)
+ {
+ /*
+ * shift right (after scroll left)
+ * for each wrapped width (starting with the last), copy (width-positions)
+ * columns from the left margin to the right margin, and copy positions
+ * columns from the right margin of the row above (if any) to the
+ * left margin of the current row
+ */
+
+ /*
+ * get y-offset of last wrapped width, first row of sequences
+ */
+ int y = canvasHeight / wrappedRepeatHeightPx * wrappedRepeatHeightPx;
+ y += wrappedSpaceAboveAlignment;
+ int copyFromLeftStart = labelWidthWest;
+ int copyFromRightStart = copyFromLeftStart + widthToCopy;
+
+ while (y >= 0)
+ {
+ gg.copyArea(copyFromLeftStart, y, widthToCopy, heightToCopy,
+ positions * charWidth, 0);
+ if (y > 0)
+ {
+ gg.copyArea(copyFromRightStart, y - wrappedRepeatHeightPx,
+ positions * charWidth, heightToCopy, -widthToCopy,
+ wrappedRepeatHeightPx);
+ }
+
+ y -= wrappedRepeatHeightPx;
+ }
}
+ else
+ {
+ /*
+ * shift left (after scroll right)
+ * for each wrapped width (starting with the first), copy (width-positions)
+ * columns from the right margin to the left margin, and copy positions
+ * columns from the left margin of the row below (if any) to the
+ * right margin of the current row
+ */
+ int xpos = av.getRanges().getStartRes();
+ int y = wrappedSpaceAboveAlignment;
+ int copyFromRightStart = labelWidthWest - positions * charWidth;
+
+ while (y < canvasHeight)
+ {
+ gg.copyArea(copyFromRightStart, y, widthToCopy, heightToCopy,
+ positions * charWidth, 0);
+ if (y + wrappedRepeatHeightPx < canvasHeight - wrappedRepeatHeightPx
+ && (xpos + viewportWidth <= xMax))
+ {
+ gg.copyArea(labelWidthWest, y + wrappedRepeatHeightPx, -positions
+ * charWidth, heightToCopy, widthToCopy,
+ -wrappedRepeatHeightPx);
+ }
+
+ y += wrappedRepeatHeightPx;
+ xpos += viewportWidth;
+ }
+ }
+ }
+
+
+ /**
+ * Redraws any positions in the search results in the visible region of a
+ * wrapped alignment. Any highlights are drawn depending on the search results
+ * set on the Viewport, not the <code>results</code> argument. This allows
+ * this method to be called either to clear highlights (passing the previous
+ * search results), or to draw new highlights.
+ *
+ * @param results
+ * @return
+ */
+ protected boolean drawMappedPositionsWrapped(SearchResultsI results)
+ {
+ if ((results == null) || (gg == null)) // JAL-2784 check gg is not null
+ {
+ return false;
+ }
+ int charHeight = av.getCharHeight();
+
+ boolean matchFound = false;
+
+ calculateWrappedGeometry(getWidth(), getHeight());
+ int wrappedWidth = av.getWrappedWidth();
+ int wrappedHeight = wrappedRepeatHeightPx;
+
+ ViewportRanges ranges = av.getRanges();
+ int canvasHeight = getHeight();
+ int repeats = canvasHeight / wrappedHeight;
+ if (canvasHeight / wrappedHeight > 0)
+ {
+ repeats++;
+ }
+
+ int firstVisibleColumn = ranges.getStartRes();
+ int lastVisibleColumn = ranges.getStartRes() + repeats
+ * ranges.getViewportWidth() - 1;
+
+ AlignmentI alignment = av.getAlignment();
+ if (av.hasHiddenColumns())
+ {
+ firstVisibleColumn = alignment.getHiddenColumns()
+ .adjustForHiddenColumns(firstVisibleColumn);
+ lastVisibleColumn = alignment.getHiddenColumns()
+ .adjustForHiddenColumns(lastVisibleColumn);
+ }
+
+ int gapHeight = charHeight * (av.getScaleAboveWrapped() ? 2 : 1);
+
+ for (int seqNo = ranges.getStartSeq(); seqNo <= ranges
+ .getEndSeq(); seqNo++)
+ {
+ SequenceI seq = alignment.getSequenceAt(seqNo);
+
+ int[] visibleResults = results.getResults(seq, firstVisibleColumn,
+ lastVisibleColumn);
+ if (visibleResults != null)
+ {
+ for (int i = 0; i < visibleResults.length - 1; i += 2)
+ {
+ int firstMatchedColumn = visibleResults[i];
+ int lastMatchedColumn = visibleResults[i + 1];
+ if (firstMatchedColumn <= lastVisibleColumn
+ && lastMatchedColumn >= firstVisibleColumn)
+ {
+ /*
+ * found a search results match in the visible region
+ */
+ firstMatchedColumn = Math.max(firstMatchedColumn,
+ firstVisibleColumn);
+ lastMatchedColumn = Math.min(lastMatchedColumn,
+ lastVisibleColumn);
+
+ /*
+ * draw each mapped position separately (as contiguous positions may
+ * wrap across lines)
+ */
+ for (int mappedPos = firstMatchedColumn; mappedPos <= lastMatchedColumn; mappedPos++)
+ {
+ int displayColumn = mappedPos;
+ if (av.hasHiddenColumns())
+ {
+ displayColumn = alignment.getHiddenColumns()
+ .findColumnPosition(displayColumn);
+ }
+
+ /*
+ * transX: offset from left edge of canvas to residue position
+ */
+ int transX = labelWidthWest
+ + ((displayColumn - ranges.getStartRes()) % wrappedWidth)
+ * av.getCharWidth();
+
+ /*
+ * transY: offset from top edge of canvas to residue position
+ */
+ int transY = gapHeight;
+ transY += (displayColumn - ranges.getStartRes())
+ / wrappedWidth * wrappedHeight;
+ transY += (seqNo - ranges.getStartSeq()) * av.getCharHeight();
+
+ /*
+ * yOffset is from graphics origin to start of visible region
+ */
+ int yOffset = 0;// (displayColumn / wrappedWidth) * wrappedHeight;
+ if (transY < getHeight())
+ {
+ matchFound = true;
+ gg.translate(transX, transY);
+ drawPanel(gg, displayColumn, displayColumn, seqNo, seqNo,
+ yOffset);
+ gg.translate(-transX, -transY);
+ }
+ }
+ }
+ }
+ }
+ }
+
+ return matchFound;
+ }
+
+ /**
+ * Answers the width in pixels of the left scale labels (0 if not shown)
+ *
+ * @return
+ */
+ int getLabelWidthWest()
+ {
+ return labelWidthWest;
}
}
import java.util.ArrayList;
import java.util.Collections;
import java.util.List;
-import java.util.ListIterator;
import javax.swing.JPanel;
import javax.swing.SwingUtilities;
/** DOCUMENT ME!! */
public AlignmentPanel ap;
+ /*
+ * last column position for mouseMoved event
+ */
+ private int lastMouseColumn;
+
+ /*
+ * last sequence offset for mouseMoved event
+ */
+ private int lastMouseSeq;
+
protected int lastres;
protected int startseq;
ssm.addStructureViewerListener(this);
ssm.addSelectionListener(this);
}
+
+ lastMouseColumn = -1;
+ lastMouseSeq = -1;
}
int startWrapBlock = -1;
+ hgap + seqCanvas.getAnnotationHeight();
int y = evt.getY();
- y -= hgap;
- x = Math.max(0, x - seqCanvas.LABEL_WEST);
+ y = Math.max(0, y - hgap);
+ x = Math.max(0, x - seqCanvas.getLabelWidthWest());
int cwidth = seqCanvas.getWrappedCanvasWidth(this.getWidth());
if (cwidth < 1)
void setCursorRow()
{
seqCanvas.cursorY = getKeyboardNo1() - 1;
- scrollToVisible();
+ scrollToVisible(true);
}
void setCursorColumn()
{
seqCanvas.cursorX = getKeyboardNo1() - 1;
- scrollToVisible();
+ scrollToVisible(true);
}
void setCursorRowAndColumn()
{
seqCanvas.cursorX = getKeyboardNo1() - 1;
seqCanvas.cursorY = getKeyboardNo2() - 1;
- scrollToVisible();
+ scrollToVisible(true);
}
}
SequenceI sequence = av.getAlignment().getSequenceAt(seqCanvas.cursorY);
seqCanvas.cursorX = sequence.findIndex(getKeyboardNo1()) - 1;
- scrollToVisible();
+ scrollToVisible(true);
}
void moveCursor(int dx, int dy)
}
}
- scrollToVisible();
+ scrollToVisible(false);
}
- void scrollToVisible()
+ /**
+ * Scroll to make the cursor visible in the viewport.
+ *
+ * @param jump
+ * just jump to the location rather than scrolling
+ */
+ void scrollToVisible(boolean jump)
{
if (seqCanvas.cursorX < 0)
{
}
endEditing();
- if (av.getWrapAlignment())
+
+ boolean repaintNeeded = true;
+ if (jump)
{
- av.getRanges().scrollToWrappedVisible(seqCanvas.cursorX);
+ // only need to repaint if the viewport did not move, as otherwise it will
+ // get a repaint
+ repaintNeeded = !av.getRanges().setViewportLocation(seqCanvas.cursorX,
+ seqCanvas.cursorY);
}
else
{
- av.getRanges().scrollToVisible(seqCanvas.cursorX, seqCanvas.cursorY);
+ if (av.getWrapAlignment())
+ {
+ // scrollToWrappedVisible expects x-value to have hidden cols subtracted
+ int x = av.getAlignment().getHiddenColumns()
+ .findColumnPosition(seqCanvas.cursorX);
+ av.getRanges().scrollToWrappedVisible(x);
+ }
+ else
+ {
+ av.getRanges().scrollToVisible(seqCanvas.cursorX,
+ seqCanvas.cursorY);
+ }
}
- setStatusMessage(av.getAlignment().getSequenceAt(seqCanvas.cursorY),
+
+ if (av.getAlignment().getHiddenColumns().isVisible(seqCanvas.cursorX))
+ {
+ setStatusMessage(av.getAlignment().getSequenceAt(seqCanvas.cursorY),
seqCanvas.cursorX, seqCanvas.cursorY);
+ }
- seqCanvas.repaint();
+ if (repaintNeeded)
+ {
+ seqCanvas.repaint();
+ }
}
+
void setSelectionAreaAtCursor(boolean topLeft)
{
SequenceI sequence = av.getAlignment().getSequenceAt(seqCanvas.cursorY);
av.setSelectionGroup(sg);
}
- ap.paintAlignment(false);
+ ap.paintAlignment(false, false);
av.sendSelection();
}
}
lastSearchResults = results;
+ boolean wasScrolled = false;
+
if (av.isFollowHighlight())
{
// don't allow highlight of protein/cDNA to also scroll a complementary
// over residue to change abruptly, causing highlighted residue in panel 2
// to change, causing a scroll in panel 1 etc)
ap.setToScrollComplementPanel(false);
- if (ap.scrollToPosition(results, false))
+ wasScrolled = ap.scrollToPosition(results, false);
+ if (wasScrolled)
{
seqCanvas.revalidate();
}
ap.setToScrollComplementPanel(true);
}
- setStatusMessage(results);
- seqCanvas.highlightSearchResults(results);
+
+ boolean noFastPaint = wasScrolled && av.getWrapAlignment();
+ if (seqCanvas.highlightSearchResults(results, noFastPaint))
+ {
+ setStatusMessage(results);
+ }
}
@Override
}
/**
- * DOCUMENT ME!
+ * Action on mouse movement is to update the status bar to show the current
+ * sequence position, and (if features are shown) to show any features at the
+ * position in a tooltip. Does nothing if the mouse move does not change
+ * residue position.
*
* @param evt
- * DOCUMENT ME!
*/
@Override
public void mouseMoved(MouseEvent evt)
}
final int column = findColumn(evt);
- int seq = findSeq(evt);
+ final int seq = findSeq(evt);
+
if (column < 0 || seq < 0 || seq >= av.getAlignment().getHeight())
{
+ lastMouseSeq = -1;
+ return;
+ }
+ if (column == lastMouseColumn && seq == lastMouseSeq)
+ {
+ /*
+ * just a pixel move without change of residue
+ */
return;
}
+ lastMouseColumn = column;
+ lastMouseSeq = seq;
SequenceI sequence = av.getAlignment().getSequenceAt(seq);
if (av.isShowSequenceFeatures())
{
List<SequenceFeature> features = ap.getFeatureRenderer()
- .findFeaturesAtRes(sequence.getDatasetSequence(), pos);
- if (isGapped)
- {
- removeAdjacentFeatures(features, column + 1, sequence);
- }
+ .findFeaturesAtColumn(sequence, column + 1);
seqARep.appendFeatures(tooltipText, pos, features,
this.ap.getSeqPanel().seqCanvas.fr.getMinMax());
}
}
else
{
- if (lastTooltip == null
- || !lastTooltip.equals(tooltipText.toString()))
+ String textString = tooltipText.toString();
+ if (lastTooltip == null || !lastTooltip.equals(textString))
{
- String formatedTooltipText = JvSwingUtils.wrapTooltip(true,
- tooltipText.toString());
- // String formatedTooltipText = tooltipText.toString();
- setToolTipText(formatedTooltipText);
- lastTooltip = tooltipText.toString();
- }
-
- }
-
- }
-
- /**
- * Removes from the list of features any that start after, or end before, the
- * given column position. This allows us to retain only those features
- * adjacent to a gapped position that straddle the position. Contact features
- * that 'straddle' the position are also removed, since they are not 'at' the
- * position.
- *
- * @param features
- * @param column
- * alignment column (1..)
- * @param sequence
- */
- protected void removeAdjacentFeatures(List<SequenceFeature> features,
- final int column, SequenceI sequence)
- {
- // TODO should this be an AlignViewController method (and reused by applet)?
- ListIterator<SequenceFeature> it = features.listIterator();
- while (it.hasNext())
- {
- SequenceFeature sf = it.next();
- if (sf.isContactFeature()
- || sequence.findIndex(sf.getBegin()) > column
- || sequence.findIndex(sf.getEnd()) < column)
- {
- it.remove();
+ String formattedTooltipText = JvSwingUtils.wrapTooltip(true,
+ textString);
+ setToolTipText(formattedTooltipText);
+ lastTooltip = textString;
}
}
}
/**
* set when the current UI interaction has resulted in a change that requires
- * overview shading to be recalculated. this could be changed to something
- * more expressive that indicates what actually has changed, so selective
- * redraws can be applied
+ * shading in overviews and structures to be recalculated. this could be
+ * changed to a something more expressive that indicates what actually has
+ * changed, so selective redraws can be applied (ie. only structures, only
+ * overview, etc)
*/
- private boolean needOverviewUpdate = false; // TODO: refactor to avcontroller
+ private boolean updateOverviewAndStructs = false; // TODO: refactor to avcontroller
/**
* set if av.getSelectionGroup() refers to a group that is defined on the
* aligned sequence object
* @param column
* alignment column
- * @param seq
+ * @param seqIndex
* index of sequence in alignment
* @return sequence position of residue at column, or adjacent residue if at a
* gap
*/
- int setStatusMessage(SequenceI sequence, final int column, int seq)
+ int setStatusMessage(SequenceI sequence, final int column, int seqIndex)
+ {
+ char sequenceChar = sequence.getCharAt(column);
+ int pos = sequence.findPosition(column);
+ setStatusMessage(sequence, seqIndex, sequenceChar, pos);
+
+ return pos;
+ }
+
+ /**
+ * Builds the status message for the current cursor location and writes it to
+ * the status bar, for example
+ *
+ * <pre>
+ * Sequence 3 ID: FER1_SOLLC
+ * Sequence 5 ID: FER1_PEA Residue: THR (4)
+ * Sequence 5 ID: FER1_PEA Residue: B (3)
+ * Sequence 6 ID: O.niloticus.3 Nucleotide: Uracil (2)
+ * </pre>
+ *
+ * @param sequence
+ * @param seqIndex
+ * sequence position in the alignment (1..)
+ * @param sequenceChar
+ * the character under the cursor
+ * @param residuePos
+ * the sequence residue position (if not over a gap)
+ */
+ protected void setStatusMessage(SequenceI sequence, int seqIndex,
+ char sequenceChar, int residuePos)
{
StringBuilder text = new StringBuilder(32);
/*
* Sequence number (if known), and sequence name.
*/
- String seqno = seq == -1 ? "" : " " + (seq + 1);
+ String seqno = seqIndex == -1 ? "" : " " + (seqIndex + 1);
text.append("Sequence").append(seqno).append(" ID: ")
.append(sequence.getName());
/*
* Try to translate the display character to residue name (null for gap).
*/
- final String displayChar = String.valueOf(sequence.getCharAt(column));
- boolean isGapped = Comparison.isGap(sequence.getCharAt(column));
- int pos = sequence.findPosition(column);
+ boolean isGapped = Comparison.isGap(sequenceChar);
if (!isGapped)
{
boolean nucleotide = av.getAlignment().isNucleotide();
+ String displayChar = String.valueOf(sequenceChar);
if (nucleotide)
{
residue = ResidueProperties.nucleotideName.get(displayChar);
text.append(" ").append(nucleotide ? "Nucleotide" : "Residue")
.append(": ").append(residue == null ? displayChar : residue);
- text.append(" (").append(Integer.toString(pos)).append(")");
+ text.append(" (").append(Integer.toString(residuePos)).append(")");
}
ap.alignFrame.statusBar.setText(text.toString());
-
- return pos;
}
/**
if (seq == ds)
{
- /*
- * Convert position in sequence (base 1) to sequence character array
- * index (base 0)
- */
- int start = m.getStart() - m.getSequence().getStart();
- setStatusMessage(seq, start, sequenceIndex);
+ int start = m.getStart();
+ setStatusMessage(seq, sequenceIndex, seq.getCharAt(start - 1),
+ start);
return;
}
}
}
if (newWidth > 0)
{
- ap.paintAlignment(false);
+ ap.paintAlignment(false, false);
if (copyChanges)
{
/*
// Find the next gap before the end
// of the visible region boundary
boolean blank = false;
- for (fixedRight = fixedRight; fixedRight > lastres; fixedRight--)
+ for (; fixedRight > lastres; fixedRight--)
{
blank = true;
}
int column = findColumn(evt);
- boolean isGapped = Comparison.isGap(sequence.getCharAt(column));
/*
* find features at the position (if not gapped), or straddling
* the position (if at a gap)
*/
List<SequenceFeature> features = seqCanvas.getFeatureRenderer()
- .findFeaturesAtRes(sequence.getDatasetSequence(),
- sequence.findPosition(column));
- if (isGapped)
- {
- removeAdjacentFeatures(features, column, sequence);
- }
+ .findFeaturesAtColumn(sequence, column + 1);
if (!features.isEmpty())
{
* highlight the first feature at the position on the alignment
*/
SearchResultsI highlight = new SearchResults();
- highlight.addResult(sequence, features.get(0).getBegin(),
- features.get(0).getEnd());
- seqCanvas.highlightSearchResults(highlight);
+ highlight.addResult(sequence, features.get(0).getBegin(), features
+ .get(0).getEnd());
+ seqCanvas.highlightSearchResults(highlight, false);
/*
* open the Amend Features dialog; clear highlighting afterwards,
List<SequenceI> seqs = Collections.singletonList(sequence);
seqCanvas.getFeatureRenderer().amendFeatures(seqs, features, false,
ap);
- seqCanvas.highlightSearchResults(null);
+ av.setSearchResults(null); // clear highlighting
+ seqCanvas.repaint(); // draw new/amended features
}
}
}
av.getRanges().scrollRight(true);
}
- else if (!av.getWrapAlignment())
+ else
{
av.getRanges().scrollUp(false);
}
{
av.getRanges().scrollRight(false);
}
- else if (!av.getWrapAlignment())
+ else
{
av.getRanges().scrollUp(true);
}
}
- // TODO Update tooltip for new position.
+
+ /*
+ * update status bar and tooltip for new position
+ * (need to synthesize a mouse movement to refresh tooltip)
+ */
+ mouseMoved(e);
+ ToolTipManager.sharedInstance().mouseMoved(e);
}
/**
final int res = findColumn(evt);
final int seq = findSeq(evt);
oldSeq = seq;
- needOverviewUpdate = false;
+ updateOverviewAndStructs = false;
startWrapBlock = wrappedBlock;
*/
void showPopupMenu(MouseEvent evt)
{
- final int res = findColumn(evt);
+ final int column = findColumn(evt);
final int seq = findSeq(evt);
SequenceI sequence = av.getAlignment().getSequenceAt(seq);
List<SequenceFeature> allFeatures = ap.getFeatureRenderer()
- .findFeaturesAtRes(sequence.getDatasetSequence(),
- sequence.findPosition(res));
+ .findFeaturesAtColumn(sequence, column + 1);
List<String> links = new ArrayList<>();
for (SequenceFeature sf : allFeatures)
{
// always do this - annotation has own state
// but defer colourscheme update until hidden sequences are passed in
boolean vischange = stretchGroup.recalcConservation(true);
- needOverviewUpdate |= vischange && av.isSelectionDefinedGroup()
+ updateOverviewAndStructs |= vischange && av.isSelectionDefinedGroup()
&& afterDrag;
if (stretchGroup.cs != null)
{
}
}
PaintRefresher.Refresh(this, av.getSequenceSetId());
- ap.paintAlignment(needOverviewUpdate);
- needOverviewUpdate = false;
+ // TODO: structure colours only need updating if stretchGroup used to or now
+ // does contain sequences with structure views
+ ap.paintAlignment(updateOverviewAndStructs, updateOverviewAndStructs);
+ updateOverviewAndStructs = false;
changeEndRes = false;
changeStartRes = false;
stretchGroup = null;
if (res > (stretchGroup.getStartRes() - 1))
{
stretchGroup.setEndRes(res);
- needOverviewUpdate |= av.isSelectionDefinedGroup();
+ updateOverviewAndStructs |= av.isSelectionDefinedGroup();
}
}
else if (changeStartRes)
if (res < (stretchGroup.getEndRes() + 1))
{
stretchGroup.setStartRes(res);
- needOverviewUpdate |= av.isSelectionDefinedGroup();
+ updateOverviewAndStructs |= av.isSelectionDefinedGroup();
}
}
if (stretchGroup.getSequences(null).contains(nextSeq))
{
stretchGroup.deleteSequence(seq, false);
- needOverviewUpdate |= av.isSelectionDefinedGroup();
+ updateOverviewAndStructs |= av.isSelectionDefinedGroup();
}
else
{
}
stretchGroup.addSequence(nextSeq, false);
- needOverviewUpdate |= av.isSelectionDefinedGroup();
+ updateOverviewAndStructs |= av.isSelectionDefinedGroup();
}
}
import jalview.datamodel.DBRefEntry;
import jalview.datamodel.SequenceFeature;
import jalview.datamodel.SequenceI;
+import jalview.fts.core.GFTSPanel;
import jalview.fts.service.pdb.PDBFTSPanel;
import jalview.fts.service.uniprot.UniprotFTSPanel;
import jalview.io.FileFormatI;
JButton close = new JButton();
+ JButton back = new JButton();
+
JPanel jPanel1 = new JPanel();
JTextArea textArea = new JTextArea();
.getString("label.additional_sequence_fetcher"));
}
+ GFTSPanel parentFTSframe = null;
+ /**
+ * change the buttons so they fit with the FTS panel.
+ */
+ public void embedWithFTSPanel(GFTSPanel toClose)
+ {
+ back.setVisible(true);
+ parentFTSframe = toClose;
+ }
private void jbInit() throws Exception
{
this.setLayout(borderLayout2);
example_actionPerformed();
}
});
- close.setText(MessageManager.getString("action.close"));
+ close.setText(MessageManager.getString("action.cancel"));
close.addActionListener(new ActionListener()
{
@Override
close_actionPerformed(e);
}
});
+ back.setText(MessageManager.getString("action.back"));
+ back.addActionListener(new ActionListener()
+ {
+ @Override
+ public void actionPerformed(ActionEvent e)
+ {
+ parentFTSframe.btn_back_ActionPerformed();
+ }
+ });
+ // back not visible unless embedded
+ back.setVisible(false);
textArea.setFont(JvSwingUtils.getLabelFont());
textArea.setLineWrap(true);
textArea.addKeyListener(new KeyAdapter()
});
jPanel3.setLayout(borderLayout1);
borderLayout1.setVgap(5);
- jPanel1.add(ok);
+ jPanel1.add(back);
jPanel1.add(example);
jPanel1.add(clear);
+ jPanel1.add(ok);
jPanel1.add(close);
jPanel2.setLayout(borderLayout3);
databaseButt = /*database.getDatabaseSelectorButton();
try
{
frame.setClosed(true);
+ if (parentFTSframe!=null)
+ {
+ parentFTSframe.btn_cancel_ActionPerformed();
+ }
} catch (Exception ex)
{
}
textArea.setEnabled(false);
ok.setEnabled(false);
close.setEnabled(false);
-
+ back.setEnabled(false);
Thread worker = new Thread(this);
worker.start();
}
textArea.setEnabled(true);
ok.setEnabled(true);
close.setEnabled(true);
+ back.setEnabled(parentFTSframe != null);
}
@Override
{
for (SequenceI sq : alsqs)
{
- if ((sfs = sq.getSequenceFeatures()) != null)
+ if (sq.getFeatures().hasFeatures())
{
- if (sfs.length > 0)
- {
- af.setShowSeqFeatures(true);
- break;
- }
+ af.setShowSeqFeatures(true);
+ break;
}
-
}
}
{
frame.setVisible(false);
}
+
+ public void setDatabaseChooserVisible(boolean b)
+ {
+ databaseButt.setVisible(b);
+ }
}
}
}
- public void drawCursor(SequenceI seq, int res, int x1, int y1)
+ /**
+ * Draw a sequence canvas cursor
+ *
+ * @param g
+ * graphics context to draw on
+ * @param s
+ * character to draw at cursor
+ * @param x1
+ * x position of cursor in graphics context
+ * @param y1
+ * y position of cursor in graphics context
+ */
+ public void drawCursor(Graphics g, char s, int x1, int y1)
{
int pady = av.getCharHeight() / 5;
int charOffset = 0;
- graphics.setColor(Color.black);
- graphics.fillRect(x1, y1, av.getCharWidth(), av.getCharHeight());
+ g.setColor(Color.black);
+ g.fillRect(x1, y1, av.getCharWidth(), av.getCharHeight());
if (av.isValidCharWidth())
{
- graphics.setColor(Color.white);
-
- char s = seq.getCharAt(res);
-
+ g.setColor(Color.white);
charOffset = (av.getCharWidth() - fm.charWidth(s)) / 2;
- graphics.drawString(String.valueOf(s), charOffset + x1,
+ g.drawString(String.valueOf(s), charOffset + x1,
(y1 + av.getCharHeight()) - pady);
}
@Override
public void mouseReleased(MouseEvent evt)
{
- ap.paintAlignment(true);
+ ap.paintAlignment(true, true);
}
});
}
/**
- * Adjust the divider for a sensible split of the real estate (for example,
+ * Adjusts the divider for a sensible split of the real estate (for example,
* when many transcripts are shown with a single protein). This should only be
* called after the split pane has been laid out (made visible) so it has a
- * height.
+ * height. The aim is to avoid unnecessary vertical scroll bars, while
+ * ensuring that at least 2 sequences are visible in each panel.
+ * <p>
+ * Once laid out, the user may choose to customise as they wish, so this
+ * method is not called again after the initial layout.
*/
- protected void adjustDivider()
+ protected void adjustInitialLayout()
{
- final AlignViewport topViewport = ((AlignFrame) getTopFrame()).viewport;
- final AlignViewport bottomViewport = ((AlignFrame) getBottomFrame()).viewport;
+ AlignFrame topFrame = (AlignFrame) getTopFrame();
+ AlignFrame bottomFrame = (AlignFrame) getBottomFrame();
+
+ /*
+ * recompute layout of top and bottom panels to reflect their
+ * actual (rather than requested) height
+ */
+ topFrame.alignPanel.adjustAnnotationHeight();
+ bottomFrame.alignPanel.adjustAnnotationHeight();
+
+ final AlignViewport topViewport = topFrame.viewport;
+ final AlignViewport bottomViewport = bottomFrame.viewport;
final AlignmentI topAlignment = topViewport.getAlignment();
final AlignmentI bottomAlignment = bottomViewport.getAlignment();
boolean topAnnotations = topViewport.isShowAnnotation();
int bottomCharHeight = bottomViewport.getViewStyle().getCharHeight();
/*
+ * calculate the minimum ratio that leaves at least the height
+ * of two sequences (after rounding) visible in the top panel
+ */
+ int topPanelHeight = topFrame.getHeight();
+ int bottomPanelHeight = bottomFrame.getHeight();
+ int topSequencesHeight = topFrame.alignPanel.getSeqPanel().seqCanvas
+ .getHeight();
+ int topPanelMinHeight = topPanelHeight
+ - Math.max(0, topSequencesHeight - 3 * topCharHeight);
+ double totalHeight = (double) topPanelHeight + bottomPanelHeight;
+ double minRatio = topPanelMinHeight / totalHeight;
+
+ /*
+ * calculate the maximum ratio that leaves at least the height
+ * of two sequences (after rounding) visible in the bottom panel
+ */
+ int bottomSequencesHeight = bottomFrame.alignPanel.getSeqPanel().seqCanvas
+ .getHeight();
+ int bottomPanelMinHeight = bottomPanelHeight
+ - Math.max(0, bottomSequencesHeight - 3 * bottomCharHeight);
+ double maxRatio = (totalHeight - bottomPanelMinHeight) / totalHeight;
+
+ /*
* estimate ratio of (topFrameContent / bottomFrameContent)
*/
int insets = Platform.isAMac() ? MAC_INSETS_HEIGHT
+ (topAnnotations ? topViewport.calcPanelHeight() : 0);
int bottomHeight = insets + (3 + bottomCount) * bottomCharHeight
+ (bottomAnnotations ? bottomViewport.calcPanelHeight() : 0);
- double ratio = ((double) topHeight) / (topHeight + bottomHeight);
+ double ratio = ((double) topHeight)
+ / (double) (topHeight + bottomHeight);
/*
- * limit to 0.2 <= ratio <= 0.8 to avoid concealing all sequences
+ * limit ratio to avoid concealing all sequences
*/
- ratio = Math.min(ratio, 0.8d);
- ratio = Math.max(ratio, 0.2d);
+ ratio = Math.min(ratio, maxRatio);
+ ratio = Math.max(ratio, minRatio);
setRelativeDividerLocation(ratio);
}
Collection<FTSDataColumnI> wantedFields = pdbDocFieldPrefs
.getStructureSummaryFields();
- discoveredStructuresSet = new LinkedHashSet<FTSData>();
- HashSet<String> errors = new HashSet<String>();
+ discoveredStructuresSet = new LinkedHashSet<>();
+ HashSet<String> errors = new HashSet<>();
for (SequenceI seq : selectedSequences)
{
FTSRestRequest pdbRequest = new FTSRestRequest();
public void loadLocalCachedPDBEntries()
{
- ArrayList<CachedPDB> entries = new ArrayList<CachedPDB>();
+ ArrayList<CachedPDB> entries = new ArrayList<>();
for (SequenceI seq : selectedSequences)
{
if (seq.getDatasetSequence() != null
boolean isPDBRefsFound = false;
boolean isUniProtRefsFound = false;
StringBuilder queryBuilder = new StringBuilder();
- Set<String> seqRefs = new LinkedHashSet<String>();
+ Set<String> seqRefs = new LinkedHashSet<>();
if (seq.getAllPDBEntries() != null
&& queryBuilder.length() < MAX_QLENGTH)
lbl_loading.setVisible(true);
Collection<FTSDataColumnI> wantedFields = pdbDocFieldPrefs
.getStructureSummaryFields();
- Collection<FTSData> filteredResponse = new HashSet<FTSData>();
- HashSet<String> errors = new HashSet<String>();
+ Collection<FTSData> filteredResponse = new HashSet<>();
+ HashSet<String> errors = new HashSet<>();
for (SequenceI seq : selectedSequences)
{
if (!filteredResponse.isEmpty())
{
final int filterResponseCount = filteredResponse.size();
- Collection<FTSData> reorderedStructuresSet = new LinkedHashSet<FTSData>();
+ Collection<FTSData> reorderedStructuresSet = new LinkedHashSet<>();
reorderedStructuresSet.addAll(filteredResponse);
reorderedStructuresSet.addAll(discoveredStructuresSet);
getResultTable().setModel(FTSRestResponse
if (cachedPDBExists)
{
- FilterOption cachedOption = new FilterOption("Cached PDB Entries",
+ FilterOption cachedOption = new FilterOption("Cached Structures",
"-", VIEWS_LOCAL_PDB, false);
cmb_filterOption.addItem(cachedOption);
cmb_filterOption.setSelectedItem(cachedOption);
@Override
public void ok_ActionPerformed()
{
- final long progressSessionId = System.currentTimeMillis();
final StructureSelectionManager ssm = ap.getStructureSelectionManager();
+
final int preferredHeight = pnl_filter.getHeight();
- ssm.setProgressIndicator(this);
- ssm.setProgressSessionId(progressSessionId);
+
new Thread(new Runnable()
{
@Override
int[] selectedRows = getResultTable().getSelectedRows();
PDBEntry[] pdbEntriesToView = new PDBEntry[selectedRows.length];
int count = 0;
- List<SequenceI> selectedSeqsToView = new ArrayList<SequenceI>();
+ List<SequenceI> selectedSeqsToView = new ArrayList<>();
for (int row : selectedRows)
{
String pdbIdStr = getResultTable()
pdbEntry = getFindEntry(pdbIdStr,
selectedSeq.getAllPDBEntries());
}
+
if (pdbEntry == null)
{
pdbEntry = new PDBEntry();
.getModelIndex();
int refSeqColIndex = tbl_local_pdb.getColumn("Ref Sequence")
.getModelIndex();
- List<SequenceI> selectedSeqsToView = new ArrayList<SequenceI>();
+ List<SequenceI> selectedSeqsToView = new ArrayList<>();
for (int row : selectedRows)
{
PDBEntry pdbEntry = (PDBEntry) tbl_local_pdb.getValueAt(row,
{
selectedSequence = userSelectedSeq;
}
-
String pdbIdStr = txt_search.getText();
PDBEntry pdbEntry = selectedSequence.getPDBEntry(pdbIdStr);
if (pdbEntry == null)
{ selectedSequence });
}
closeAction(preferredHeight);
+ mainFrame.dispose();
}
}).start();
}
final PDBEntry[] pdbEntriesToView,
final AlignmentPanel alignPanel, SequenceI[] sequences)
{
- ssm.setProgressBar(MessageManager
- .getString("status.launching_3d_structure_viewer"));
+ long progressId = sequences.hashCode();
+ setProgressBar(MessageManager
+ .getString("status.launching_3d_structure_viewer"), progressId);
final StructureViewer sViewer = new StructureViewer(ssm);
+ setProgressBar(null, progressId);
if (SiftsSettings.isMapWithSifts())
{
- List<SequenceI> seqsWithoutSourceDBRef = new ArrayList<SequenceI>();
+ List<SequenceI> seqsWithoutSourceDBRef = new ArrayList<>();
int p = 0;
// TODO: skip PDBEntry:Sequence pairs where PDBEntry doesn't look like a
// real PDB ID. For moment, we can also safely do this if there is already
if (!seqsWithoutSourceDBRef.isEmpty())
{
int y = seqsWithoutSourceDBRef.size();
- ssm.setProgressBar(null);
- ssm.setProgressBar(MessageManager.formatMessage(
+ setProgressBar(MessageManager.formatMessage(
"status.fetching_dbrefs_for_sequences_without_valid_refs",
- y));
+ y), progressId);
SequenceI[] seqWithoutSrcDBRef = new SequenceI[y];
int x = 0;
for (SequenceI fSeq : seqsWithoutSourceDBRef)
{
seqWithoutSrcDBRef[x++] = fSeq;
}
+
DBRefFetcher dbRefFetcher = new DBRefFetcher(seqWithoutSrcDBRef);
dbRefFetcher.fetchDBRefs(true);
+
+ setProgressBar("Fetch complete.", progressId); // todo i18n
}
}
if (pdbEntriesToView.length > 1)
{
- ArrayList<SequenceI[]> seqsMap = new ArrayList<SequenceI[]>();
- for (SequenceI seq : sequences)
- {
- seqsMap.add(new SequenceI[] { seq });
- }
- SequenceI[][] collatedSeqs = seqsMap.toArray(new SequenceI[0][0]);
- ssm.setProgressBar(null);
- ssm.setProgressBar(MessageManager.getString(
- "status.fetching_3d_structures_for_selected_entries"));
- sViewer.viewStructures(pdbEntriesToView, collatedSeqs, alignPanel);
+ setProgressBar(MessageManager.getString(
+ "status.fetching_3d_structures_for_selected_entries"),
+ progressId);
+ sViewer.viewStructures(pdbEntriesToView, sequences, alignPanel);
}
else
{
- ssm.setProgressBar(null);
- ssm.setProgressBar(MessageManager.formatMessage(
+ setProgressBar(MessageManager.formatMessage(
"status.fetching_3d_structures_for",
- pdbEntriesToView[0].getId()));
+ pdbEntriesToView[0].getId()),progressId);
sViewer.viewStructures(pdbEntriesToView[0], sequences, alignPanel);
}
+ setProgressBar(null, progressId);
}
/**
String searchTerm = txt_search.getText().toLowerCase();
searchTerm = searchTerm.split(":")[0];
// System.out.println(">>>>> search term : " + searchTerm);
- List<FTSDataColumnI> wantedFields = new ArrayList<FTSDataColumnI>();
+ List<FTSDataColumnI> wantedFields = new ArrayList<>();
FTSRestRequest pdbRequest = new FTSRestRequest();
pdbRequest.setAllowEmptySeq(false);
pdbRequest.setResponseSize(1);
public PDBEntryTableModel(List<CachedPDB> pdbEntries)
{
- this.pdbEntries = new ArrayList<CachedPDB>(pdbEntries);
+ this.pdbEntries = new ArrayList<>(pdbEntries);
}
@Override
import java.awt.Rectangle;
import java.util.ArrayList;
+import java.util.HashMap;
+import java.util.LinkedHashMap;
import java.util.List;
+import java.util.Map;
+import java.util.Map.Entry;
/**
- * proxy for handling structure viewers.
- *
- * this allows new views to be created with the currently configured viewer, the
- * preferred viewer to be set/read and existing views created previously with a
- * particular viewer to be recovered
+ * A proxy for handling structure viewers, that orchestrates adding selected
+ * structures, associated with sequences in Jalview, to an existing viewer, or
+ * opening a new one. Currently supports either Jmol or Chimera as the structure
+ * viewer.
*
* @author jprocter
*/
public class StructureViewer
{
+ private static final String UNKNOWN_VIEWER_TYPE = "Unknown structure viewer type ";
+
StructureSelectionManager ssm;
public enum ViewerType
JMOL, CHIMERA
};
+ /**
+ * Constructor
+ *
+ * @param structureSelectionManager
+ */
+ public StructureViewer(StructureSelectionManager structureSelectionManager)
+ {
+ ssm = structureSelectionManager;
+ }
+
public ViewerType getViewerType()
{
String viewType = Cache.getDefault(Preferences.STRUCTURE_DISPLAY,
Cache.setProperty(Preferences.STRUCTURE_DISPLAY, type.name());
}
- public StructureViewer(
- StructureSelectionManager structureSelectionManager)
- {
- ssm = structureSelectionManager;
- }
-
/**
* View multiple PDB entries, each with associated sequences
*
* @param pdbs
- * @param seqsForPdbs
+ * @param seqs
* @param ap
* @return
*/
public JalviewStructureDisplayI viewStructures(PDBEntry[] pdbs,
- SequenceI[][] seqsForPdbs, AlignmentPanel ap)
+ SequenceI[] seqs, AlignmentPanel ap)
{
- JalviewStructureDisplayI viewer = onlyOnePdb(pdbs, seqsForPdbs, ap);
+ JalviewStructureDisplayI viewer = onlyOnePdb(pdbs, seqs, ap);
if (viewer != null)
{
+ /*
+ * user added structure to an existing viewer - all done
+ */
return viewer;
}
- return viewStructures(getViewerType(), pdbs, seqsForPdbs, ap);
+
+ ViewerType viewerType = getViewerType();
+
+ Map<PDBEntry, SequenceI[]> seqsForPdbs = getSequencesForPdbs(pdbs,
+ seqs);
+ PDBEntry[] pdbsForFile = seqsForPdbs.keySet().toArray(
+ new PDBEntry[seqsForPdbs.size()]);
+ SequenceI[][] theSeqs = seqsForPdbs.values().toArray(
+ new SequenceI[seqsForPdbs.size()][]);
+ JalviewStructureDisplayI sview = null;
+ if (viewerType.equals(ViewerType.JMOL))
+ {
+ sview = new AppJmol(ap, pdbsForFile, theSeqs);
+ }
+ else if (viewerType.equals(ViewerType.CHIMERA))
+ {
+ sview = new ChimeraViewFrame(pdbsForFile, theSeqs, ap);
+ }
+ else
+ {
+ Cache.log.error(UNKNOWN_VIEWER_TYPE + getViewerType().toString());
+ }
+ return sview;
}
/**
- * A strictly temporary method pending JAL-1761 refactoring. Determines if all
- * the passed PDB entries are the same (this is the case if selected sequences
- * to view structure for are chains of the same structure). If so, calls the
- * single-pdb version of viewStructures and returns the viewer, else returns
- * null.
+ * Converts the list of selected PDB entries (possibly including duplicates
+ * for multiple chains), and corresponding sequences, into a map of sequences
+ * for each distinct PDB file. Returns null if either argument is null, or
+ * their lengths do not match.
*
* @param pdbs
- * @param seqsForPdbs
- * @param ap
+ * @param seqs
* @return
*/
- private JalviewStructureDisplayI onlyOnePdb(PDBEntry[] pdbs,
- SequenceI[][] seqsForPdbs, AlignmentPanel ap)
+ Map<PDBEntry, SequenceI[]> getSequencesForPdbs(PDBEntry[] pdbs,
+ SequenceI[] seqs)
{
- List<SequenceI> seqs = new ArrayList<SequenceI>();
- if (pdbs == null || pdbs.length == 0)
+ if (pdbs == null || seqs == null || pdbs.length != seqs.length)
{
return null;
}
- int i = 0;
- String firstFile = pdbs[0].getFile();
- for (PDBEntry pdb : pdbs)
+
+ /*
+ * we want only one 'representative' PDBEntry per distinct file name
+ * (there may be entries for distinct chains)
+ */
+ Map<String, PDBEntry> pdbsSeen = new HashMap<>();
+
+ /*
+ * LinkedHashMap preserves order of PDB entries (significant if they
+ * will get superimposed to the first structure)
+ */
+ Map<PDBEntry, List<SequenceI>> pdbSeqs = new LinkedHashMap<>();
+ for (int i = 0; i < pdbs.length; i++)
{
+ PDBEntry pdb = pdbs[i];
+ SequenceI seq = seqs[i];
String pdbFile = pdb.getFile();
- if (pdbFile == null || !pdbFile.equals(firstFile))
+ if (!pdbsSeen.containsKey(pdbFile))
{
- return null;
+ pdbsSeen.put(pdbFile, pdb);
+ pdbSeqs.put(pdb, new ArrayList<SequenceI>());
+ }
+ else
+ {
+ pdb = pdbsSeen.get(pdbFile);
}
- SequenceI[] pdbseqs = seqsForPdbs[i++];
- if (pdbseqs != null)
+ List<SequenceI> seqsForPdb = pdbSeqs.get(pdb);
+ if (!seqsForPdb.contains(seq))
{
- for (SequenceI sq : pdbseqs)
- {
- seqs.add(sq);
- }
+ seqsForPdb.add(seq);
}
}
- return viewStructures(pdbs[0], seqs.toArray(new SequenceI[seqs.size()]),
- ap);
- }
-
- public JalviewStructureDisplayI viewStructures(PDBEntry pdb,
- SequenceI[] seqsForPdb, AlignmentPanel ap)
- {
- return viewStructures(getViewerType(), pdb, seqsForPdb, ap);
- }
- protected JalviewStructureDisplayI viewStructures(ViewerType viewerType,
- PDBEntry[] pdbs, SequenceI[][] seqsForPdbs, AlignmentPanel ap)
- {
- PDBEntry[] pdbsForFile = getUniquePdbFiles(pdbs);
- JalviewStructureDisplayI sview = null;
- if (viewerType.equals(ViewerType.JMOL))
- {
- sview = new AppJmol(ap, pdbsForFile,
- ap.av.collateForPDB(pdbsForFile));
- }
- else if (viewerType.equals(ViewerType.CHIMERA))
+ /*
+ * convert to Map<PDBEntry, SequenceI[]>
+ */
+ Map<PDBEntry, SequenceI[]> result = new LinkedHashMap<>();
+ for (Entry<PDBEntry, List<SequenceI>> entry : pdbSeqs.entrySet())
{
- sview = new ChimeraViewFrame(pdbsForFile,
- ap.av.collateForPDB(pdbsForFile), ap);
+ List<SequenceI> theSeqs = entry.getValue();
+ result.put(entry.getKey(),
+ theSeqs.toArray(new SequenceI[theSeqs.size()]));
}
- else
- {
- Cache.log.error("Unknown structure viewer type "
- + getViewerType().toString());
- }
- return sview;
+
+ return result;
}
/**
- * Convert the array of PDBEntry into an array with no filename repeated
+ * A strictly temporary method pending JAL-1761 refactoring. Determines if all
+ * the passed PDB entries are the same (this is the case if selected sequences
+ * to view structure for are chains of the same structure). If so, calls the
+ * single-pdb version of viewStructures and returns the viewer, else returns
+ * null.
*
* @param pdbs
+ * @param seqsForPdbs
+ * @param ap
* @return
*/
- static PDBEntry[] getUniquePdbFiles(PDBEntry[] pdbs)
+ private JalviewStructureDisplayI onlyOnePdb(PDBEntry[] pdbs,
+ SequenceI[] seqsForPdbs, AlignmentPanel ap)
{
- if (pdbs == null)
+ List<SequenceI> seqs = new ArrayList<SequenceI>();
+ if (pdbs == null || pdbs.length == 0)
{
return null;
}
- List<PDBEntry> uniques = new ArrayList<PDBEntry>();
- List<String> filesSeen = new ArrayList<String>();
- for (PDBEntry entry : pdbs)
+ int i = 0;
+ String firstFile = pdbs[0].getFile();
+ for (PDBEntry pdb : pdbs)
{
- String file = entry.getFile();
- if (file == null)
+ String pdbFile = pdb.getFile();
+ if (pdbFile == null || !pdbFile.equals(firstFile))
{
- uniques.add(entry);
+ return null;
}
- else if (!filesSeen.contains(file))
+ SequenceI pdbseq = seqsForPdbs[i++];
+ if (pdbseq != null)
{
- uniques.add(entry);
- filesSeen.add(file);
+ seqs.add(pdbseq);
}
}
- return uniques.toArray(new PDBEntry[uniques.size()]);
+ return viewStructures(pdbs[0], seqs.toArray(new SequenceI[seqs.size()]),
+ ap);
}
- protected JalviewStructureDisplayI viewStructures(ViewerType viewerType,
- PDBEntry pdb, SequenceI[] seqsForPdb, AlignmentPanel ap)
+ public JalviewStructureDisplayI viewStructures(PDBEntry pdb,
+ SequenceI[] seqsForPdb, AlignmentPanel ap)
{
+ ViewerType viewerType = getViewerType();
JalviewStructureDisplayI sview = null;
if (viewerType.equals(ViewerType.JMOL))
{
}
else
{
- Cache.log.error("Unknown structure viewer type "
- + getViewerType().toString());
+ Cache.log.error(UNKNOWN_VIEWER_TYPE + getViewerType().toString());
}
return sview;
}
"Unsupported structure viewer type " + type.toString());
break;
default:
- Cache.log.error("Unknown structure viewer type " + type.toString());
+ Cache.log.error(UNKNOWN_VIEWER_TYPE + type.toString());
}
return sview;
}
/**
* list of sequenceSet ids associated with the view
*/
- protected List<String> _aps = new ArrayList<String>();
+ protected List<String> _aps = new ArrayList<>();
/**
* list of alignment panels to use for superposition
*/
- protected Vector<AlignmentPanel> _alignwith = new Vector<AlignmentPanel>();
+ protected Vector<AlignmentPanel> _alignwith = new Vector<>();
/**
* list of alignment panels that are used for colouring structures by aligned
* sequences
*/
- protected Vector<AlignmentPanel> _colourwith = new Vector<AlignmentPanel>();
+ protected Vector<AlignmentPanel> _colourwith = new Vector<>();
private String viewId = null;
{
if (_alignwith == null)
{
- _alignwith = new Vector<AlignmentPanel>();
+ _alignwith = new Vector<>();
}
if (_alignwith.size() == 0 && ap != null)
{
public abstract ViewerType getViewerType();
+ protected abstract IProgressIndicator getIProgressIndicator();
+
/**
* add a new structure (with associated sequences and chains) to this viewer,
* retrieving it if necessary first.
* create the mappings
*/
apanel.getStructureSelectionManager().setMapping(seq, chains,
- pdbFilename, DataSourceType.FILE);
+ pdbFilename, DataSourceType.FILE, getIProgressIndicator());
/*
* alert the FeatureRenderer to show new (PDB RESNUM) features
if (apanel.getSeqPanel().seqCanvas.fr != null)
{
apanel.getSeqPanel().seqCanvas.fr.featuresAdded();
- apanel.paintAlignment(true);
+ // note - we don't do a refresh for structure here because we do it
+ // explicitly for all panels later on
+ apanel.paintAlignment(true, false);
}
/*
if (_colourwith == null)
{
- _colourwith = new Vector<AlignmentPanel>();
+ _colourwith = new Vector<>();
}
if (_alignwith == null)
{
- _alignwith = new Vector<AlignmentPanel>();
+ _alignwith = new Vector<>();
}
ViewSelectionMenu seqColourBy = new ViewSelectionMenu(
binding.setColourBySequence(seqColour.isSelected());
if (_colourwith == null)
{
- _colourwith = new Vector<AlignmentPanel>();
+ _colourwith = new Vector<>();
}
if (binding.isColourBySequence())
{
*/
protected void saveInitialSettings()
{
- groupColour1 = new HashMap<SequenceGroup, Color>();
- groupColour2 = new HashMap<SequenceGroup, Color>();
- groupThreshold = new HashMap<SequenceGroup, Integer>();
+ groupColour1 = new HashMap<>();
+ groupColour2 = new HashMap<>();
+ groupThreshold = new HashMap<>();
if (sg == null)
{
sg.textColour = col;
}
- ap.paintAlignment(true);
+ ap.paintAlignment(false, false);
}
void colour2Changed(Color col)
sg.textColour2 = col;
}
- ap.paintAlignment(true);
+ ap.paintAlignment(false, false);
}
void thresholdChanged(int value)
sg.thresholdTextColour = value;
}
- ap.paintAlignment(true);
+ ap.paintAlignment(false, false);
}
void setGroupTextColour()
import java.awt.event.ActionListener;
import java.awt.image.BufferedImage;
import java.beans.PropertyChangeEvent;
+import java.beans.PropertyChangeListener;
import java.io.FileOutputStream;
import java.util.ArrayList;
import java.util.List;
import javax.swing.ButtonGroup;
import javax.swing.JMenuItem;
import javax.swing.JRadioButtonMenuItem;
+import javax.swing.event.InternalFrameAdapter;
+import javax.swing.event.InternalFrameEvent;
import org.jibble.epsgraphics.EpsGraphics2D;
buildAssociatedViewMenu();
- av.addPropertyChangeListener(new java.beans.PropertyChangeListener()
+ final PropertyChangeListener listener = addAlignmentListener();
+
+ /*
+ * remove listener when window is closed, so that this
+ * panel can be garbage collected
+ */
+ addInternalFrameListener(new InternalFrameAdapter()
+ {
+ @Override
+ public void internalFrameClosed(InternalFrameEvent evt)
+ {
+ if (av != null)
+ {
+ av.removePropertyChangeListener(listener);
+ }
+ }
+ });
+
+ TreeLoader tl = new TreeLoader(newTree, inputData);
+ tl.start();
+
+ }
+
+ /**
+ * @return
+ */
+ protected PropertyChangeListener addAlignmentListener()
+ {
+ final PropertyChangeListener listener = new PropertyChangeListener()
{
@Override
public void propertyChange(PropertyChangeEvent evt)
repaint();
}
}
- });
-
- TreeLoader tl = new TreeLoader(newTree, inputData);
- tl.start();
-
+ };
+ av.addPropertyChangeListener(listener);
+ return listener;
}
@Override
if (treeCanvas.applyToAllViews)
{
- final ArrayList<CommandI> commands = new ArrayList<CommandI>();
+ final ArrayList<CommandI> commands = new ArrayList<>();
for (AlignmentPanel ap : PaintRefresher
.getAssociatedPanels(av.getSequenceSetId()))
{
public CommandI sortAlignmentIn(AlignmentPanel ap)
{
+ // TODO: move to alignment view controller
AlignmentViewport viewport = ap.av;
SequenceI[] oldOrder = viewport.getAlignment().getSequencesArray();
AlignmentSorter.sortByTree(viewport.getAlignment(), tree);
CommandI undo;
undo = new OrderCommand("Tree Sort", oldOrder, viewport.getAlignment());
- ap.paintAlignment(true);
+ ap.paintAlignment(true, false);
return undo;
}
}
if (newname == null)
{
- SequenceFeature sf[] = sq.getSequenceFeatures();
- for (int i = 0; sf != null && i < sf.length; i++)
+ List<SequenceFeature> features = sq.getFeatures()
+ .getPositionalFeatures(labelClass);
+ for (SequenceFeature feature : features)
{
- if (sf[i].getType().equals(labelClass))
+ if (newname == null)
+ {
+ newname = feature.getDescription();
+ }
+ else
{
- if (newname == null)
- {
- newname = new String(sf[i].getDescription());
- }
- else
- {
- newname = newname + "; " + sf[i].getDescription();
- }
+ newname = newname + "; " + feature.getDescription();
}
}
}
UserDefinedColours()
{
super();
- selectedButtons = new ArrayList<JButton>();
+ selectedButtons = new ArrayList<>();
}
void showFrame()
if (upperCaseButtons == null)
{
- upperCaseButtons = new ArrayList<JButton>();
+ upperCaseButtons = new ArrayList<>();
}
for (int i = 0; i < 20; i++)
if (lowerCaseButtons == null)
{
- lowerCaseButtons = new ArrayList<JButton>();
+ lowerCaseButtons = new ArrayList<>();
}
for (int i = 0; i < 20; i++)
@Override
protected void loadbutton_actionPerformed()
{
- upperCaseButtons = new ArrayList<JButton>();
- lowerCaseButtons = new ArrayList<JButton>();
+ upperCaseButtons = new ArrayList<>();
+ lowerCaseButtons = new ArrayList<>();
JalviewFileChooser chooser = new JalviewFileChooser("jc",
"Jalview User Colours");
protected void cancelButton_actionPerformed()
{
ap.alignFrame.changeColour(oldColourScheme);
- ap.paintAlignment(true);
+ ap.paintAlignment(true, true);
try
{
private ItemListener _handler;
- @Override
- protected void finalize() throws Throwable
- {
- _selectedviews = null;
- _handler = null;
- _allviews = null;
- super.finalize();
- }
-
/**
* create a new view selection menu. This menu has some standard entries
* (select all, invert selection), and a checkbox for every view. Mousing over
}
parseCalled = true;
parse();
- // sets the index of each sequence in the alignment
- for (int i = 0, c = seqs.size(); i < c; i++)
- {
- seqs.get(i).setIndex(i);
- }
}
/**
out.append(newline);
- if (s[i].getSequence().length > max)
- {
- max = s[i].getSequence().length;
- }
+ max = Math.max(max, s[i].getLength());
i++;
}
{
String tmp = printId(s[i], jvsuffix);
- if (s[i].getSequence().length > max)
- {
- max = s[i].getSequence().length;
- }
+ max = Math.max(max, s[i].getLength());
if (tmp.length() > maxid)
{
int start = i * len;
int end = start + len;
- if ((end < s[j].getSequence().length)
- && (start < s[j].getSequence().length))
+ int length = s[j].getLength();
+ if ((end < length) && (start < length))
{
out.append(s[j].getSequenceAsString(start, end));
}
else
{
- if (start < s[j].getSequence().length)
+ if (start < length)
{
out.append(s[j].getSequenceAsString().substring(start));
}
import java.io.IOException;
import java.util.ArrayList;
import java.util.Arrays;
+import java.util.Collections;
import java.util.HashMap;
-import java.util.Iterator;
import java.util.List;
import java.util.Map;
import java.util.Map.Entry;
/**
* Constructor which does not parse the file immediately
*
- * @param inFile
+ * @param file
* @param paste
* @throws IOException
*/
- public FeaturesFile(String inFile, DataSourceType paste)
+ public FeaturesFile(String file, DataSourceType paste)
throws IOException
{
- super(false, inFile, paste);
+ super(false, file, paste);
}
/**
* Constructor that optionally parses the file immediately
*
* @param parseImmediately
- * @param inFile
+ * @param file
* @param type
* @throws IOException
*/
- public FeaturesFile(boolean parseImmediately, String inFile,
+ public FeaturesFile(boolean parseImmediately, String file,
DataSourceType type) throws IOException
{
- super(parseImmediately, inFile, type);
+ super(parseImmediately, file, type);
}
/**
*/
for (SequenceI newseq : newseqs)
{
- if (newseq.getSequenceFeatures() != null)
+ if (newseq.getFeatures().hasFeatures())
{
align.addSequence(newseq);
}
Color colour = ColorUtils.createColourFromName(ft);
featureColours.put(ft, new FeatureColour(colour));
}
- SequenceFeature sf = new SequenceFeature(ft, desc, "", startPos, endPos,
- featureGroup);
+ SequenceFeature sf = null;
if (gffColumns.length > 6)
{
float score = Float.NaN;
try
{
score = new Float(gffColumns[6]).floatValue();
- // update colourgradient bounds if allowed to
} catch (NumberFormatException ex)
{
- // leave as NaN
+ sf = new SequenceFeature(ft, desc, startPos, endPos, featureGroup);
}
- sf.setScore(score);
+ sf = new SequenceFeature(ft, desc, startPos, endPos, score,
+ featureGroup);
+ }
+ else
+ {
+ sf = new SequenceFeature(ft, desc, startPos, endPos, featureGroup);
}
parseDescriptionHTML(sf, removeHTML);
ParseHtmlBodyAndLinks parsed = new ParseHtmlBodyAndLinks(
sf.getDescription(), removeHTML, newline);
- sf.description = (removeHTML) ? parsed.getNonHtmlContent()
- : sf.description;
+ if (removeHTML)
+ {
+ sf.setDescription(parsed.getNonHtmlContent());
+ }
+
for (String link : parsed.getLinks())
{
sf.addLink(link);
}
-
}
/**
- * generate a features file for seqs includes non-pos features by default.
- *
- * @param sequences
- * source of sequence features
- * @param visible
- * hash of feature types and colours
- * @return features file contents
- */
- public String printJalviewFormat(SequenceI[] sequences,
- Map<String, FeatureColourI> visible)
- {
- return printJalviewFormat(sequences, visible, true, true);
- }
-
- /**
- * generate a features file for seqs with colours from visible (if any)
+ * Returns contents of a Jalview format features file, for visible features,
+ * as filtered by type and group. Features with a null group are displayed if
+ * their feature type is visible. Non-positional features may optionally be
+ * included (with no check on type or group).
*
* @param sequences
* source of features
* @param visible
- * hash of Colours for each feature type
- * @param visOnly
- * when true only feature types in 'visible' will be output
- * @param nonpos
- * indicates if non-positional features should be output (regardless
- * of group or type)
- * @return features file contents
+ * map of colour for each visible feature type
+ * @param visibleFeatureGroups
+ * @param includeNonPositional
+ * if true, include non-positional features (regardless of group or
+ * type)
+ * @return
*/
public String printJalviewFormat(SequenceI[] sequences,
- Map<String, FeatureColourI> visible, boolean visOnly,
- boolean nonpos)
+ Map<String, FeatureColourI> visible,
+ List<String> visibleFeatureGroups, boolean includeNonPositional)
{
- StringBuilder out = new StringBuilder(256);
- boolean featuresGen = false;
- if (visOnly && !nonpos && (visible == null || visible.size() < 1))
+ if (!includeNonPositional && (visible == null || visible.isEmpty()))
{
// no point continuing.
return "No Features Visible";
}
- if (visible != null && visOnly)
+ /*
+ * write out feature colours (if we know them)
+ */
+ // TODO: decide if feature links should also be written here ?
+ StringBuilder out = new StringBuilder(256);
+ if (visible != null)
{
- // write feature colours only if we're given them and we are generating
- // viewed features
- // TODO: decide if feature links should also be written here ?
- Iterator<String> en = visible.keySet().iterator();
- while (en.hasNext())
+ for (Entry<String, FeatureColourI> featureColour : visible.entrySet())
{
- String featureType = en.next().toString();
- FeatureColourI colour = visible.get(featureType);
- out.append(colour.toJalviewFormat(featureType)).append(newline);
+ FeatureColourI colour = featureColour.getValue();
+ out.append(colour.toJalviewFormat(featureColour.getKey())).append(
+ newline);
}
}
- // Work out which groups are both present and visible
- List<String> groups = new ArrayList<String>();
- int groupIndex = 0;
- boolean isnonpos = false;
+ String[] types = visible == null ? new String[0] : visible.keySet()
+ .toArray(new String[visible.keySet().size()]);
- SequenceFeature[] features;
- for (int i = 0; i < sequences.length; i++)
+ /*
+ * sort groups alphabetically, and ensure that features with a
+ * null or empty group are output after those in named groups
+ */
+ List<String> sortedGroups = new ArrayList<String>(visibleFeatureGroups);
+ sortedGroups.remove(null);
+ sortedGroups.remove("");
+ Collections.sort(sortedGroups);
+ sortedGroups.add(null);
+ sortedGroups.add("");
+
+ boolean foundSome = false;
+
+ /*
+ * first output any non-positional features
+ */
+ if (includeNonPositional)
{
- features = sequences[i].getSequenceFeatures();
- if (features != null)
+ for (int i = 0; i < sequences.length; i++)
{
- for (int j = 0; j < features.length; j++)
+ String sequenceName = sequences[i].getName();
+ for (SequenceFeature feature : sequences[i].getFeatures()
+ .getNonPositionalFeatures())
{
- isnonpos = features[j].begin == 0 && features[j].end == 0;
- if ((!nonpos && isnonpos) || (!isnonpos && visOnly
- && !visible.containsKey(features[j].type)))
- {
- continue;
- }
-
- if (features[j].featureGroup != null
- && !groups.contains(features[j].featureGroup))
- {
- groups.add(features[j].featureGroup);
- }
+ foundSome = true;
+ out.append(formatJalviewFeature(sequenceName, feature));
}
}
}
- String group = null;
- do
+ for (String group : sortedGroups)
{
- if (groups.size() > 0 && groupIndex < groups.size())
+ boolean isNamedGroup = (group != null && !"".equals(group));
+ if (isNamedGroup)
{
- group = groups.get(groupIndex);
out.append(newline);
out.append("STARTGROUP").append(TAB);
out.append(group);
out.append(newline);
}
- else
- {
- group = null;
- }
+ /*
+ * output positional features within groups
+ */
for (int i = 0; i < sequences.length; i++)
{
- features = sequences[i].getSequenceFeatures();
- if (features != null)
+ String sequenceName = sequences[i].getName();
+ List<SequenceFeature> features = new ArrayList<SequenceFeature>();
+ if (types.length > 0)
{
- for (SequenceFeature sequenceFeature : features)
- {
- isnonpos = sequenceFeature.begin == 0
- && sequenceFeature.end == 0;
- if ((!nonpos && isnonpos) || (!isnonpos && visOnly
- && !visible.containsKey(sequenceFeature.type)))
- {
- // skip if feature is nonpos and we ignore them or if we only
- // output visible and it isn't non-pos and it's not visible
- continue;
- }
-
- if (group != null && (sequenceFeature.featureGroup == null
- || !sequenceFeature.featureGroup.equals(group)))
- {
- continue;
- }
+ features.addAll(sequences[i].getFeatures().getFeaturesForGroup(
+ true, group, types));
+ }
- if (group == null && sequenceFeature.featureGroup != null)
- {
- continue;
- }
- // we have features to output
- featuresGen = true;
- if (sequenceFeature.description == null
- || sequenceFeature.description.equals(""))
- {
- out.append(sequenceFeature.type).append(TAB);
- }
- else
- {
- if (sequenceFeature.links != null && sequenceFeature
- .getDescription().indexOf("<html>") == -1)
- {
- out.append("<html>");
- }
-
- out.append(sequenceFeature.description);
- if (sequenceFeature.links != null)
- {
- for (int l = 0; l < sequenceFeature.links.size(); l++)
- {
- String label = sequenceFeature.links.elementAt(l);
- String href = label.substring(label.indexOf("|") + 1);
- label = label.substring(0, label.indexOf("|"));
-
- if (sequenceFeature.description.indexOf(href) == -1)
- {
- out.append(
- " <a href=\"" + href + "\">" + label + "</a>");
- }
- }
-
- if (sequenceFeature.getDescription()
- .indexOf("</html>") == -1)
- {
- out.append("</html>");
- }
- }
-
- out.append(TAB);
- }
- out.append(sequences[i].getName());
- out.append("\t-1\t");
- out.append(sequenceFeature.begin);
- out.append(TAB);
- out.append(sequenceFeature.end);
- out.append(TAB);
- out.append(sequenceFeature.type);
- if (!Float.isNaN(sequenceFeature.score))
- {
- out.append(TAB);
- out.append(sequenceFeature.score);
- }
- out.append(newline);
- }
+ for (SequenceFeature sequenceFeature : features)
+ {
+ foundSome = true;
+ out.append(formatJalviewFeature(sequenceName, sequenceFeature));
}
}
- if (group != null)
+ if (isNamedGroup)
{
out.append("ENDGROUP").append(TAB);
out.append(group);
out.append(newline);
- groupIndex++;
}
- else
+ }
+
+ return foundSome ? out.toString() : "No Features Visible";
+ }
+
+ /**
+ * @param out
+ * @param sequenceName
+ * @param sequenceFeature
+ */
+ protected String formatJalviewFeature(
+ String sequenceName, SequenceFeature sequenceFeature)
+ {
+ StringBuilder out = new StringBuilder(64);
+ if (sequenceFeature.description == null
+ || sequenceFeature.description.equals(""))
+ {
+ out.append(sequenceFeature.type).append(TAB);
+ }
+ else
+ {
+ if (sequenceFeature.links != null
+ && sequenceFeature.getDescription().indexOf("<html>") == -1)
{
- break;
+ out.append("<html>");
}
- } while (groupIndex < groups.size() + 1);
+ out.append(sequenceFeature.description);
+ if (sequenceFeature.links != null)
+ {
+ for (int l = 0; l < sequenceFeature.links.size(); l++)
+ {
+ String label = sequenceFeature.links.elementAt(l);
+ String href = label.substring(label.indexOf("|") + 1);
+ label = label.substring(0, label.indexOf("|"));
+
+ if (sequenceFeature.description.indexOf(href) == -1)
+ {
+ out.append(" <a href=\"" + href + "\">" + label + "</a>");
+ }
+ }
+
+ if (sequenceFeature.getDescription().indexOf("</html>") == -1)
+ {
+ out.append("</html>");
+ }
+ }
- if (!featuresGen)
+ out.append(TAB);
+ }
+ out.append(sequenceName);
+ out.append("\t-1\t");
+ out.append(sequenceFeature.begin);
+ out.append(TAB);
+ out.append(sequenceFeature.end);
+ out.append(TAB);
+ out.append(sequenceFeature.type);
+ if (!Float.isNaN(sequenceFeature.score))
{
- return "No Features Visible";
+ out.append(TAB);
+ out.append(sequenceFeature.score);
}
+ out.append(newline);
return out.toString();
}
}
/**
- * Returns features output in GFF2 format, including hidden and non-positional
- * features
- *
- * @param sequences
- * the sequences whose features are to be output
- * @param visible
- * a map whose keys are the type names of visible features
- * @return
- */
- public String printGffFormat(SequenceI[] sequences,
- Map<String, FeatureColourI> visible)
- {
- return printGffFormat(sequences, visible, true, true);
- }
-
- /**
* Returns features output in GFF2 format
*
* @param sequences
* the sequences whose features are to be output
* @param visible
* a map whose keys are the type names of visible features
- * @param outputVisibleOnly
+ * @param visibleFeatureGroups
* @param includeNonPositionalFeatures
* @return
*/
public String printGffFormat(SequenceI[] sequences,
- Map<String, FeatureColourI> visible, boolean outputVisibleOnly,
+ Map<String, FeatureColourI> visible,
+ List<String> visibleFeatureGroups,
boolean includeNonPositionalFeatures)
{
StringBuilder out = new StringBuilder(256);
- int version = gffVersion == 0 ? 2 : gffVersion;
- out.append(String.format("%s %d\n", GFF_VERSION, version));
- String source;
- boolean isnonpos;
+
+ out.append(String.format("%s %d\n", GFF_VERSION, gffVersion == 0 ? 2 : gffVersion));
+
+ if (!includeNonPositionalFeatures
+ && (visible == null || visible.isEmpty()))
+ {
+ return out.toString();
+ }
+
+ String[] types = visible == null ? new String[0] : visible.keySet()
+ .toArray(
+ new String[visible.keySet().size()]);
+
for (SequenceI seq : sequences)
{
- SequenceFeature[] features = seq.getSequenceFeatures();
- if (features != null)
+ List<SequenceFeature> features = new ArrayList<SequenceFeature>();
+ if (includeNonPositionalFeatures)
{
- for (SequenceFeature sf : features)
- {
- isnonpos = sf.begin == 0 && sf.end == 0;
- if (!includeNonPositionalFeatures && isnonpos)
- {
- /*
- * ignore non-positional features if not wanted
- */
- continue;
- }
- // TODO why the test !isnonpos here?
- // what about not visible non-positional features?
- if (!isnonpos && outputVisibleOnly
- && !visible.containsKey(sf.type))
- {
- /*
- * ignore not visible features if not wanted
- */
- continue;
- }
+ features.addAll(seq.getFeatures().getNonPositionalFeatures());
+ }
+ if (visible != null && !visible.isEmpty())
+ {
+ features.addAll(seq.getFeatures().getPositionalFeatures(types));
+ }
- source = sf.featureGroup;
- if (source == null)
- {
- source = sf.getDescription();
- }
+ for (SequenceFeature sf : features)
+ {
+ String source = sf.featureGroup;
+ if (!sf.isNonPositional() && source != null
+ && !visibleFeatureGroups.contains(source))
+ {
+ // group is not visible
+ continue;
+ }
- out.append(seq.getName());
- out.append(TAB);
- out.append(source);
- out.append(TAB);
- out.append(sf.type);
- out.append(TAB);
- out.append(sf.begin);
- out.append(TAB);
- out.append(sf.end);
- out.append(TAB);
- out.append(sf.score);
- out.append(TAB);
-
- int strand = sf.getStrand();
- out.append(strand == 1 ? "+" : (strand == -1 ? "-" : "."));
- out.append(TAB);
-
- String phase = sf.getPhase();
- out.append(phase == null ? "." : phase);
-
- // miscellaneous key-values (GFF column 9)
- String attributes = sf.getAttributes();
- if (attributes != null)
- {
- out.append(TAB).append(attributes);
- }
+ if (source == null)
+ {
+ source = sf.getDescription();
+ }
- out.append(newline);
+ out.append(seq.getName());
+ out.append(TAB);
+ out.append(source);
+ out.append(TAB);
+ out.append(sf.type);
+ out.append(TAB);
+ out.append(sf.begin);
+ out.append(TAB);
+ out.append(sf.end);
+ out.append(TAB);
+ out.append(sf.score);
+ out.append(TAB);
+
+ int strand = sf.getStrand();
+ out.append(strand == 1 ? "+" : (strand == -1 ? "-" : "."));
+ out.append(TAB);
+
+ String phase = sf.getPhase();
+ out.append(phase == null ? "." : phase);
+
+ // miscellaneous key-values (GFF column 9)
+ String attributes = sf.getAttributes();
+ if (attributes != null)
+ {
+ out.append(TAB).append(attributes);
}
+
+ out.append(newline);
}
}
// rename sequences if GFF handler requested this
// TODO a more elegant way e.g. gffHelper.postProcess(newseqs) ?
- SequenceFeature[] sfs = seq.getSequenceFeatures();
- if (sfs != null)
+ List<SequenceFeature> sfs = seq.getFeatures().getPositionalFeatures();
+ if (!sfs.isEmpty())
{
- String newName = (String) sfs[0].getValue(GffHelperI.RENAME_TOKEN);
+ String newName = (String) sfs.get(0).getValue(
+ GffHelperI.RENAME_TOKEN);
if (newName != null)
{
seq.setName(newName);
return tempStructFile.toString();
}
- /*
- * (non-Javadoc)
- *
- * @see java.lang.Object#finalize()
- */
- @Override
- protected void finalize() throws Throwable
- {
- source = null;
- alignFrame = null;
- viewport = null;
- super.finalize();
- }
-
}
// read as a FASTA (probably)
break;
}
+ if (data.indexOf("{\"") > -1)
+ {
+ reply = FileFormat.Json;
+ break;
+ }
int lessThan = data.indexOf("<");
if ((lessThan > -1)) // possible Markup Language data i.e HTML,
// RNAML, XML
}
}
- if (data.indexOf("{\"") > -1)
- {
- reply = FileFormat.Json;
- break;
- }
if ((data.length() < 1) || (data.indexOf("#") == 0))
{
lineswereskipped = true;
error = false;
}
- @Override
- protected void finalize() throws Throwable
- {
- dataIn = null;
- super.finalize();
- }
-
}
import jalview.schemes.JalviewColourScheme;
import jalview.schemes.ResidueColourScheme;
import jalview.util.ColorUtils;
+import jalview.util.Format;
import jalview.viewmodel.seqfeatures.FeaturesDisplayed;
import java.awt.Color;
if (exportSettings.isExportFeatures())
{
- jsonAlignmentPojo
- .setSeqFeatures(sequenceFeatureToJsonPojo(sqs, fr));
+ jsonAlignmentPojo.setSeqFeatures(sequenceFeatureToJsonPojo(sqs));
}
if (exportSettings.isExportGroups() && seqGroups != null
return hiddenSections;
}
- public List<SequenceFeaturesPojo> sequenceFeatureToJsonPojo(
- SequenceI[] sqs, FeatureRenderer fr)
+ protected List<SequenceFeaturesPojo> sequenceFeatureToJsonPojo(
+ SequenceI[] sqs)
{
displayedFeatures = (fr == null) ? null : fr.getFeaturesDisplayed();
List<SequenceFeaturesPojo> sequenceFeaturesPojo = new ArrayList<>();
FeatureColourFinder finder = new FeatureColourFinder(fr);
+ String[] visibleFeatureTypes = displayedFeatures == null ? null
+ : displayedFeatures.getVisibleFeatures().toArray(
+ new String[displayedFeatures.getVisibleFeatureCount()]);
+
for (SequenceI seq : sqs)
{
- SequenceI dataSetSequence = seq.getDatasetSequence();
- SequenceFeature[] seqFeatures = (dataSetSequence == null) ? null
- : seq.getDatasetSequence().getSequenceFeatures();
-
- seqFeatures = (seqFeatures == null) ? seq.getSequenceFeatures()
- : seqFeatures;
- if (seqFeatures == null)
- {
- continue;
- }
-
+ /*
+ * get all features currently visible (and any non-positional features)
+ */
+ List<SequenceFeature> seqFeatures = seq.getFeatures().getAllFeatures(
+ visibleFeatureTypes);
for (SequenceFeature sf : seqFeatures)
{
- if (displayedFeatures != null
- && displayedFeatures.isVisible(sf.getType()))
- {
- SequenceFeaturesPojo jsonFeature = new SequenceFeaturesPojo(
- String.valueOf(seq.hashCode()));
-
- String featureColour = (fr == null) ? null
- : jalview.util.Format.getHexString(
- finder.findFeatureColour(Color.white, seq,
- seq.findIndex(sf.getBegin())));
- jsonFeature.setXstart(seq.findIndex(sf.getBegin()) - 1);
- jsonFeature.setXend(seq.findIndex(sf.getEnd()));
- jsonFeature.setType(sf.getType());
- jsonFeature.setDescription(sf.getDescription());
- jsonFeature.setLinks(sf.links);
- jsonFeature.setOtherDetails(sf.otherDetails);
- jsonFeature.setScore(sf.getScore());
- jsonFeature.setFillColor(featureColour);
- jsonFeature.setFeatureGroup(sf.getFeatureGroup());
- sequenceFeaturesPojo.add(jsonFeature);
- }
+ SequenceFeaturesPojo jsonFeature = new SequenceFeaturesPojo(
+ String.valueOf(seq.hashCode()));
+
+ String featureColour = (fr == null) ? null : Format
+ .getHexString(finder.findFeatureColour(Color.white, seq,
+ seq.findIndex(sf.getBegin())));
+ int xStart = sf.getBegin() == 0 ? 0
+ : seq.findIndex(sf.getBegin()) - 1;
+ int xEnd = sf.getEnd() == 0 ? 0 : seq.findIndex(sf.getEnd());
+ jsonFeature.setXstart(xStart);
+ jsonFeature.setXend(xEnd);
+ jsonFeature.setType(sf.getType());
+ jsonFeature.setDescription(sf.getDescription());
+ jsonFeature.setLinks(sf.links);
+ jsonFeature.setOtherDetails(sf.otherDetails);
+ jsonFeature.setScore(sf.getScore());
+ jsonFeature.setFillColor(featureColour);
+ jsonFeature.setFeatureGroup(sf.getFeatureGroup());
+ sequenceFeaturesPojo.add(jsonFeature);
}
}
return sequenceFeaturesPojo;
Long end = (Long) jsonFeature.get("xEnd");
String type = (String) jsonFeature.get("type");
String featureGrp = (String) jsonFeature.get("featureGroup");
- String descripiton = (String) jsonFeature.get("description");
+ String description = (String) jsonFeature.get("description");
String seqRef = (String) jsonFeature.get("sequenceRef");
Float score = Float.valueOf(jsonFeature.get("score").toString());
Sequence seq = seqMap.get(seqRef);
- SequenceFeature sequenceFeature = new SequenceFeature();
+
+ /*
+ * begin/end of 0 is for a non-positional feature
+ */
+ int featureBegin = begin.intValue() == 0 ? 0 : seq
+ .findPosition(begin.intValue());
+ int featureEnd = end.intValue() == 0 ? 0 : seq.findPosition(end
+ .intValue()) - 1;
+
+ SequenceFeature sequenceFeature = new SequenceFeature(type,
+ description, featureBegin, featureEnd, score, featureGrp);
+
JSONArray linksJsonArray = (JSONArray) jsonFeature.get("links");
if (linksJsonArray != null && linksJsonArray.size() > 0)
{
sequenceFeature.addLink(link);
}
}
- sequenceFeature.setFeatureGroup(featureGrp);
- sequenceFeature.setScore(score);
- sequenceFeature.setDescription(descripiton);
- sequenceFeature.setType(type);
- sequenceFeature.setBegin(seq.findPosition(begin.intValue()));
- sequenceFeature.setEnd(seq.findPosition(end.intValue()) - 1);
+
seq.addSequenceFeature(sequenceFeature);
displayedFeatures.setVisible(type);
}
// in the future we could search for the query
// sequence in the alignment before calling this function.
SequenceI seqRef = al.getSequenceAt(firstSeq);
- int width = preds[0].getSequence().length;
+ int width = preds[0].getLength();
int[] gapmap = al.getSequenceAt(firstSeq).gapMap();
if ((delMap != null && delMap.length > width)
|| (delMap == null && gapmap.length != width))
}
long maxNB = 0;
- out.append(" MSF: " + s[0].getSequence().length + " Type: "
+ out.append(" MSF: " + s[0].getLength() + " Type: "
+ (is_NA ? "N" : "P") + " Check: " + (bigChecksum % 10000)
+ " ..");
out.append(newline);
nameBlock[i] = new String(" Name: " + printId(s[i], jvSuffix) + " ");
- idBlock[i] = new String("Len: "
- + maxLenpad.form(s[i].getSequence().length) + " Check: "
- + maxChkpad.form(checksums[i]) + " Weight: 1.00" + newline);
+ idBlock[i] = new String("Len: " + maxLenpad.form(s[i].getLength())
+ + " Check: " + maxChkpad.form(checksums[i])
+ + " Weight: 1.00" + newline);
if (s[i].getName().length() > maxid)
{
int start = (i * 50) + (k * 10);
int end = start + 10;
- if ((end < s[j].getSequence().length)
- && (start < s[j].getSequence().length))
+ int length = s[j].getLength();
+ if ((end < length)
+ && (start < length))
{
out.append(s[j].getSequence(start, end));
}
else
{
- if (start < s[j].getSequence().length)
+ if (start < length)
{
out.append(s[j].getSequenceAsString().substring(start));
out.append(newline);
{
String tmp = printId(s[i], jvsuffix);
- if (s[i].getSequence().length > max)
- {
- max = s[i].getSequence().length;
- }
+ max = Math.max(max, s[i].getLength());
if (tmp.length() > maxid)
{
sb.append(" ");
// if there are no sequences, then define the number of characters as 0
sb.append(
- (sqs.length > 0) ? Integer.toString(sqs[0].getSequence().length)
+(sqs.length > 0) ? Integer.toString(sqs[0].getLength())
: "0")
.append(newline);
// sequential has the entire sequence following the name
if (sequential)
{
- sb.append(s.getSequence());
+ sb.append(s.getSequenceAsString());
}
else
{
// Jalview ensures all sequences are of same length so no need
// to keep track of min/max length
- sequenceLength = s.getSequence().length;
+ sequenceLength = s.getLength();
// interleaved breaks the sequence into chunks for
// interleavedColumns characters
sb.append(s.getSequence(0,
i++;
}
- out.append(" MSF: " + s[0].getSequence().length
+ out.append(" MSF: " + s[0].getLength()
+ " Type: P Check: " + bigChecksum % 10000 + " ..");
out.append(newline);
out.append(newline);
int start = (i * 50) + (k * 10);
int end = start + 10;
- if ((end < s[j].getSequence().length)
- && (start < s[j].getSequence().length))
+ int length = s[j].getLength();
+ if ((end < length) && (start < length))
{
out.append(s[j].getSequence(start, end));
}
else
{
- if (start < s[j].getSequence().length)
+ if (start < length)
{
out.append(s[j].getSequenceAsString().substring(start));
out.append(newline);
final String linkImageURL;
/*
- * Comparator to order DBRefEntry by Source + accession id (case-insensitive)
+ * Comparator to order DBRefEntry by Source + accession id (case-insensitive),
+ * with 'Primary' sources placed before others
*/
private static Comparator<DBRefEntry> comparator = new Comparator<DBRefEntry>()
{
{
ds = ds.getDatasetSequence();
}
+
+ if (showDbRefs)
+ {
+ maxWidth = Math.max(maxWidth, appendDbRefs(sb, ds, summary));
+ }
+
+ /*
+ * add non-positional features if wanted
+ */
+ if (showNpFeats)
+ {
+ for (SequenceFeature sf : sequence.getFeatures()
+ .getNonPositionalFeatures())
+ {
+ int sz = -sb.length();
+ appendFeature(sb, 0, minmax, sf);
+ sz += sb.length();
+ maxWidth = Math.max(maxWidth, sz);
+ }
+ }
+ sb.append("</i>");
+ return maxWidth;
+ }
+
+ /**
+ * A helper method that appends any DBRefs, returning the maximum line length
+ * added
+ *
+ * @param sb
+ * @param ds
+ * @param summary
+ * @return
+ */
+ protected int appendDbRefs(final StringBuilder sb, SequenceI ds,
+ boolean summary)
+ {
DBRefEntry[] dbrefs = ds.getDBRefs();
- if (showDbRefs && dbrefs != null)
+ if (dbrefs == null)
+ {
+ return 0;
+ }
+
+ // note this sorts the refs held on the sequence!
+ Arrays.sort(dbrefs, comparator);
+ boolean ellipsis = false;
+ String source = null;
+ String lastSource = null;
+ int countForSource = 0;
+ int sourceCount = 0;
+ boolean moreSources = false;
+ int maxLineLength = 0;
+ int lineLength = 0;
+
+ for (DBRefEntry ref : dbrefs)
{
- // note this sorts the refs held on the sequence!
- Arrays.sort(dbrefs, comparator);
- boolean ellipsis = false;
- String source = null;
- String lastSource = null;
- int countForSource = 0;
- int sourceCount = 0;
- boolean moreSources = false;
- int lineLength = 0;
-
- for (DBRefEntry ref : dbrefs)
+ source = ref.getSource();
+ if (source == null)
{
- source = ref.getSource();
- if (source == null)
- {
- // shouldn't happen
- continue;
- }
- boolean sourceChanged = !source.equals(lastSource);
- if (sourceChanged)
- {
- lineLength = 0;
- countForSource = 0;
- sourceCount++;
- }
- if (sourceCount > MAX_SOURCES && summary)
- {
- ellipsis = true;
- moreSources = true;
- break;
- }
- lastSource = source;
- countForSource++;
- if (countForSource == 1 || !summary)
- {
- sb.append("<br>");
- }
- if (countForSource <= MAX_REFS_PER_SOURCE || !summary)
- {
- String accessionId = ref.getAccessionId();
- lineLength += accessionId.length() + 1;
- if (countForSource > 1 && summary)
- {
- sb.append(", ").append(accessionId);
- lineLength++;
- }
- else
- {
- sb.append(source).append(" ").append(accessionId);
- lineLength += source.length();
- }
- maxWidth = Math.max(maxWidth, lineLength);
- }
- if (countForSource == MAX_REFS_PER_SOURCE && summary)
- {
- sb.append(COMMA).append(ELLIPSIS);
- ellipsis = true;
- }
+ // shouldn't happen
+ continue;
}
- if (moreSources)
+ boolean sourceChanged = !source.equals(lastSource);
+ if (sourceChanged)
{
- sb.append("<br>").append(ELLIPSIS).append(COMMA).append(source)
- .append(COMMA).append(ELLIPSIS);
+ lineLength = 0;
+ countForSource = 0;
+ sourceCount++;
}
- if (ellipsis)
+ if (sourceCount > MAX_SOURCES && summary)
{
- sb.append("<br>(");
- sb.append(MessageManager.getString("label.output_seq_details"));
- sb.append(")");
+ ellipsis = true;
+ moreSources = true;
+ break;
}
- }
-
- /*
- * add non-positional features if wanted
- */
- SequenceFeature[] features = sequence.getSequenceFeatures();
- if (showNpFeats && features != null)
- {
- for (int i = 0; i < features.length; i++)
+ lastSource = source;
+ countForSource++;
+ if (countForSource == 1 || !summary)
+ {
+ sb.append("<br>");
+ }
+ if (countForSource <= MAX_REFS_PER_SOURCE || !summary)
{
- if (features[i].begin == 0 && features[i].end == 0)
+ String accessionId = ref.getAccessionId();
+ lineLength += accessionId.length() + 1;
+ if (countForSource > 1 && summary)
{
- int sz = -sb.length();
- appendFeature(sb, 0, minmax, features[i]);
- sz += sb.length();
- maxWidth = Math.max(maxWidth, sz);
+ sb.append(", ").append(accessionId);
+ lineLength++;
}
+ else
+ {
+ sb.append(source).append(" ").append(accessionId);
+ lineLength += source.length();
+ }
+ maxLineLength = Math.max(maxLineLength, lineLength);
+ }
+ if (countForSource == MAX_REFS_PER_SOURCE && summary)
+ {
+ sb.append(COMMA).append(ELLIPSIS);
+ ellipsis = true;
}
}
- sb.append("</i>");
- return maxWidth;
+ if (moreSources)
+ {
+ sb.append("<br>").append(source)
+ .append(COMMA).append(ELLIPSIS);
+ }
+ if (ellipsis)
+ {
+ sb.append("<br>(");
+ sb.append(MessageManager.getString("label.output_seq_details"));
+ sb.append(")");
+ }
+
+ return maxLineLength;
}
public void createTooltipAnnotationReport(final StringBuilder tip,
*/
public class StockholmFile extends AlignFile
{
+ private static final String ANNOTATION = "annotation";
+
private static final Regex OPEN_PAREN = new Regex("(<|\\[)", "(");
private static final Regex CLOSE_PAREN = new Regex("(>|\\])", ")");
while (j.hasMoreElements())
{
String desc = j.nextElement().toString();
- if ("annotations".equals(desc) && annotsAdded)
+ if (ANNOTATION.equals(desc) && annotsAdded)
{
// don't add features if we already added an annotation row
continue;
int new_pos = posmap[k]; // look up nearest seqeunce
// position to this column
SequenceFeature feat = new SequenceFeature(type, desc,
- new_pos, new_pos, 0f, null);
+ new_pos, new_pos, null);
seqO.addSequenceFeature(feat);
}
content = new Hashtable();
features.put(this.id2type(type), content);
}
- String ns = (String) content.get("annotation");
+ String ns = (String) content.get(ANNOTATION);
if (ns == null)
{
}
// finally, append the annotation line
ns += seq;
- content.put("annotation", ns);
+ content.put(ANNOTATION, ns);
// // end of wrapped annotation block.
// // Now a new row is created with the current set of data
while ((in < s.length) && (s[in] != null))
{
String tmp = printId(s[in], jvSuffix);
- if (s[in].getSequence().length > max)
- {
- max = s[in].getSequence().length;
- }
+ max = Math.max(max, s[in].getLength());
if (tmp.length() > maxid)
{
public static boolean isRNA(SequenceI seq)
{
- for (char c : seq.getSequence())
+ int length = seq.getLength();
+ for (int i = 0; i < length; i++)
{
+ char c = seq.getCharAt(i);
if ((c != 'A') && (c != 'C') && (c != 'G') && (c != 'U'))
{
return false;
}
}
}
- ap.paintAlignment(true);
+ ap.paintAlignment(true, false);
}
import java.awt.event.ActionEvent;
import java.awt.event.ActionListener;
import java.awt.event.KeyEvent;
+import java.awt.event.KeyListener;
import java.util.ArrayList;
import java.util.Arrays;
import java.util.Collections;
private JMenuItem menuItemClearCache = new JMenuItem();
+ volatile boolean enterWasPressed = false;
+
+ /**
+ * @return flag indicating if the most recent keypress was enter
+ */
+ public boolean wasEnterPressed()
+ {
+ return enterWasPressed;
+ }
+
public JvCacheableInputBox(String newCacheKey)
{
super();
this.cacheKey = newCacheKey;
setEditable(true);
+ addKeyListener(new KeyListener()
+ {
+
+ @Override
+ public void keyTyped(KeyEvent e)
+ {
+ enterWasPressed = false;
+ if (e.getKeyCode() == KeyEvent.VK_ENTER)
+ {
+ enterWasPressed = true;
+ }
+ // let event bubble up
+ }
+
+ @Override
+ public void keyReleased(KeyEvent e)
+ {
+ // TODO Auto-generated method stub
+
+ }
+
+ @Override
+ public void keyPressed(KeyEvent e)
+ {
+ // TODO Auto-generated method stub
+
+ }
+ });
setPrototypeDisplayValue(
"XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX");
appCache = AppCache.getInstance();
return false;
}
+ /**
+ * An override to set feature group to "exonerate" instead of the default GFF
+ * source value (column 2)
+ */
@Override
protected SequenceFeature buildSequenceFeature(String[] gff,
Map<String, List<String>> set)
{
- SequenceFeature sf = super.buildSequenceFeature(gff, set);
- sf.setFeatureGroup("exonerate");
+ SequenceFeature sf = super.buildSequenceFeature(gff, TYPE_COL,
+ "exonerate", set);
return sf;
}
* give the mapped sequence a copy of the sequence feature, with
* start/end range adjusted
*/
- SequenceFeature sf2 = new SequenceFeature(sf);
- sf2.setBegin(1);
int sequenceFeatureLength = 1 + sf.getEnd() - sf.getBegin();
- sf2.setEnd(sequenceFeatureLength);
+ SequenceFeature sf2 = new SequenceFeature(sf, 1,
+ sequenceFeatureLength, sf.getFeatureGroup(), sf.getScore());
mappedSequence.addSequenceFeature(sf2);
/*
*/
@Override
protected SequenceFeature buildSequenceFeature(String[] gff,
+ int typeColumn, String group,
Map<String, List<String>> attributes)
{
- SequenceFeature sf = super.buildSequenceFeature(gff, attributes);
+ SequenceFeature sf = super.buildSequenceFeature(gff, typeColumn, group,
+ attributes);
String desc = getDescription(sf, attributes);
if (desc != null)
{
protected SequenceFeature buildSequenceFeature(String[] gff,
Map<String, List<String>> attributes)
{
+ return buildSequenceFeature(gff, TYPE_COL, gff[SOURCE_COL], attributes);
+ }
+
+ /**
+ * @param gff
+ * @param typeColumn
+ * @param group
+ * @param attributes
+ * @return
+ */
+ protected SequenceFeature buildSequenceFeature(String[] gff,
+ int typeColumn, String group, Map<String, List<String>> attributes)
+ {
try
{
int start = Integer.parseInt(gff[START_COL]);
// e.g. '.' - leave as zero
}
- SequenceFeature sf = new SequenceFeature(gff[TYPE_COL],
- gff[SOURCE_COL], start, end, score, gff[SOURCE_COL]);
+ SequenceFeature sf = new SequenceFeature(gff[typeColumn],
+ gff[SOURCE_COL], start, end, score, group);
sf.setStrand(gff[STRAND_COL]);
}
/**
- *
- */
+ * An override that
+ * <ul>
+ * <li>uses Source (column 2) as feature type instead of the default column 3</li>
+ * <li>sets "InterProScan" as the feature group</li>
+ * <li>extracts "signature_desc" attribute as the feature description</li>
+ * </ul>
+ */
@Override
protected SequenceFeature buildSequenceFeature(String[] gff,
Map<String, List<String>> attributes)
{
- SequenceFeature sf = super.buildSequenceFeature(gff, attributes);
+ SequenceFeature sf = super.buildSequenceFeature(gff, SOURCE_COL,
+ INTER_PRO_SCAN, attributes);
/*
* signature_desc is a more informative source of description
sf.setDescription(description);
}
- /*
- * Set sequence feature group as 'InterProScan', and type as the source
- * database for this match (e.g. 'Pfam')
- */
- sf.setType(gff[SOURCE_COL]);
- sf.setFeatureGroup(INTER_PRO_SCAN);
-
return sf;
}
package jalview.io.vamsas;
import jalview.datamodel.DBRefEntry;
+import jalview.datamodel.SequenceFeature;
import jalview.datamodel.SequenceI;
import jalview.io.VamsasAppDatastore;
+import java.util.List;
+
import uk.ac.vamsas.objects.core.DataSet;
import uk.ac.vamsas.objects.core.DbRef;
import uk.ac.vamsas.objects.core.Sequence;
// private AlignmentI jvdset;
public Datasetsequence(VamsasAppDatastore vamsasAppDatastore,
- SequenceI sq, String dict, DataSet dataset)
+ SequenceI sq, String theDict, DataSet theDataset)
{
super(vamsasAppDatastore, sq, uk.ac.vamsas.objects.core.Sequence.class);
- this.dataset = dataset;
+ this.dataset = theDataset;
// this.jvdset = jvdset;
- this.dict = dict;
+ this.dict = theDict;
doSync();
}
doJvUpdate();
}
+ @Override
public void addFromDocument()
{
Sequence vseq = (Sequence) vobj;
modified = true;
}
+ @Override
public void updateFromDoc()
{
Sequence sq = (Sequence) vobj;
*/
private boolean updateSqFeatures()
{
- boolean modified = false;
+ boolean changed = false;
SequenceI sq = (SequenceI) jvobj;
// add or update any new features/references on dataset sequence
- if (sq.getSequenceFeatures() != null)
+ List<SequenceFeature> sfs = sq.getSequenceFeatures();
+ for (SequenceFeature sf : sfs)
{
- int sfSize = sq.getSequenceFeatures().length;
-
- for (int sf = 0; sf < sfSize; sf++)
- {
- modified |= new jalview.io.vamsas.Sequencefeature(datastore,
- (jalview.datamodel.SequenceFeature) sq
- .getSequenceFeatures()[sf],
- dataset, (Sequence) vobj).docWasUpdated();
- }
+ changed |= new jalview.io.vamsas.Sequencefeature(datastore, sf,
+ dataset, (Sequence) vobj).docWasUpdated();
}
- return modified;
+
+ return changed;
}
+ @Override
public void addToDocument()
{
SequenceI sq = (SequenceI) jvobj;
return modifiedtheseq;
}
+ @Override
public void conflict()
{
log.warn(
boolean modified = false;
+ @Override
public void updateToDoc()
{
SequenceI sq = (SequenceI) jvobj;
private SequenceFeature getJalviewSeqFeature(RangeAnnotation dseta)
{
int[] se = getBounds(dseta);
- SequenceFeature sf = new jalview.datamodel.SequenceFeature(
- dseta.getType(), dseta.getDescription(), dseta.getStatus(),
- se[0], se[1], dseta.getGroup());
+
+ /*
+ * try to identify feature score
+ */
+ boolean scoreFound = false;
+ float theScore = 0f;
+ String featureType = dseta.getType();
+ if (dseta.getScoreCount() > 0)
+ {
+ Enumeration scr = dseta.enumerateScore();
+ while (scr.hasMoreElements())
+ {
+ Score score = (Score) scr.nextElement();
+ if (score.getName().equals(featureType))
+ {
+ theScore = score.getContent();
+ scoreFound = true;
+ }
+ }
+ }
+
+ SequenceFeature sf = null;
+ if (scoreFound)
+ {
+ sf = new SequenceFeature(featureType, dseta.getDescription(), se[0],
+ se[1], theScore, dseta.getGroup());
+ }
+ else
+ {
+ sf = new SequenceFeature(featureType, dseta.getDescription(), se[0],
+ se[1], dseta.getGroup());
+ }
+ sf.setStatus(dseta.getStatus());
if (dseta.getLinkCount() > 0)
{
Link[] links = dseta.getLink();
while (scr.hasMoreElements())
{
Score score = (Score) scr.nextElement();
- if (score.getName().equals(sf.getType()))
- {
- sf.setScore(score.getContent());
- }
- else
+ if (!score.getName().equals(sf.getType()))
{
sf.setValue(score.getName(), "" + score.getContent());
}
jvlite.setExecutor(this);
}
- @Override
- protected void finalize() throws Throwable
- {
- jvlite = null;
- executor = null;
- if (jsExecQueue != null)
- {
- jsExecQueue.clear();
- }
- jsExecQueue = null;
- super.finalize();
- }
-
private Vector jsExecQueue;
private Thread executor = null;
}
@Override
- public void finalize() throws Throwable
- {
- jvlite = null;
- super.finalize();
- }
-
- @Override
public void releaseReferences(Object svl)
{
*/
public class ScaleRenderer
{
+ /**
+ * Represents one major or minor scale mark
+ */
public final class ScaleMark
{
+ /**
+ * true for a major scale mark, false for minor
+ */
public final boolean major;
+ /**
+ * visible column position (0..) e.g. 19
+ */
public final int column;
+ /**
+ * text (if any) to show e.g. "20"
+ */
public final String text;
ScaleMark(boolean isMajor, int col, String txt)
column = col;
text = txt;
}
+
+ /**
+ * String representation for inspection when debugging only
+ */
+ @Override
+ public String toString()
+ {
+ return String.format("%s:%d:%s", major ? "major" : "minor", column,
+ text);
+ }
}
/**
- * calculate positions markers on the alignment ruler
+ * Calculates position markers on the alignment ruler
*
* @param av
* @param startx
- * left-most column in visible view
+ * left-most column in visible view (0..)
* @param endx
- * - right-most column in visible view
- * @return List of ScaleMark holding boolean: true/false for major/minor mark,
- * marker position in alignment column coords, a String to be rendered
- * at the position (or null)
+ * - right-most column in visible view (0..)
+ * @return
*/
public List<ScaleMark> calculateMarks(AlignViewportI av, int startx,
int endx)
scalestartx += 5;
}
List<ScaleMark> marks = new ArrayList<ScaleMark>();
- String string;
- int refN, iadj;
// todo: add a 'reference origin column' to set column number relative to
- for (int i = scalestartx; i < endx; i += 5)
+ for (int i = scalestartx; i <= endx; i += 5)
{
if (((i - refSp) % 10) == 0)
{
+ String text;
if (refSeq == null)
{
- iadj = av.getAlignment().getHiddenColumns()
+ int iadj = av.getAlignment().getHiddenColumns()
.adjustForHiddenColumns(i - 1) + 1;
- string = String.valueOf(iadj);
+ text = String.valueOf(iadj);
}
else
{
- iadj = av.getAlignment().getHiddenColumns()
+ int iadj = av.getAlignment().getHiddenColumns()
.adjustForHiddenColumns(i - 1);
- refN = refSeq.findPosition(iadj);
+ int refN = refSeq.findPosition(iadj);
// TODO show bounds if position is a gap
// - ie L--R -> "1L|2R" for
// marker
if (iadj < refStartI)
{
- string = String.valueOf(iadj - refStartI);
+ text = String.valueOf(iadj - refStartI);
}
else if (iadj > refEndI)
{
- string = "+" + String.valueOf(iadj - refEndI);
+ text = "+" + String.valueOf(iadj - refEndI);
}
else
{
- string = String.valueOf(refN) + refSeq.getCharAt(iadj);
+ text = String.valueOf(refN) + refSeq.getCharAt(iadj);
}
}
- marks.add(new ScaleMark(true, i - startx - 1, string));
+ marks.add(new ScaleMark(true, i - startx - 1, text));
}
else
{
* @param defaultColour
* @param seq
* @param column
- * alignment column position (base zero)
+ * alignment column position (0..)
* @return
*/
public Color findFeatureColour(Color defaultColour, SequenceI seq,
}
}
- Color c = featureRenderer.findFeatureColour(seq, column, g);
+ Color c = featureRenderer.findFeatureColour(seq, column + 1, g);
if (c == null)
{
return defaultColour;
package jalview.renderer.seqfeatures;
import jalview.api.AlignViewportI;
+import jalview.api.FeatureColourI;
+import jalview.datamodel.Range;
import jalview.datamodel.SequenceFeature;
import jalview.datamodel.SequenceI;
import jalview.util.Comparison;
import java.awt.FontMetrics;
import java.awt.Graphics;
import java.awt.Graphics2D;
+import java.util.List;
public class FeatureRenderer extends FeatureRendererModel
{
return null;
}
- SequenceFeature[] sequenceFeatures = seq.getSequenceFeatures();
-
- if (sequenceFeatures == null || sequenceFeatures.length == 0)
- {
- return null;
- }
-
- if (Comparison.isGap(seq.getCharAt(column)))
+ // column is 'base 1' but getCharAt is an array index (ie from 0)
+ if (Comparison.isGap(seq.getCharAt(column - 1)))
{
/*
* returning null allows the colour scheme to provide gap colour
- * - normally white, but can be customised otherwise
+ * - normally white, but can be customised
*/
return null;
}
/*
* simple case - just find the topmost rendered visible feature colour
*/
- renderedColour = findFeatureColour(seq, seq.findPosition(column));
+ renderedColour = findFeatureColour(seq, column);
}
else
{
final SequenceI seq, int start, int end, int y1,
boolean colourOnly)
{
- SequenceFeature[] sequenceFeatures = seq.getSequenceFeatures();
- if (sequenceFeatures == null || sequenceFeatures.length == 0)
+ /*
+ * if columns are all gapped, or sequence has no features, nothing to do
+ */
+ Range visiblePositions = seq.findPositions(start+1, end+1);
+ if (visiblePositions == null || !seq.getFeatures().hasFeatures())
{
return null;
}
transparency));
}
- int startPos = seq.findPosition(start);
- int endPos = seq.findPosition(end);
-
- int sfSize = sequenceFeatures.length;
Color drawnColour = null;
/*
continue;
}
- // loop through all features in sequence to find
- // current feature to render
- for (int sfindex = 0; sfindex < sfSize; sfindex++)
+ FeatureColourI fc = getFeatureStyle(type);
+ List<SequenceFeature> overlaps = seq.getFeatures().findFeatures(
+ visiblePositions.getBegin(), visiblePositions.getEnd(), type);
+
+ filterFeaturesForDisplay(overlaps, fc);
+
+ for (SequenceFeature sf : overlaps)
{
- final SequenceFeature sequenceFeature = sequenceFeatures[sfindex];
- if (!sequenceFeature.type.equals(type))
+ Color featureColour = fc.getColor(sf);
+ if (featureColour == null)
{
+ // score feature outwith threshold for colouring
continue;
}
/*
- * a feature type may be flagged as shown but the group
- * an instance of it belongs to may be hidden
+ * if feature starts/ends outside the visible range,
+ * restrict to visible positions (or if a contact feature,
+ * to a single position)
*/
- if (featureGroupNotShown(sequenceFeature))
+ int visibleStart = sf.getBegin();
+ if (visibleStart < visiblePositions.getBegin())
{
- continue;
+ visibleStart = sf.isContactFeature() ? sf.getEnd()
+ : visiblePositions.getBegin();
}
-
- /*
- * check feature overlaps the target range
- * TODO: efficient retrieval of features overlapping a range
- */
- if (sequenceFeature.getBegin() > endPos
- || sequenceFeature.getEnd() < startPos)
+ int visibleEnd = sf.getEnd();
+ if (visibleEnd > visiblePositions.getEnd())
{
- continue;
+ visibleEnd = sf.isContactFeature() ? sf.getBegin()
+ : visiblePositions.getEnd();
}
- Color featureColour = getColour(sequenceFeature);
- if (featureColour == null)
- {
- // score feature outwith threshold for colouring
- continue;
- }
+ int featureStartCol = seq.findIndex(visibleStart);
+ int featureEndCol = sf.begin == sf.end ? featureStartCol : seq
+ .findIndex(visibleEnd);
+
+ // Color featureColour = getColour(sequenceFeature);
- boolean isContactFeature = sequenceFeature.isContactFeature();
+ boolean isContactFeature = sf.isContactFeature();
if (isContactFeature)
{
- boolean drawn = renderFeature(g, seq,
- seq.findIndex(sequenceFeature.begin) - 1,
- seq.findIndex(sequenceFeature.begin) - 1, featureColour,
- start, end, y1, colourOnly);
- drawn |= renderFeature(g, seq,
- seq.findIndex(sequenceFeature.end) - 1,
- seq.findIndex(sequenceFeature.end) - 1, featureColour,
- start, end, y1, colourOnly);
+ boolean drawn = renderFeature(g, seq, featureStartCol - 1,
+ featureStartCol - 1, featureColour, start, end, y1,
+ colourOnly);
+ drawn |= renderFeature(g, seq, featureEndCol - 1,
+ featureEndCol - 1, featureColour, start, end, y1,
+ colourOnly);
if (drawn)
{
drawnColour = featureColour;
}
else
{
+ /*
+ * showing feature score by height of colour
+ * is not implemented as a selectable option
+ *
if (av.isShowSequenceFeaturesHeight()
&& !Float.isNaN(sequenceFeature.score))
{
}
else
{
+ */
boolean drawn = renderFeature(g, seq,
- seq.findIndex(sequenceFeature.begin) - 1,
- seq.findIndex(sequenceFeature.end) - 1, featureColour,
+ featureStartCol - 1,
+ featureEndCol - 1, featureColour,
start, end, y1, colourOnly);
if (drawn)
{
drawnColour = featureColour;
}
- }
+ /*}*/
}
}
}
}
/**
- * Answers true if the feature belongs to a feature group which is not
- * currently displayed, else false
- *
- * @param sequenceFeature
- * @return
- */
- protected boolean featureGroupNotShown(
- final SequenceFeature sequenceFeature)
- {
- return featureGroups != null && sequenceFeature.featureGroup != null
- && sequenceFeature.featureGroup.length() != 0
- && featureGroups.containsKey(sequenceFeature.featureGroup)
- && !featureGroups.get(sequenceFeature.featureGroup)
- .booleanValue();
- }
-
- /**
* Called when alignment in associated view has new/modified features to
* discover and display.
*
}
/**
- * Returns the sequence feature colour rendered at the given sequence
- * position, or null if none found. The feature of highest render order (i.e.
- * on top) is found, subject to both feature type and feature group being
- * visible, and its colour returned.
+ * Returns the sequence feature colour rendered at the given column position,
+ * or null if none found. The feature of highest render order (i.e. on top) is
+ * found, subject to both feature type and feature group being visible, and
+ * its colour returned. This method is suitable when no feature transparency
+ * applied (only the topmost visible feature colour is rendered).
+ * <p>
+ * Note this method does not check for a gap in the column so would return the
+ * colour for features enclosing a gapped column. Check for gap before calling
+ * if different behaviour is wanted.
*
* @param seq
- * @param pos
+ * @param column
+ * (1..)
* @return
*/
- Color findFeatureColour(SequenceI seq, int pos)
+ Color findFeatureColour(SequenceI seq, int column)
{
- SequenceFeature[] sequenceFeatures = seq.getSequenceFeatures();
- if (sequenceFeatures == null || sequenceFeatures.length == 0)
- {
- return null;
- }
-
/*
* check for new feature added while processing
*/
continue;
}
- for (int sfindex = 0; sfindex < sequenceFeatures.length; sfindex++)
+ List<SequenceFeature> overlaps = seq.findFeatures(column, column,
+ type);
+ for (SequenceFeature sequenceFeature : overlaps)
{
- SequenceFeature sequenceFeature = sequenceFeatures[sfindex];
- if (!sequenceFeature.type.equals(type))
+ if (!featureGroupNotShown(sequenceFeature))
{
- continue;
- }
-
- if (featureGroupNotShown(sequenceFeature))
- {
- continue;
- }
-
- /*
- * check the column position is within the feature range
- * (or is one of the two contact positions for a contact feature)
- */
- boolean featureIsAtPosition = sequenceFeature.begin <= pos
- && sequenceFeature.end >= pos;
- if (sequenceFeature.isContactFeature())
- {
- featureIsAtPosition = sequenceFeature.begin == pos
- || sequenceFeature.end == pos;
- }
- if (featureIsAtPosition)
- {
- return getColour(sequenceFeature);
+ Color col = getColour(sequenceFeature);
+ if (col != null)
+ {
+ return col;
+ }
}
}
}
for (SequenceI sq : seqs)
{
- char[] seq = sq.getSequence();
-
- int end_j = seq.length - 1;
+ int end_j = sq.getLength() - 1;
+ int length = sq.getLength();
for (int i = 0; i <= end_j; i++)
{
- if ((seq.length - 1) < i)
+ if (length - 1 < i)
{
res = 23;
}
else
{
- res = ResidueProperties.aaIndex[seq[i]];
+ res = ResidueProperties.aaIndex[sq.getCharAt(i)];
}
cons2[i][res]++;
}
return getColour();
}
- // todo should we check for above/below threshold here?
- if (range == 0.0)
- {
- return getMaxColour();
- }
+ /*
+ * graduated colour case, optionally with threshold
+ * Float.NaN is assigned minimum visible score colour
+ */
float scr = feature.getScore();
if (Float.isNaN(scr))
{
return getMinColour();
}
+ if (isAboveThreshold() && scr <= threshold)
+ {
+ return null;
+ }
+ if (isBelowThreshold() && scr >= threshold)
+ {
+ return null;
+ }
+ if (range == 0.0)
+ {
+ return getMaxColour();
+ }
float scl = (scr - base) / range;
if (isHighToLow)
{
return (isHighToLow) ? (base + range) : base;
}
- /**
- * Answers true if the feature has a simple colour, or is coloured by label,
- * or has a graduated colour and the score of this feature instance is within
- * the range to render (if any), i.e. does not lie below or above any
- * threshold set.
- *
- * @param feature
- * @return
- */
- @Override
- public boolean isColored(SequenceFeature feature)
- {
- if (isColourByLabel() || !isGraduatedColour())
- {
- return true;
- }
-
- float val = feature.getScore();
- if (Float.isNaN(val))
- {
- return true;
- }
- if (Float.isNaN(this.threshold))
- {
- return true;
- }
-
- if (isAboveThreshold() && val <= threshold)
- {
- return false;
- }
- if (isBelowThreshold() && val >= threshold)
- {
- return false;
- }
- return true;
- }
-
@Override
public boolean isSimpleColour()
{
oldcs = av.getGlobalColourScheme();
if (av.getAlignment().getGroups() != null)
{
- oldgroupColours = new Hashtable<SequenceGroup, ColourSchemeI>();
+ oldgroupColours = new Hashtable<>();
for (SequenceGroup sg : ap.getAlignment().getGroups())
{
if (sg.getColourScheme() != null)
this.ap = ap;
adjusting = true;
- Vector<String> list = new Vector<String>();
+ Vector<String> list = new Vector<>();
int index = 1;
AlignmentAnnotation[] anns = av.getAlignment().getAlignmentAnnotation();
if (anns != null)
av.setGlobalColourScheme(rhc);
- ap.paintAlignment(true);
+ ap.paintAlignment(true, true);
}
}
static IdentityHashMap<StructureSelectionManagerProvider, StructureSelectionManager> instances;
- private List<StructureMapping> mappings = new ArrayList<StructureMapping>();
+ private List<StructureMapping> mappings = new ArrayList<>();
private boolean processSecondaryStructure = false;
private boolean addTempFacAnnot = false;
- private IProgressIndicator progressIndicator;
-
private SiftsClient siftsClient = null;
- private long progressSessionId;
-
/*
* Set of any registered mappings between (dataset) sequences.
*/
- private List<AlignedCodonFrame> seqmappings = new ArrayList<AlignedCodonFrame>();
+ private List<AlignedCodonFrame> seqmappings = new ArrayList<>();
- private List<CommandListener> commandListeners = new ArrayList<CommandListener>();
+ private List<CommandListener> commandListeners = new ArrayList<>();
- private List<SelectionListener> sel_listeners = new ArrayList<SelectionListener>();
+ private List<SelectionListener> sel_listeners = new ArrayList<>();
/**
* @return true if will try to use external services for processing secondary
* map between the PDB IDs (or structure identifiers) used by Jalview and the
* absolute filenames for PDB data that corresponds to it
*/
- Map<String, String> pdbIdFileName = new HashMap<String, String>();
+ Map<String, String> pdbIdFileName = new HashMap<>();
- Map<String, String> pdbFileNameId = new HashMap<String, String>();
+ Map<String, String> pdbFileNameId = new HashMap<>();
public void registerPDBFile(String idForFile, String absoluteFile)
{
}
if (instances == null)
{
- instances = new java.util.IdentityHashMap<StructureSelectionManagerProvider, StructureSelectionManager>();
+ instances = new java.util.IdentityHashMap<>();
}
StructureSelectionManager instance = instances.get(context);
if (instance == null)
* @return null or the structure data parsed as a pdb file
*/
synchronized public StructureFile setMapping(SequenceI[] sequence,
- String[] targetChains, String pdbFile, DataSourceType protocol)
+ String[] targetChains, String pdbFile, DataSourceType protocol,
+ IProgressIndicator progress)
{
- return setMapping(true, sequence, targetChains, pdbFile, protocol);
+ return computeMapping(true, sequence, targetChains, pdbFile, protocol,
+ progress);
}
/**
SequenceI[] sequenceArray, String[] targetChainIds,
String pdbFile, DataSourceType sourceType)
{
+ return computeMapping(forStructureView, sequenceArray, targetChainIds,
+ pdbFile, sourceType, null);
+ }
+
+ synchronized public StructureFile computeMapping(
+ boolean forStructureView, SequenceI[] sequenceArray,
+ String[] targetChainIds, String pdbFile, DataSourceType sourceType,
+ IProgressIndicator progress)
+ {
+ long progressSessionId = System.currentTimeMillis() * 3;
/*
* There will be better ways of doing this in the future, for now we'll use
* the tried and tested MCview pdb mapping
pdbFile = "INLINE" + pdb.getId();
}
- List<StructureMapping> seqToStrucMapping = new ArrayList<StructureMapping>();
+ List<StructureMapping> seqToStrucMapping = new ArrayList<>();
if (isMapUsingSIFTs && seq.isProtein())
{
- setProgressBar(null);
- setProgressBar(MessageManager
- .getString("status.obtaining_mapping_with_sifts"));
+ if (progress!=null) {
+ progress.setProgressBar(MessageManager
+ .getString("status.obtaining_mapping_with_sifts"),
+ progressSessionId);
+ }
jalview.datamodel.Mapping sqmpping = maxAlignseq
.getMappingFromS1(false);
if (targetChainId != null && !targetChainId.trim().isEmpty())
}
else
{
- List<StructureMapping> foundSiftsMappings = new ArrayList<StructureMapping>();
+ List<StructureMapping> foundSiftsMappings = new ArrayList<>();
for (PDBChain chain : pdb.getChains())
{
try
}
else
{
- setProgressBar(null);
- setProgressBar(MessageManager
- .getString("status.obtaining_mapping_with_nw_alignment"));
+ if (progress != null)
+ {
+ progress.setProgressBar(MessageManager
+ .getString("status.obtaining_mapping_with_nw_alignment"),
+ progressSessionId);
+ }
StructureMapping nwMapping = getNWMappings(seq, pdbFile, maxChainId,
maxChain, pdb, maxAlignseq);
seqToStrucMapping.add(nwMapping);
ds.addPDBId(maxChain.sequence.getAllPDBEntries().get(0));
-
}
-
if (forStructureView)
{
mappings.addAll(seqToStrucMapping);
}
+ if (progress != null)
+ {
+ progress.setProgressBar(null, progressSessionId);
+ }
}
return pdb;
}
.getMappingFromS1(false);
maxChain.transferRESNUMFeatures(seq, null);
- HashMap<Integer, int[]> mapping = new HashMap<Integer, int[]>();
+ HashMap<Integer, int[]> mapping = new HashMap<>();
int resNum = -10000;
int index = 0;
char insCode = ' ';
* Remove mappings to the closed listener's PDB files, but first check if
* another listener is still interested
*/
- List<String> pdbs = new ArrayList<String>(Arrays.asList(pdbfiles));
+ List<String> pdbs = new ArrayList<>(Arrays.asList(pdbfiles));
StructureListener sl;
for (int i = 0; i < listeners.size(); i++)
*/
if (pdbs.size() > 0)
{
- List<StructureMapping> tmp = new ArrayList<StructureMapping>();
+ List<StructureMapping> tmp = new ArrayList<>();
for (StructureMapping sm : mappings)
{
if (!pdbs.contains(sm.pdbfile))
&& sm.pdbchain.equals(atom.getChain()))
{
int indexpos = sm.getSeqPos(atom.getPdbResNum());
- if (lastipos != indexpos && lastseq != sm.sequence)
+ if (lastipos != indexpos || lastseq != sm.sequence)
{
results.addResult(sm.sequence, indexpos, indexpos);
lastipos = indexpos;
return;
}
int atomNo;
- List<AtomSpec> atoms = new ArrayList<AtomSpec>();
+ List<AtomSpec> atoms = new ArrayList<>();
for (StructureMapping sm : mappings)
{
if (sm.sequence == seq || sm.sequence == seq.getDatasetSequence()
public StructureMapping[] getMapping(String pdbfile)
{
- List<StructureMapping> tmp = new ArrayList<StructureMapping>();
+ List<StructureMapping> tmp = new ArrayList<>();
for (StructureMapping sm : mappings)
{
if (sm.pdbfile.equals(pdbfile))
}
}
- Vector<AlignmentViewPanelListener> view_listeners = new Vector<AlignmentViewPanelListener>();
+ Vector<AlignmentViewPanelListener> view_listeners = new Vector<>();
public synchronized void sendViewPosition(
jalview.api.AlignmentViewPanel source, int startRes, int endRes,
return null;
}
- public IProgressIndicator getProgressIndicator()
- {
- return progressIndicator;
- }
-
- public void setProgressIndicator(IProgressIndicator progressIndicator)
- {
- this.progressIndicator = progressIndicator;
- }
-
- public long getProgressSessionId()
- {
- return progressSessionId;
- }
-
- public void setProgressSessionId(long progressSessionId)
- {
- this.progressSessionId = progressSessionId;
- }
-
- public void setProgressBar(String message)
- {
- if (progressIndicator == null)
- {
- return;
- }
- progressIndicator.setProgressBar(message, progressSessionId);
- }
-
public List<AlignedCodonFrame> getSequenceMappings()
{
return seqmappings;
*/
private void upgradeOldLinks(HashMap<String, UrlLink> urls)
{
+ boolean upgrade = false;
// upgrade old SRS link
if (urls.containsKey(SRS_LABEL))
{
urls.remove(SRS_LABEL);
+ upgrade = true;
+ }
+ // upgrade old EBI link - easier just to remove and re-add than faffing
+ // around checking exact url
+ if (urls.containsKey(UrlConstants.DEFAULT_LABEL))
+ {
+ // note because this is called separately for selected and nonselected
+ // urls, the default url will not always be present
+ urls.remove(UrlConstants.DEFAULT_LABEL);
+ upgrade = true;
+ }
+ if (upgrade)
+ {
UrlLink link = new UrlLink(UrlConstants.DEFAULT_STRING);
link.setLabel(UrlConstants.DEFAULT_LABEL);
urls.put(UrlConstants.DEFAULT_LABEL, link);
{
return false;
}
- char[][] letters = new char[seqs.length][];
- for (int i = 0; i < seqs.length; i++)
- {
- if (seqs[i] != null)
- {
- char[] sequence = seqs[i].getSequence();
- if (sequence != null)
- {
- letters[i] = sequence;
- }
- }
- }
-
- return areNucleotide(letters);
- }
- /**
- * Answers true if more than 85% of the sequence residues (ignoring gaps) are
- * A, G, C, T or U, else false. This is just a heuristic guess and may give a
- * wrong answer (as AGCT are also amino acid codes).
- *
- * @param letters
- * @return
- */
- static final boolean areNucleotide(char[][] letters)
- {
int ntCount = 0;
int aaCount = 0;
- for (char[] seq : letters)
+ for (SequenceI seq : seqs)
{
if (seq == null)
{
}
// TODO could possibly make an informed guess just from the first sequence
// to save a lengthy calculation
- for (char c : seq)
+ int len = seq.getLength();
+ for (int i = 0; i < len; i++)
{
+ char c = seq.getCharAt(i);
if (isNucleotide(c))
{
ntCount++;
* A comparator to order [from, to] ranges into ascending or descending order of
* their start position
*/
-public class RangeComparator implements Comparator<int[]>
+public class IntRangeComparator implements Comparator<int[]>
{
+ public static final Comparator<int[]> ASCENDING = new IntRangeComparator(
+ true);
+
+ public static final Comparator<int[]> DESCENDING = new IntRangeComparator(
+ false);
+
boolean forwards;
- public RangeComparator(boolean forward)
+ IntRangeComparator(boolean forward)
{
forwards = forward;
}
}
return copy;
}
+
+ /**
+ * Removes the specified number of positions from the given ranges. Provided
+ * to allow a stop codon to be stripped from a CDS sequence so that it matches
+ * the peptide translation length.
+ *
+ * @param positions
+ * @param ranges
+ * a list of (single) [start, end] ranges
+ * @return
+ */
+ public static void removeEndPositions(int positions,
+ List<int[]> ranges)
+ {
+ int toRemove = positions;
+ Iterator<int[]> it = new ReverseListIterator<>(ranges);
+ while (toRemove > 0)
+ {
+ int[] endRange = it.next();
+ if (endRange.length != 2)
+ {
+ /*
+ * not coded for [start1, end1, start2, end2, ...]
+ */
+ System.err
+ .println("MappingUtils.removeEndPositions doesn't handle multiple ranges");
+ return;
+ }
+
+ int length = endRange[1] - endRange[0] + 1;
+ if (length <= 0)
+ {
+ /*
+ * not coded for a reverse strand range (end < start)
+ */
+ System.err
+ .println("MappingUtils.removeEndPositions doesn't handle reverse strand");
+ return;
+ }
+ if (length > toRemove)
+ {
+ endRange[1] -= toRemove;
+ toRemove = 0;
+ }
+ else
+ {
+ toRemove -= length;
+ it.remove();
+ }
+ }
+ }
}
*/
public class Platform
{
- private static Boolean isAMac = null;
+ private static Boolean isAMac = null, isWindows = null;
private static Boolean isHeadless = null;
{
isAMac = System.getProperty("os.name").indexOf("Mac") > -1;
}
+
return isAMac.booleanValue();
}
+ /**
+ * Check if we are on a Microsoft plaform...
+ *
+ * @return true if we have to cope with another platform variation
+ */
+ public static boolean isWindows()
+ {
+ if (isWindows == null)
+ {
+ isWindows = System.getProperty("os.name").indexOf("Win") > -1;
+ }
+ return isWindows.booleanValue();
+ }
+
+ /**
+ *
+ * @return true if we are running in non-interactive no UI mode
+ */
public static boolean isHeadless()
{
if (isHeadless == null)
public static final String DEFAULT_STRING = DEFAULT_LABEL
+ "|https://www.ebi.ac.uk/ebisearch/search.ebi?db=allebi&query=$SEQUENCE_ID$";
+ private static final String COLON = ":";
+
/*
* not instantiable
*/
private UrlConstants()
{
}
+
+ public static boolean isDefaultString(String link)
+ {
+ String sublink = link.substring(link.indexOf(COLON) + 1);
+ String subdefault = DEFAULT_STRING
+ .substring(DEFAULT_STRING.indexOf(COLON) + 1);
+ return sublink.equalsIgnoreCase(subdefault);
+ }
}
import jalview.analysis.AnnotationSorter.SequenceAnnotationOrder;
import jalview.analysis.Conservation;
+import jalview.analysis.TreeModel;
import jalview.api.AlignCalcManagerI;
import jalview.api.AlignViewportI;
import jalview.api.AlignmentViewPanel;
import jalview.datamodel.AlignmentI;
import jalview.datamodel.AlignmentView;
import jalview.datamodel.Annotation;
-import jalview.datamodel.CigarArray;
import jalview.datamodel.ColumnSelection;
import jalview.datamodel.HiddenColumns;
import jalview.datamodel.HiddenSequences;
public abstract class AlignmentViewport
implements AlignViewportI, CommandListener, VamsasSource
{
- final protected ViewportRanges ranges;
+ protected ViewportRanges ranges;
protected ViewStyleI viewStyle = new ViewStyle();
groupConsensus = null;
groupConservation = null;
hconsensus = null;
+ hconservation = null;
hcomplementConsensus = null;
- // colour scheme may hold reference to consensus
- residueShading = null;
- // TODO remove listeners from changeSupport?
+ gapcounts = null;
+ calculator = null;
+ residueShading = null; // may hold a reference to Consensus
changeSupport = null;
+ ranges = null;
+ currentTree = null;
+ selectionGroup = null;
setAlignment(null);
}
public void removePropertyChangeListener(
java.beans.PropertyChangeListener listener)
{
- changeSupport.removePropertyChangeListener(listener);
+ if (changeSupport != null)
+ {
+ changeSupport.removePropertyChangeListener(listener);
+ }
}
/**
}
@Override
- public CigarArray getViewAsCigars(boolean selectedRegionOnly)
- {
- return new CigarArray(alignment, alignment.getHiddenColumns(),
- (selectedRegionOnly ? selectionGroup : null));
- }
-
- @Override
public jalview.datamodel.AlignmentView getAlignmentView(
boolean selectedOnly)
{
*/
private SearchResultsI searchResults = null;
+ protected TreeModel currentTree = null;
+
@Override
public boolean hasSearchResults()
{
+ ((ignoreGapsInConsensusCalculation) ? " without gaps" : ""));
return sq;
}
+
+ @Override
+ public void setCurrentTree(TreeModel tree)
+ {
+ currentTree = tree;
+ }
+
+ @Override
+ public TreeModel getCurrentTree()
+ {
+ return currentTree;
+ }
}
}
}
- // update viewport
- ranges.setStartRes(xAsRes);
- ranges.setStartSeq(yAsSeq);
+ ranges.setStartResAndSeq(xAsRes, yAsSeq);
}
@Override
}
// update viewport
- ranges.setStartRes(visXAsRes);
- ranges.setStartSeq(visYAsSeq);
+ ranges.setStartResAndSeq(visXAsRes, visYAsSeq);
}
/**
import jalview.datamodel.HiddenColumns;
/**
- * Slightly less embryonic class which: Supplies and updates viewport properties
- * relating to position such as: start and end residues and sequences; ideally
- * will serve hidden columns/rows too. Intention also to support calculations
- * for positioning, scrolling etc. such as finding the middle of the viewport,
- * checking for scrolls off screen
+ * Supplies and updates viewport properties relating to position such as: start
+ * and end residues and sequences; ideally will serve hidden columns/rows too.
+ * Intention also to support calculations for positioning, scrolling etc. such
+ * as finding the middle of the viewport, checking for scrolls off screen
*/
public class ViewportRanges extends ViewportProperties
{
public static final String ENDSEQ = "endseq";
+ public static final String STARTRESANDSEQ = "startresandseq";
+
+ public static final String MOVE_VIEWPORT = "move_viewport";
+
private boolean wrappedMode = false;
// start residue of viewport
*/
public void setStartEndRes(int start, int end)
{
+ int[] oldvalues = updateStartEndRes(start, end);
+ int oldstartres = oldvalues[0];
+ int oldendres = oldvalues[1];
+
+ changeSupport.firePropertyChange(STARTRES, oldstartres, startRes);
+ if (oldstartres == startRes)
+ {
+ // event won't be fired if start positions are same
+ // fire an event for the end positions in case they changed
+ changeSupport.firePropertyChange(ENDRES, oldendres, endRes);
+ }
+ }
+
+ /**
+ * Update start and end residue values, adjusting for width constraints if
+ * necessary
+ *
+ * @param start
+ * start residue
+ * @param end
+ * end residue
+ * @return array containing old start and end residue values
+ */
+ private int[] updateStartEndRes(int start, int end)
+ {
int oldstartres = this.startRes;
/*
{
endRes = end;
}
-
- changeSupport.firePropertyChange(STARTRES, oldstartres, startRes);
- if (oldstartres == startRes)
- {
- // event won't be fired if start positions are same
- // fire an event for the end positions in case they changed
- changeSupport.firePropertyChange(ENDRES, oldendres, endRes);
- }
+ return new int[] { oldstartres, oldendres };
}
/**
*/
public void setStartEndSeq(int start, int end)
{
+ int[] oldvalues = updateStartEndSeq(start, end);
+ int oldstartseq = oldvalues[0];
+ int oldendseq = oldvalues[1];
+
+ changeSupport.firePropertyChange(STARTSEQ, oldstartseq, startSeq);
+ if (oldstartseq == startSeq)
+ {
+ // event won't be fired if start positions are the same
+ // fire in case the end positions changed
+ changeSupport.firePropertyChange(ENDSEQ, oldendseq, endSeq);
+ }
+ }
+
+ /**
+ * Update start and end sequence values, adjusting for height constraints if
+ * necessary
+ *
+ * @param start
+ * start sequence
+ * @param end
+ * end sequence
+ * @return array containing old start and end sequence values
+ */
+ private int[] updateStartEndSeq(int start, int end)
+ {
int oldstartseq = this.startSeq;
int visibleHeight = getVisibleAlignmentHeight();
if (start > visibleHeight - 1)
{
endSeq = end;
}
-
- changeSupport.firePropertyChange(STARTSEQ, oldstartseq, startSeq);
- if (oldstartseq == startSeq)
- {
- // event won't be fired if start positions are the same
- // fire in case the end positions changed
- changeSupport.firePropertyChange(ENDSEQ, oldendseq, endSeq);
- }
+ return new int[] { oldstartseq, oldendseq };
}
/**
}
/**
+ * Set start residue and start sequence together (fires single event). The
+ * event supplies a pair of old values and a pair of new values: [old start
+ * residue, old start sequence] and [new start residue, new start sequence]
+ *
+ * @param res
+ * the start residue
+ * @param seq
+ * the start sequence
+ */
+ public void setStartResAndSeq(int res, int seq)
+ {
+ int width = getViewportWidth();
+ int[] oldresvalues = updateStartEndRes(res, res + width - 1);
+
+ int startseq = seq;
+ int height = getViewportHeight();
+ if (startseq + height - 1 > getVisibleAlignmentHeight() - 1)
+ {
+ startseq = getVisibleAlignmentHeight() - height;
+ }
+ int[] oldseqvalues = updateStartEndSeq(startseq, startseq + height - 1);
+
+ int[] old = new int[] { oldresvalues[0], oldseqvalues[0] };
+ int[] newresseq = new int[] { startRes, startSeq };
+ changeSupport.firePropertyChange(STARTRESANDSEQ, old, newresseq);
+ }
+
+ /**
* Get start residue of viewport
*/
public int getStartRes()
*/
public boolean scrollUp(boolean up)
{
+ /*
+ * if in unwrapped mode, scroll up or down one sequence row;
+ * if in wrapped mode, scroll by one visible width of columns
+ */
if (up)
{
- if (startSeq < 1)
+ if (wrappedMode)
{
- return false;
+ pageUp();
+ }
+ else
+ {
+ if (startSeq < 1)
+ {
+ return false;
+ }
+ setStartSeq(startSeq - 1);
}
-
- setStartSeq(startSeq - 1);
}
else
{
- if (endSeq >= getVisibleAlignmentHeight() - 1)
+ if (wrappedMode)
{
- return false;
+ pageDown();
+ }
+ else
+ {
+ if (endSeq >= getVisibleAlignmentHeight() - 1)
+ {
+ return false;
+ }
+ setStartSeq(startSeq + 1);
}
-
- setStartSeq(startSeq + 1);
}
return true;
}
}
/**
- * Scroll a wrapped alignment so that the specified residue is visible. Fires
- * a property change event.
+ * Scroll a wrapped alignment so that the specified residue is in the first
+ * repeat of the wrapped view. Fires a property change event. Answers true if
+ * the startRes changed, else false.
+ *
+ * @param res
+ * residue position to scroll to NB visible position not absolute
+ * alignment position
+ * @return
+ */
+ public boolean scrollToWrappedVisible(int res)
+ {
+ int newStartRes = calcWrappedStartResidue(res);
+ if (newStartRes == startRes)
+ {
+ return false;
+ }
+ setStartRes(newStartRes);
+
+ return true;
+ }
+
+ /**
+ * Calculate wrapped start residue from visible start residue
*
* @param res
- * residue position to scroll to
+ * visible start residue
+ * @return left column of panel res will be located in
*/
- public void scrollToWrappedVisible(int res)
+ private int calcWrappedStartResidue(int res)
{
- // get the start residue of the wrapped row which res is in
- // and set that as our start residue
+ int oldStartRes = startRes;
int width = getViewportWidth();
- setStartRes((res / width) * width);
+
+ boolean up = res < oldStartRes;
+ int widthsToScroll = Math.abs((res - oldStartRes) / width);
+ if (up)
+ {
+ widthsToScroll++;
+ }
+
+ int residuesToScroll = width * widthsToScroll;
+ int newStartRes = up ? oldStartRes - residuesToScroll : oldStartRes
+ + residuesToScroll;
+ if (newStartRes < 0)
+ {
+ newStartRes = 0;
+ }
+ return newStartRes;
}
/**
* Scroll so that (x,y) is visible. Fires a property change event.
*
* @param x
- * x position in alignment
+ * x position in alignment (absolute position)
* @param y
- * y position in alignment
+ * y position in alignment (absolute position)
*/
public void scrollToVisible(int x, int y)
{
{
scrollUp(false);
}
-
+
HiddenColumns hidden = al.getHiddenColumns();
while (x < hidden.adjustForHiddenColumns(startRes))
{
}
/**
+ * Set the viewport location so that a position is visible
+ *
+ * @param x
+ * column to be visible: absolute position in alignment
+ * @param y
+ * row to be visible: absolute position in alignment
+ */
+ public boolean setViewportLocation(int x, int y)
+ {
+ boolean changedLocation = false;
+
+ // convert the x,y location to visible coordinates
+ int visX = al.getHiddenColumns().findColumnPosition(x);
+ int visY = al.getHiddenSequences().findIndexWithoutHiddenSeqs(y);
+
+ // if (vis_x,vis_y) is already visible don't do anything
+ if (startRes > visX || visX > endRes
+ || startSeq > visY && visY > endSeq)
+ {
+ int[] old = new int[] { startRes, startSeq };
+ int[] newresseq;
+ if (wrappedMode)
+ {
+ int newstartres = calcWrappedStartResidue(visX);
+ setStartRes(newstartres);
+ newresseq = new int[] { startRes, startSeq };
+ }
+ else
+ {
+ // set the viewport x location to contain vis_x
+ int newstartres = visX;
+ int width = getViewportWidth();
+ if (newstartres + width - 1 > getVisibleAlignmentWidth() - 1)
+ {
+ newstartres = getVisibleAlignmentWidth() - width;
+ }
+ updateStartEndRes(newstartres, newstartres + width - 1);
+
+ // set the viewport y location to contain vis_y
+ int newstartseq = visY;
+ int height = getViewportHeight();
+ if (newstartseq + height - 1 > getVisibleAlignmentHeight() - 1)
+ {
+ newstartseq = getVisibleAlignmentHeight() - height;
+ }
+ updateStartEndSeq(newstartseq, newstartseq + height - 1);
+
+ newresseq = new int[] { startRes, startSeq };
+ }
+ changedLocation = true;
+ changeSupport.firePropertyChange(MOVE_VIEWPORT, old, newresseq);
+ }
+ return changedLocation;
+ }
+
+ /**
* Adjust sequence position for page up. Fires a property change event.
*/
public void pageUp()
import jalview.datamodel.AlignmentI;
import jalview.datamodel.SequenceFeature;
import jalview.datamodel.SequenceI;
+import jalview.datamodel.features.SequenceFeatures;
import jalview.renderer.seqfeatures.FeatureRenderer;
import jalview.schemes.FeatureColour;
import jalview.util.ColorUtils;
synchronized (fd)
{
fd.clear();
- java.util.Iterator<String> fdisp = _fr.getFeaturesDisplayed()
- .getVisibleFeatures();
- while (fdisp.hasNext())
+ for (String type : _fr.getFeaturesDisplayed()
+ .getVisibleFeatures())
{
- fd.setVisible(fdisp.next());
+ fd.setVisible(type);
}
}
}
}
@Override
- public List<SequenceFeature> findFeaturesAtRes(SequenceI sequence,
- int res)
+ public List<SequenceFeature> findFeaturesAtColumn(SequenceI sequence, int column)
{
- ArrayList<SequenceFeature> tmp = new ArrayList<SequenceFeature>();
- SequenceFeature[] features = sequence.getSequenceFeatures();
-
- if (features != null)
+ /*
+ * include features at the position provided their feature type is
+ * displayed, and feature group is null or marked for display
+ */
+ List<SequenceFeature> result = new ArrayList<SequenceFeature>();
+ if (!av.areFeaturesDisplayed() || getFeaturesDisplayed() == null)
{
- for (int i = 0; i < features.length; i++)
- {
- if (!av.areFeaturesDisplayed() || !av.getFeaturesDisplayed()
- .isVisible(features[i].getType()))
- {
- continue;
- }
+ return result;
+ }
- if (features[i].featureGroup != null && featureGroups != null
- && featureGroups.containsKey(features[i].featureGroup)
- && !featureGroups.get(features[i].featureGroup)
- .booleanValue())
- {
- continue;
- }
+ Set<String> visibleFeatures = getFeaturesDisplayed()
+ .getVisibleFeatures();
+ String[] visibleTypes = visibleFeatures
+ .toArray(new String[visibleFeatures.size()]);
+ List<SequenceFeature> features = sequence.findFeatures(column, column,
+ visibleTypes);
- // check if start/end are at res, and if not a contact feature, that res
- // lies between start and end
- if ((features[i].getBegin() == res || features[i].getEnd() == res)
- || (!features[i].isContactFeature()
- && (features[i].getBegin() < res)
- && (features[i].getEnd() >= res)))
- {
- tmp.add(features[i]);
- }
+ for (SequenceFeature sf : features)
+ {
+ if (!featureGroupNotShown(sf))
+ {
+ result.add(sf);
}
}
- return tmp;
+ return result;
}
/**
* Searches alignment for all features and updates colours
*
* @param newMadeVisible
- * if true newly added feature types will be rendered immediatly
+ * if true newly added feature types will be rendered immediately
* TODO: check to see if this method should actually be proxied so
* repaint events can be propagated by the renderer code
*/
}
FeaturesDisplayedI featuresDisplayed = av.getFeaturesDisplayed();
- ArrayList<String> allfeatures = new ArrayList<String>();
- ArrayList<String> oldfeatures = new ArrayList<String>();
+ Set<String> oldfeatures = new HashSet<String>();
if (renderOrder != null)
{
for (int i = 0; i < renderOrder.length; i++)
}
}
}
- if (minmax == null)
- {
- minmax = new Hashtable<String, float[][]>();
- }
- Set<String> oldGroups = new HashSet<String>(featureGroups.keySet());
AlignmentI alignment = av.getAlignment();
+ List<String> allfeatures = new ArrayList<String>();
+
for (int i = 0; i < alignment.getHeight(); i++)
{
SequenceI asq = alignment.getSequenceAt(i);
- SequenceFeature[] features = asq.getSequenceFeatures();
-
- if (features == null)
- {
- continue;
- }
-
- int index = 0;
- while (index < features.length)
+ for (String group : asq.getFeatures().getFeatureGroups(true))
{
- String fgrp = features[index].getFeatureGroup();
- oldGroups.remove(fgrp);
- if (!featuresDisplayed.isRegistered(features[index].getType()))
+ boolean groupDisplayed = true;
+ if (group != null)
{
- if (fgrp != null)
+ if (featureGroups.containsKey(group))
{
- Boolean groupDisplayed = featureGroups.get(fgrp);
- if (groupDisplayed == null)
- {
- groupDisplayed = Boolean.valueOf(newMadeVisible);
- featureGroups.put(fgrp, groupDisplayed);
- }
- if (!groupDisplayed.booleanValue())
- {
- index++;
- continue;
- }
+ groupDisplayed = featureGroups.get(group);
}
- if (!(features[index].begin == 0 && features[index].end == 0))
+ else
{
- // If beginning and end are 0, the feature is for the whole sequence
- // and we don't want to render the feature in the normal way
-
- if (newMadeVisible
- && !oldfeatures.contains(features[index].getType()))
- {
- // this is a new feature type on the alignment. Mark it for
- // display.
- featuresDisplayed.setVisible(features[index].getType());
- setOrder(features[index].getType(), 0);
- }
+ groupDisplayed = newMadeVisible;
+ featureGroups.put(group, groupDisplayed);
}
}
- if (!allfeatures.contains(features[index].getType()))
+ if (groupDisplayed)
{
- allfeatures.add(features[index].getType());
- }
- if (!Float.isNaN(features[index].score))
- {
- int nonpos = features[index].getBegin() >= 1 ? 0 : 1;
- float[][] mm = minmax.get(features[index].getType());
- if (mm == null)
- {
- mm = new float[][] { null, null };
- minmax.put(features[index].getType(), mm);
- }
- if (mm[nonpos] == null)
- {
- mm[nonpos] = new float[] { features[index].score,
- features[index].score };
-
- }
- else
+ Set<String> types = asq.getFeatures().getFeatureTypesForGroups(
+ true, group);
+ for (String type : types)
{
- if (mm[nonpos][0] > features[index].score)
+ if (!allfeatures.contains(type)) // or use HashSet and no test?
{
- mm[nonpos][0] = features[index].score;
- }
- if (mm[nonpos][1] < features[index].score)
- {
- mm[nonpos][1] = features[index].score;
+ allfeatures.add(type);
}
+ updateMinMax(asq, type, true); // todo: for all features?
}
}
- index++;
}
}
- /*
- * oldGroups now consists of groups that no longer
- * have any feature in them - remove these
- */
- for (String grp : oldGroups)
+ // uncomment to add new features in alphebetical order (but JAL-2575)
+ // Collections.sort(allfeatures, String.CASE_INSENSITIVE_ORDER);
+ if (newMadeVisible)
{
- featureGroups.remove(grp);
+ for (String type : allfeatures)
+ {
+ if (!oldfeatures.contains(type))
+ {
+ featuresDisplayed.setVisible(type);
+ setOrder(type, 0);
+ }
+ }
}
updateRenderOrder(allfeatures);
findingFeatures = false;
}
+ /**
+ * Updates the global (alignment) min and max values for a feature type from
+ * the score for a sequence, if the score is not NaN. Values are stored
+ * separately for positional and non-positional features.
+ *
+ * @param seq
+ * @param featureType
+ * @param positional
+ */
+ protected void updateMinMax(SequenceI seq, String featureType,
+ boolean positional)
+ {
+ float min = seq.getFeatures().getMinimumScore(featureType, positional);
+ if (Float.isNaN(min))
+ {
+ return;
+ }
+
+ float max = seq.getFeatures().getMaximumScore(featureType, positional);
+
+ /*
+ * stored values are
+ * { {positionalMin, positionalMax}, {nonPositionalMin, nonPositionalMax} }
+ */
+ if (minmax == null)
+ {
+ minmax = new Hashtable<String, float[][]>();
+ }
+ synchronized (minmax)
+ {
+ float[][] mm = minmax.get(featureType);
+ int index = positional ? 0 : 1;
+ if (mm == null)
+ {
+ mm = new float[][] { null, null };
+ minmax.put(featureType, mm);
+ }
+ if (mm[index] == null)
+ {
+ mm[index] = new float[] { min, max };
+ }
+ else
+ {
+ mm[index][0] = Math.min(mm[index][0], min);
+ mm[index][1] = Math.max(mm[index][1], max);
+ }
+ }
+ }
protected Boolean firing = Boolean.FALSE;
/**
* Returns the configured colour for a particular feature instance. This
* includes calculation of 'colour by label', or of a graduated score colour,
* if applicable. It does not take into account feature visibility or colour
- * transparency.
+ * transparency. Returns null for a score feature whose score value lies
+ * outside any colour threshold.
*
* @param feature
* @return
public Color getColour(SequenceFeature feature)
{
FeatureColourI fc = getFeatureStyle(feature.getType());
- return fc.isColored(feature) ? fc.getColor(feature) : null;
- }
-
- /**
- * Answers true unless the feature has a score value which lies outside a
- * minimum or maximum threshold configured for colouring. This method does not
- * check feature type or group visibility.
- *
- * @param sequenceFeature
- * @return
- */
- protected boolean showFeature(SequenceFeature sequenceFeature)
- {
- FeatureColourI fc = getFeatureStyle(sequenceFeature.type);
- return fc.isColored(sequenceFeature);
+ return fc.getColor(feature);
}
/**
}
/**
- * Sets the priority order for features
+ * Sets the priority order for features, with the highest priority (displayed
+ * on top) at the start of the data array
*
* @param data
* { String(Type), Colour(Type), Boolean(Displayed) }
{
return fcols;
}
- Iterator<String> features = getViewport().getFeaturesDisplayed()
+ Set<String> features = getViewport().getFeaturesDisplayed()
.getVisibleFeatures();
- while (features.hasNext())
+ for (String feature : features)
{
- String feature = features.next();
fcols.put(feature, getFeatureStyle(feature));
}
return fcols;
public List<String> getDisplayedFeatureGroups()
{
List<String> _gps = new ArrayList<String>();
- boolean valid = false;
for (String gp : getFeatureGroups())
{
if (checkGroupVisibility(gp, false))
{
- valid = true;
_gps.add(gp);
}
- if (!valid)
+ }
+ return _gps;
+ }
+
+ /**
+ * Answers true if the feature belongs to a feature group which is not
+ * currently displayed, else false
+ *
+ * @param sequenceFeature
+ * @return
+ */
+ protected boolean featureGroupNotShown(final SequenceFeature sequenceFeature)
+ {
+ return featureGroups != null
+ && sequenceFeature.featureGroup != null
+ && sequenceFeature.featureGroup.length() != 0
+ && featureGroups.containsKey(sequenceFeature.featureGroup)
+ && !featureGroups.get(sequenceFeature.featureGroup)
+ .booleanValue();
+ }
+
+ /**
+ * {@inheritDoc}
+ */
+ @Override
+ public List<SequenceFeature> findFeaturesAtResidue(SequenceI sequence,
+ int resNo)
+ {
+ List<SequenceFeature> result = new ArrayList<SequenceFeature>();
+ if (!av.areFeaturesDisplayed() || getFeaturesDisplayed() == null)
+ {
+ return result;
+ }
+
+ /*
+ * include features at the position provided their feature type is
+ * displayed, and feature group is null or the empty string
+ * or marked for display
+ */
+ Set<String> visibleFeatures = getFeaturesDisplayed()
+ .getVisibleFeatures();
+ String[] visibleTypes = visibleFeatures
+ .toArray(new String[visibleFeatures.size()]);
+ List<SequenceFeature> features = sequence.getFeatures().findFeatures(
+ resNo, resNo, visibleTypes);
+
+ for (SequenceFeature sf : features)
+ {
+ if (!featureGroupNotShown(sf))
{
- return null;
+ result.add(sf);
}
- else
+ }
+ return result;
+ }
+
+ /**
+ * Removes from the list of features any that have a feature group that is not
+ * displayed, or duplicate the location of a feature of the same type (unless
+ * a graduated colour scheme or colour by label is applied). Should be used
+ * only for features of the same feature colour (which normally implies the
+ * same feature type).
+ *
+ * @param features
+ * @param fc
+ */
+ public void filterFeaturesForDisplay(List<SequenceFeature> features,
+ FeatureColourI fc)
+ {
+ if (features.isEmpty())
+ {
+ return;
+ }
+ SequenceFeatures.sortFeatures(features, true);
+ boolean simpleColour = fc == null || fc.isSimpleColour();
+ SequenceFeature lastFeature = null;
+
+ Iterator<SequenceFeature> it = features.iterator();
+ while (it.hasNext())
+ {
+ SequenceFeature sf = it.next();
+ if (featureGroupNotShown(sf))
{
- // gps = new String[_gps.size()];
- // _gps.toArray(gps);
+ it.remove();
+ continue;
}
+
+ /*
+ * a feature is redundant for rendering purposes if it has the
+ * same extent as another (so would just redraw the same colour);
+ * (checking type and isContactFeature as a fail-safe here, although
+ * currently they are guaranteed to match in this context)
+ */
+ if (simpleColour)
+ {
+ if (lastFeature != null && sf.getBegin() == lastFeature.getBegin()
+ && sf.getEnd() == lastFeature.getEnd()
+ && sf.isContactFeature() == lastFeature.isContactFeature()
+ && sf.getType().equals(lastFeature.getType()))
+ {
+ it.remove();
+ }
+ }
+ lastFeature = sf;
}
- return _gps;
}
}
import jalview.api.FeaturesDisplayedI;
import java.util.Collection;
+import java.util.Collections;
import java.util.HashSet;
-import java.util.Iterator;
+import java.util.Set;
public class FeaturesDisplayed implements FeaturesDisplayedI
{
- private HashSet<String> featuresDisplayed = new HashSet<String>();
+ private Set<String> featuresDisplayed = new HashSet<String>();
- private HashSet<String> featuresRegistered = new HashSet<String>();
+ private Set<String> featuresRegistered = new HashSet<String>();
public FeaturesDisplayed(FeaturesDisplayedI featuresDisplayed2)
{
- Iterator<String> fdisp = featuresDisplayed2.getVisibleFeatures();
- String ftype;
- while (fdisp.hasNext())
+ Set<String> fdisp = featuresDisplayed2.getVisibleFeatures();
+ for (String ftype : fdisp)
{
- ftype = fdisp.next();
featuresDisplayed.add(ftype);
featuresRegistered.add(ftype);
}
public FeaturesDisplayed()
{
- // TODO Auto-generated constructor stub
}
@Override
- public Iterator<String> getVisibleFeatures()
+ public Set<String> getVisibleFeatures()
{
- return featuresDisplayed.iterator();
+ return Collections.unmodifiableSet(featuresDisplayed);
}
@Override
AnnotationProviderI counter)
{
super(viewport, panel);
- ourAnnots = new ArrayList<AlignmentAnnotation>();
+ ourAnnots = new ArrayList<>();
this.counter = counter;
calcMan.registerWorker(this);
}
if (ap != null)
{
ap.adjustAnnotationHeight();
- ap.paintAlignment(true);
+ // TODO: only need to update colour and geometry if panel height changes
+ // and view is coloured by annotation, and the annotation is actually
+ // changed!
+ ap.paintAlignment(true, true);
}
}
AlignmentViewPanel panel, FeatureSetCounterI counter)
{
super(viewport, panel);
- ourAnnots = new ArrayList<AlignmentAnnotation>();
+ ourAnnots = new ArrayList<>();
this.counter = counter;
calcMan.registerWorker(this);
}
{
ap.adjustAnnotationHeight();
}
- ap.paintAlignment(true);
+ ap.paintAlignment(true, true);
}
}
*
* @param alignment
* @param col
+ * (0..)
* @param row
* @param fr
*/
{
return null;
}
- int pos = seq.findPosition(col);
/*
* compute a count for any displayed features at residue
*/
- // NB have to adjust pos if using AlignmentView.getVisibleAlignment
// see JAL-2075
- List<SequenceFeature> features = fr.findFeaturesAtRes(seq, pos);
+ List<SequenceFeature> features = fr.findFeaturesAtColumn(seq, col + 1);
int[] count = this.counter.count(String.valueOf(res), features);
return count;
}
{
if (ap != null)
{
- ap.paintAlignment(false);
+ ap.paintAlignment(false, false);
}
Thread.sleep(200);
} catch (Exception ex)
if (ap != null)
{
- ap.paintAlignment(true);
+ ap.paintAlignment(true, true);
}
} catch (OutOfMemoryError error)
{
abortAndDestroy();
return;
}
- List<AlignmentAnnotation> ourAnnot = new ArrayList<AlignmentAnnotation>();
+ List<AlignmentAnnotation> ourAnnot = new ArrayList<>();
AlignmentI alignment = alignViewport.getAlignment();
conservation = alignViewport.getAlignmentConservationAnnotation();
quality = alignViewport.getAlignmentQualityAnnot();
}
if (ap != null)
{
- ap.paintAlignment(true);
+ ap.paintAlignment(true, true);
}
}
calcMan.workerComplete(this);
if (ap != null)
{
- ap.paintAlignment(true);
+ ap.paintAlignment(true, true);
}
}
import jalview.datamodel.DBRefEntry;
import jalview.datamodel.DBRefSource;
import jalview.datamodel.Mapping;
-import jalview.datamodel.SequenceFeature;
import jalview.datamodel.SequenceI;
import jalview.gui.CutAndPasteTransfer;
import jalview.gui.DasSourceBrowser;
if (updateRefFrame)
{
- SequenceFeature[] sfs = sequence.getSequenceFeatures();
- if (sfs != null)
+ /*
+ * relocate existing sequence features by offset
+ */
+ int startShift = absStart - sequenceStart + 1;
+ if (startShift != 0)
{
- /*
- * relocate existing sequence features by offset
- */
- int start = sequenceStart;
- int end = sequence.getEnd();
- int startShift = 1 - absStart - start;
-
- if (startShift != 0)
- {
- for (SequenceFeature sf : sfs)
- {
- if (sf.getBegin() >= start && sf.getEnd() <= end)
- {
- sf.setBegin(sf.getBegin() + startShift);
- sf.setEnd(sf.getEnd() + startShift);
- modified = true;
- }
- }
- }
+ modified |= sequence.getFeatures().shiftFeatures(startShift);
}
}
}
boolean useJDasMultiThread)
{
this.useJDASMultiThread = useJDasMultiThread;
- this.selectedSources = new ArrayList<jalviewSourceI>();
+ this.selectedSources = new ArrayList<>();
// filter both sequences and sources to eliminate duplicates
for (jalviewSourceI src : selectedSources2)
{
FeaturesClientMultipleSources fc = new FeaturesClientMultipleSources();
fc.setConnProps(sourceRegistry.getSessionHandler());
// Now sending requests one at a time to each server
- ArrayList<jalviewSourceI> srcobj = new ArrayList<jalviewSourceI>();
- ArrayList<String> src = new ArrayList<String>();
- List<List<String>> ids = new ArrayList<List<String>>();
- List<List<DBRefEntry>> idobj = new ArrayList<List<DBRefEntry>>();
- List<Map<String, SequenceI>> sqset = new ArrayList<Map<String, SequenceI>>();
+ ArrayList<jalviewSourceI> srcobj = new ArrayList<>();
+ ArrayList<String> src = new ArrayList<>();
+ List<List<String>> ids = new ArrayList<>();
+ List<List<DBRefEntry>> idobj = new ArrayList<>();
+ List<Map<String, SequenceI>> sqset = new ArrayList<>();
for (jalviewSourceI _sr : selectedSources)
{
- Map<String, SequenceI> slist = new HashMap<String, SequenceI>();
- List<DBRefEntry> idob = new ArrayList<DBRefEntry>();
- List<String> qset = new ArrayList<String>();
+ Map<String, SequenceI> slist = new HashMap<>();
+ List<DBRefEntry> idob = new ArrayList<>();
+ List<String> qset = new ArrayList<>();
for (SequenceI seq : sequences)
{
sqset.add(slist);
}
}
- Map<String, Map<List<String>, Exception>> errors = new HashMap<String, Map<List<String>, Exception>>();
- Map<String, Map<List<String>, DasGFFAdapter>> results = new HashMap<String, Map<List<String>, DasGFFAdapter>>();
+ Map<String, Map<List<String>, Exception>> errors = new HashMap<>();
+ Map<String, Map<List<String>, DasGFFAdapter>> results = new HashMap<>();
if (!useJDASMultiThread)
{
Iterator<String> sources = src.iterator();
if (ers == null)
{
results.put(source,
- ers = new HashMap<List<String>, DasGFFAdapter>());
+ ers = new HashMap<>());
}
ers.put(qid, dga);
} catch (Exception ex)
if (ers == null)
{
errors.put(source,
- ers = new HashMap<List<String>, Exception>());
+ ers = new HashMap<>());
}
ers.put(qid, ex);
}
Map<List<String>, DasGFFAdapter> results,
Map<List<String>, Exception> errors)
{
- Set<SequenceI> sequences = new HashSet<SequenceI>();
+ Set<SequenceI> sequences = new HashSet<>();
String source = jvsource.getSourceURL();
// process features
DasGFFAdapter result = (results == null) ? null : results.get(ids);
if (seq == af.getViewport().getAlignment().getSequenceAt(index)
.getDatasetSequence())
{
- af.alignPanel.paintAlignment(true);
+ af.alignPanel.paintAlignment(true, true);
index = end;
break;
}
// TODO: minimal list of DAS queries to make by querying with untyped ID if
// distinct from any typed IDs
- List<DBRefEntry> ids = new ArrayList<DBRefEntry>();
- List<String> qstring = new ArrayList<String>();
+ List<DBRefEntry> ids = new ArrayList<>();
+ List<String> qstring = new ArrayList<>();
boolean dasCoordSysFound = false;
if (uprefs != null)
import jalview.datamodel.Sequence;
import jalview.datamodel.SequenceFeature;
import jalview.datamodel.SequenceI;
-import jalview.datamodel.UniprotEntry;
-import jalview.datamodel.UniprotFile;
+import jalview.datamodel.xdb.uniprot.UniprotEntry;
+import jalview.datamodel.xdb.uniprot.UniprotFeature;
+import jalview.datamodel.xdb.uniprot.UniprotFile;
import jalview.ws.seqfetcher.DbSourceProxyImpl;
import java.io.InputStream;
}
}
-
}
sequence.setPDBId(onlyPdbEntries);
if (entry.getFeature() != null)
{
- for (SequenceFeature sf : entry.getFeature())
+ for (UniprotFeature uf : entry.getFeature())
{
- sf.setFeatureGroup("Uniprot");
- sequence.addSequenceFeature(sf);
+ SequenceFeature copy = new SequenceFeature(uf.getType(),
+ uf.getDescription(), uf.getBegin(), uf.getEnd(), "Uniprot");
+ copy.setStatus(uf.getStatus());
+ sequence.addSequenceFeature(copy);
}
}
for (DBRefEntry dbr : dbRefs)
/**
*
* @param entry
- * UniportEntry
+ * UniprotEntry
* @return The accession id(s) and name(s) delimited by '|'.
*/
public static String getUniprotEntryId(UniprotEntry entry)
{
StringBuilder name = new StringBuilder(32);
- // name.append("UniProt/Swiss-Prot");
- // use 'canonicalised' name for optimal id matching
- name.append(DBRefSource.UNIPROT);
- for (String accessionId : entry.getAccession())
- {
- name.append(BAR_DELIMITER);
- name.append(accessionId);
- }
for (String n : entry.getName())
{
- name.append(BAR_DELIMITER);
+ if (name.length() > 0)
+ {
+ name.append(BAR_DELIMITER);
+ }
name.append(n);
}
return name.toString();
*/
package jalview.ws.jws2;
-import jalview.api.AlignCalcWorkerI;
import jalview.api.FeatureColourI;
import jalview.bin.Cache;
import jalview.datamodel.AlignmentAnnotation;
AlignFrame af;
public AADisorderClient(Jws2Instance sh, AlignFrame alignFrame,
- WsParamSetI preset, List<Argument> paramset)
+ WsParamSetI thePreset, List<Argument> paramset)
{
- super(sh, alignFrame, preset, paramset);
+ super(sh, alignFrame, thePreset, paramset);
af = alignFrame;
typeName = sh.action;
methodName = sh.serviceType;
{
// TODO: turn this into some kind of configuration file that's a bit easier
// to edit
- featureMap = new HashMap<String, Map<String, String[]>>();
+ featureMap = new HashMap<>();
Map<String, String[]> fmap;
featureMap.put(compbio.ws.client.Services.IUPredWS.toString(),
- fmap = new HashMap<String, String[]>());
+ fmap = new HashMap<>());
fmap.put("Glob",
new String[]
{ "Globular Domain", "Predicted globular domain" });
featureMap.put(compbio.ws.client.Services.JronnWS.toString(),
- fmap = new HashMap<String, String[]>());
+ fmap = new HashMap<>());
featureMap.put(compbio.ws.client.Services.DisemblWS.toString(),
- fmap = new HashMap<String, String[]>());
+ fmap = new HashMap<>());
fmap.put("REM465", new String[] { "REM465", "Missing density" });
fmap.put("HOTLOOPS", new String[] { "HOTLOOPS", "Flexible loops" });
fmap.put("COILS", new String[] { "COILS", "Random coil" });
featureMap.put(compbio.ws.client.Services.GlobPlotWS.toString(),
- fmap = new HashMap<String, String[]>());
+ fmap = new HashMap<>());
fmap.put("GlobDoms",
new String[]
{ "Globular Domain", "Predicted globular domain" });
new String[]
{ "Protein Disorder", "Probable unstructured peptide region" });
Map<String, Map<String, Object>> amap;
- annotMap = new HashMap<String, Map<String, Map<String, Object>>>();
+ annotMap = new HashMap<>();
annotMap.put(compbio.ws.client.Services.GlobPlotWS.toString(),
- amap = new HashMap<String, Map<String, Object>>());
+ amap = new HashMap<>());
amap.put("Dydx", new HashMap<String, Object>());
amap.get("Dydx").put(DONTCOMBINE, DONTCOMBINE);
amap.get("Dydx").put(THRESHOLD, new double[] { 1, 0 });
amap.put("RawScore", new HashMap<String, Object>());
amap.get("RawScore").put(INVISIBLE, INVISIBLE);
annotMap.put(compbio.ws.client.Services.DisemblWS.toString(),
- amap = new HashMap<String, Map<String, Object>>());
+ amap = new HashMap<>());
amap.put("COILS", new HashMap<String, Object>());
amap.put("HOTLOOPS", new HashMap<String, Object>());
amap.put("REM465", new HashMap<String, Object>());
amap.get("REM465").put(RANGE, new float[] { 0, 1 });
annotMap.put(compbio.ws.client.Services.IUPredWS.toString(),
- amap = new HashMap<String, Map<String, Object>>());
+ amap = new HashMap<>());
amap.put("Long", new HashMap<String, Object>());
amap.put("Short", new HashMap<String, Object>());
amap.get("Long").put(THRESHOLD, new double[] { 1, 0.5 });
amap.get("Short").put(THRESHOLD, new double[] { 1, 0.5 });
amap.get("Short").put(RANGE, new float[] { 0, 1 });
annotMap.put(compbio.ws.client.Services.JronnWS.toString(),
- amap = new HashMap<String, Map<String, Object>>());
+ amap = new HashMap<>());
amap.put("JRonn", new HashMap<String, Object>());
amap.get("JRonn").put(THRESHOLD, new double[] { 1, 0.5 });
amap.get("JRonn").put(RANGE, new float[] { 0, 1 });
Map<String, Map<String, Object>> annotTypeMap = annotMap
.get(service.serviceType);
boolean dispFeatures = false;
- Map<String, Object> fc = new Hashtable<String, Object>();
- List<AlignmentAnnotation> ourAnnot = new ArrayList<AlignmentAnnotation>();
+ Map<String, Object> fc = new Hashtable<>();
+ List<AlignmentAnnotation> ourAnnot = new ArrayList<>();
/**
* grouping for any annotation rows created
*/
}
if (vals.hasNext())
{
- sf = new SequenceFeature(type[0], type[1], base + rn.from,
- base + rn.to, val = vals.next().floatValue(),
- methodName);
+ val = vals.next().floatValue();
+ sf = new SequenceFeature(type[0], type[1],
+ base + rn.from, base + rn.to, val, methodName);
}
else
{
- sf = new SequenceFeature(type[0], type[1], null,
+ sf = new SequenceFeature(type[0], type[1],
base + rn.from, base + rn.to, methodName);
}
dseq.addSequenceFeature(sf);
// only do this if the alignFrame is currently showing this view.
af.setShowSeqFeatures(true);
}
- ap.paintAlignment(true);
}
if (ourAnnot.size() > 0)
{
// new alignment annotation rows created.
updateOurAnnots(ourAnnot);
ap.adjustAnnotationHeight();
+ ap.paintAlignment(true, true);
}
}
}
import jalview.datamodel.SequenceI;
import jalview.gui.AlignFrame;
import jalview.gui.IProgressIndicator;
+import jalview.gui.IProgressIndicatorHandler;
import jalview.schemes.ResidueProperties;
import jalview.workers.AlignCalcWorker;
import jalview.ws.jws2.dm.AAConSettings;
progressId = System.currentTimeMillis());
}
rslt = submitToService(seqs);
+ if (guiProgress != null)
+ {
+ guiProgress.registerHandler(progressId,
+ new IProgressIndicatorHandler()
+ {
+ @Override
+ public boolean cancelActivity(long id)
+ {
+ cancelCurrentJob();
+ return true;
+ }
+
+ @Override
+ public boolean canCancel()
+ {
+ return true;
+ }
+ });
+ }
boolean finished = false;
long rpos = 0;
do
{
guiProgress.setProgressBar("", progressId);
}
- ap.paintAlignment(true);
+ // TODO: may not need to paintAlignment again !
+ ap.paintAlignment(false, false);
}
if (msg.length() > 0)
{
protected boolean checkDone()
{
calcMan.notifyStart(this);
- ap.paintAlignment(false);
+ ap.paintAlignment(false, false);
while (!calcMan.notifyWorking(this))
{
if (calcMan.isWorking(this))
{
if (ap != null)
{
- ap.paintAlignment(false);
+ ap.paintAlignment(false, false);
}
Thread.sleep(200);
{
try
{
- Closeable svc = (Closeable) service;
- service = null;
- svc.close();
- } catch (Exception e)
+ ((Closeable) service).close();
+ } catch (Throwable t)
{
+ // ignore
}
- ;
}
super.finalize();
}
{
idvector.append(sep);
}
- idvector.append(seq.getSequence());
+ idvector.append(seq.getSequenceAsString());
}
return new StringBody(idvector.toString());
}
import jalview.structure.StructureImportSettings;
import java.awt.Color;
+import java.util.List;
import java.util.Vector;
import org.testng.annotations.BeforeClass;
/*
* check sequence features
*/
- SequenceFeature[] sfs = c.sequence.getSequenceFeatures();
- assertEquals(3, sfs.length);
- assertEquals("RESNUM", sfs[0].type);
- assertEquals("MET:4 1gaqA", sfs[0].description);
- assertEquals(4, sfs[0].begin);
- assertEquals(4, sfs[0].end);
- assertEquals("RESNUM", sfs[0].type);
- assertEquals("LYS:5 1gaqA", sfs[1].description);
- assertEquals(5, sfs[1].begin);
- assertEquals(5, sfs[1].end);
- assertEquals("LEU:6 1gaqA", sfs[2].description);
- assertEquals(6, sfs[2].begin);
- assertEquals(6, sfs[2].end);
+ List<SequenceFeature> sfs = c.sequence.getSequenceFeatures();
+ assertEquals(3, sfs.size());
+ assertEquals("RESNUM", sfs.get(0).type);
+ assertEquals("MET:4 1gaqA", sfs.get(0).description);
+ assertEquals(4, sfs.get(0).begin);
+ assertEquals(4, sfs.get(0).end);
+ assertEquals("RESNUM", sfs.get(0).type);
+ assertEquals("LYS:5 1gaqA", sfs.get(1).description);
+ assertEquals(5, sfs.get(1).begin);
+ assertEquals(5, sfs.get(1).end);
+ assertEquals("LEU:6 1gaqA", sfs.get(2).description);
+ assertEquals(6, sfs.get(2).begin);
+ assertEquals(6, sfs.get(2).end);
}
private Atom makeAtom(int resnum, String name, String resname)
import jalview.gui.JvOptionPane;
import jalview.io.FastaFile;
+import java.io.File;
+import java.io.FileNotFoundException;
+import java.io.PrintStream;
import java.util.Arrays;
import java.util.Random;
import org.testng.annotations.BeforeClass;
/**
- * Generates, and outputs in Fasta format, a random DNA alignment for given
+ * Generates, and outputs in Fasta format, a random peptide or nucleotide alignment for given
* sequence length and count. Will regenerate the same alignment each time if
* the same random seed is used (so may be used for reproducible unit tests).
* Not guaranteed to reproduce the same results between versions, as the rules
* may get tweaked to produce more 'realistic' results.
*
- * Arguments:
- * <ul>
- * <li>length (number of bases in each sequence)</li>
- * <li>height (number of sequences)</li>
- * <li>a whole number random seed</li>
- * <li>percentage of gaps to include (0-100)</li>
- * <li>percentage chance of variation of each position (0-100)</li>
- * </ul>
- *
* @author gmcarstairs
- *
*/
public class AlignmentGenerator
{
- @BeforeClass(alwaysRun = true)
- public void setUpJvOptionPane()
- {
- JvOptionPane.setInteractiveMode(false);
- JvOptionPane.setMockResponse(JvOptionPane.CANCEL_OPTION);
- }
-
private static final char GAP = '-';
private static final char ZERO = '0';
private Random random;
+ private PrintStream ps;
/**
- * Outputs a DNA 'alignment' where each position is a random choice from
- * 'GTCA-'.
+ * Outputs a pseudo-randomly generated nucleotide or peptide alignment
+ * Arguments:
+ * <ul>
+ * <li>n (for nucleotide) or p (for peptide)</li>
+ * <li>length (number of bases in each sequence)</li>
+ * <li>height (number of sequences)</li>
+ * <li>a whole number random seed</li>
+ * <li>percentage of gaps to include (0-100)</li>
+ * <li>percentage chance of variation of each position (0-100)</li>
+ * <li>(optional) path to a file to write the alignment to</li>
+ * </ul>
+ *
*
* @param args
+ * @throws FileNotFoundException
*/
- public static void main(String[] args)
+ public static void main(String[] args) throws FileNotFoundException
{
- if (args.length != 6)
+ if (args.length != 6 && args.length != 7)
{
usage();
return;
}
+
+ PrintStream ps = System.out;
+ if (args.length == 7)
+ {
+ ps = new PrintStream(new File(args[6]));
+ }
+
boolean nucleotide = args[0].toLowerCase().startsWith("n");
int width = Integer.parseInt(args[1]);
int height = Integer.parseInt(args[2]);
long randomSeed = Long.valueOf(args[3]);
int gapPercentage = Integer.valueOf(args[4]);
int changePercentage = Integer.valueOf(args[5]);
- AlignmentI al = new AlignmentGenerator(nucleotide).generate(width,
- height,
- randomSeed, gapPercentage, changePercentage);
- System.out.println("; " + height + " sequences of " + width
+ ps.println("; " + height + " sequences of " + width
+ " bases with " + gapPercentage + "% gaps and "
+ changePercentage + "% mutations (random seed = " + randomSeed
+ ")");
- System.out.println(new FastaFile().print(al.getSequencesArray(), true));
+
+ new AlignmentGenerator(nucleotide, ps).generate(width, height,
+ randomSeed, gapPercentage, changePercentage);
+
+ if (ps != System.out)
+ {
+ ps.close();
+ }
}
/**
- * Print parameter help.
+ * Prints parameter help
*/
private static void usage()
{
System.out.println("Usage:");
System.out.println("arg0: n (for nucleotide) or p (for peptide)");
System.out.println("arg1: number of (non-gap) bases per sequence");
- System.out.println("arg2: number sequences");
+ System.out.println("arg2: number of sequences");
System.out
.println("arg3: an integer as random seed (same seed = same results)");
System.out.println("arg4: percentage of gaps to (randomly) generate");
System.out
.println("arg5: percentage of 'mutations' to (randomly) generate");
+ System.out
+ .println("arg6: (optional) path to output file (default is sysout)");
System.out.println("Example: AlignmentGenerator n 12 15 387 10 5");
System.out
.println("- 15 nucleotide sequences of 12 bases each, approx 10% gaps and 5% mutations, random seed = 387");
}
/**
- * Constructor that sets nucleotide or peptide symbol set
+ * Constructor that sets nucleotide or peptide symbol set, and also writes the
+ * generated alignment to sysout
*/
public AlignmentGenerator(boolean nuc)
{
- BASES = nuc ? NUCS : PEPS;
+ this(nuc, System.out);
+ }
+
+ /**
+ * Constructor that sets nucleotide or peptide symbol set, and also writes the
+ * generated alignment to the specified output stream (if not null). This can
+ * be used to write the alignment to a file or sysout.
+ */
+ public AlignmentGenerator(boolean nucleotide, PrintStream printStream)
+ {
+ BASES = nucleotide ? NUCS : PEPS;
+ ps = printStream;
}
/**
- * Outputs a DNA 'alignment' of given width and height, where each position is
- * a random choice from 'GTCA-'.
+ * Outputs an 'alignment' of given width and height, where each position is a
+ * random choice from the symbol alphabet, or - for gap
*
* @param width
* @param height
seqno + 1, width, changePercentage);
}
AlignmentI al = new Alignment(seqs);
+
+ if (ps != null)
+ {
+ ps.println(new FastaFile().print(al.getSequencesArray(), true));
+ }
+
return al;
}
/*
* sort with no score features does nothing
*/
- PA.setValue(AlignmentSorter.class, "lastSortByFeatureScore", null);
+ PA.setValue(AlignmentSorter.class, "sortByFeatureCriteria", null);
- AlignmentSorter.sortByFeature((String) null, null, 0, al.getWidth(),
- al,
+ AlignmentSorter.sortByFeature(null, null, 0, al.getWidth(), al,
AlignmentSorter.FEATURE_SCORE);
assertSame(al.getSequenceAt(0), seq1);
assertSame(al.getSequenceAt(1), seq2);
* sort by ascending score, no filter on feature type or group
* NB sort order for the same feature set (none) gets toggled, so descending
*/
- PA.setValue(AlignmentSorter.class, "sortByFeatureScoreAscending", true);
- AlignmentSorter.sortByFeature((String) null, null, 0, al.getWidth(),
- al, AlignmentSorter.FEATURE_SCORE);
+ PA.setValue(AlignmentSorter.class, "sortByFeatureAscending", true);
+ AlignmentSorter.sortByFeature(null, null, 0, al.getWidth(), al,
+ AlignmentSorter.FEATURE_SCORE);
assertSame(al.getSequenceAt(3), seq3); // -0.5
assertSame(al.getSequenceAt(2), seq2); // 2.5
assertSame(al.getSequenceAt(1), seq1); // 3.0
/*
* repeat sort toggles order - now ascending
*/
- AlignmentSorter.sortByFeature((String) null, null, 0, al.getWidth(),
- al, AlignmentSorter.FEATURE_SCORE);
+ AlignmentSorter.sortByFeature(null, null, 0, al.getWidth(), al,
+ AlignmentSorter.FEATURE_SCORE);
assertSame(al.getSequenceAt(0), seq3); // -0.5
assertSame(al.getSequenceAt(1), seq2); // 2.5
assertSame(al.getSequenceAt(2), seq1); // 3.0
*/
// fails because seq1.findPosition(4) returns 4
// although residue 4 is in column 5! - JAL-2544
- AlignmentSorter.sortByFeature((String) null, null, 0, 4, al,
+ AlignmentSorter.sortByFeature(null, null, 0, 4, al,
AlignmentSorter.FEATURE_SCORE);
assertSame(al.getSequenceAt(0), seq3); // -4
assertSame(al.getSequenceAt(1), seq1); // 2.0
import jalview.datamodel.Sequence;
import jalview.datamodel.SequenceFeature;
import jalview.datamodel.SequenceI;
+import jalview.datamodel.features.SequenceFeatures;
import jalview.gui.JvOptionPane;
import jalview.io.AppletFormatAdapter;
import jalview.io.DataSourceType;
/*
* check cds2 acquired a variant feature in position 5
*/
- SequenceFeature[] sfs = cds2Dss.getSequenceFeatures();
+ List<SequenceFeature> sfs = cds2Dss.getSequenceFeatures();
assertNotNull(sfs);
- assertEquals(1, sfs.length);
- assertEquals("variant", sfs[0].type);
- assertEquals(5, sfs[0].begin);
- assertEquals(5, sfs[0].end);
+ assertEquals(1, sfs.size());
+ assertEquals("variant", sfs.get(0).type);
+ assertEquals(5, sfs.get(0).begin);
+ assertEquals(5, sfs.get(0).end);
}
/**
* that partially overlap 5' or 3' (start or end) of target sequence
*/
AlignmentUtils.transferFeatures(dna, cds, map, null);
- SequenceFeature[] sfs = cds.getSequenceFeatures();
- assertEquals(6, sfs.length);
+ List<SequenceFeature> sfs = cds.getSequenceFeatures();
+ assertEquals(6, sfs.size());
- SequenceFeature sf = sfs[0];
+ SequenceFeature sf = sfs.get(0);
assertEquals("type2", sf.getType());
assertEquals("desc2", sf.getDescription());
assertEquals(2f, sf.getScore());
assertEquals(1, sf.getBegin());
assertEquals(1, sf.getEnd());
- sf = sfs[1];
+ sf = sfs.get(1);
assertEquals("type3", sf.getType());
assertEquals("desc3", sf.getDescription());
assertEquals(3f, sf.getScore());
assertEquals(1, sf.getBegin());
assertEquals(3, sf.getEnd());
- sf = sfs[2];
+ sf = sfs.get(2);
assertEquals("type4", sf.getType());
assertEquals(2, sf.getBegin());
assertEquals(5, sf.getEnd());
- sf = sfs[3];
+ sf = sfs.get(3);
assertEquals("type5", sf.getType());
assertEquals(1, sf.getBegin());
assertEquals(6, sf.getEnd());
- sf = sfs[4];
+ sf = sfs.get(4);
assertEquals("type8", sf.getType());
assertEquals(6, sf.getBegin());
assertEquals(6, sf.getEnd());
- sf = sfs[5];
+ sf = sfs.get(5);
assertEquals("type9", sf.getType());
assertEquals(6, sf.getBegin());
assertEquals(6, sf.getEnd());
// desc4 and desc8 are the 'omit these' varargs
AlignmentUtils.transferFeatures(dna, cds, map, null, "type4", "type8");
- SequenceFeature[] sfs = cds.getSequenceFeatures();
- assertEquals(1, sfs.length);
+ List<SequenceFeature> sfs = cds.getSequenceFeatures();
+ assertEquals(1, sfs.size());
- SequenceFeature sf = sfs[0];
+ SequenceFeature sf = sfs.get(0);
assertEquals("type5", sf.getType());
assertEquals(1, sf.getBegin());
assertEquals(6, sf.getEnd());
// "type5" is the 'select this type' argument
AlignmentUtils.transferFeatures(dna, cds, map, "type5");
- SequenceFeature[] sfs = cds.getSequenceFeatures();
- assertEquals(1, sfs.length);
+ List<SequenceFeature> sfs = cds.getSequenceFeatures();
+ assertEquals(1, sfs.size());
- SequenceFeature sf = sfs[0];
+ SequenceFeature sf = sfs.get(0);
assertEquals("type5", sf.getType());
assertEquals(1, sf.getBegin());
assertEquals(6, sf.getEnd());
* var6 P -> H COSMIC
* var6 P -> R COSMIC
*/
- SequenceFeature[] sfs = peptide.getSequenceFeatures();
- assertEquals(5, sfs.length);
+ List<SequenceFeature> sfs = peptide.getSequenceFeatures();
+ SequenceFeatures.sortFeatures(sfs, true);
+ assertEquals(5, sfs.size());
- SequenceFeature sf = sfs[0];
+ /*
+ * features are sorted by start position ascending, but in no
+ * particular order where start positions match; asserts here
+ * simply match the data returned (the order is not important)
+ */
+ SequenceFeature sf = sfs.get(0);
assertEquals(1, sf.getBegin());
assertEquals(1, sf.getEnd());
- assertEquals("p.Lys1Glu", sf.getDescription());
- assertEquals("var1.125A>G", sf.getValue("ID"));
- assertNull(sf.getValue("clinical_significance"));
- assertEquals("ID=var1.125A>G", sf.getAttributes());
+ assertEquals("p.Lys1Asn", sf.getDescription());
+ assertEquals("var4", sf.getValue("ID"));
+ assertEquals("Benign", sf.getValue("clinical_significance"));
+ assertEquals("ID=var4;clinical_significance=Benign", sf.getAttributes());
assertEquals(1, sf.links.size());
- // link to variation is urlencoded
assertEquals(
- "p.Lys1Glu var1.125A>G|http://www.ensembl.org/Homo_sapiens/Variation/Summary?v=var1.125A%3EG",
+ "p.Lys1Asn var4|http://www.ensembl.org/Homo_sapiens/Variation/Summary?v=var4",
sf.links.get(0));
assertEquals(ensembl, sf.getFeatureGroup());
- sf = sfs[1];
+ sf = sfs.get(1);
assertEquals(1, sf.getBegin());
assertEquals(1, sf.getEnd());
assertEquals("p.Lys1Gln", sf.getDescription());
sf.links.get(0));
assertEquals(dbSnp, sf.getFeatureGroup());
- sf = sfs[2];
+ sf = sfs.get(2);
assertEquals(1, sf.getBegin());
assertEquals(1, sf.getEnd());
- assertEquals("p.Lys1Asn", sf.getDescription());
- assertEquals("var4", sf.getValue("ID"));
- assertEquals("Benign", sf.getValue("clinical_significance"));
- assertEquals("ID=var4;clinical_significance=Benign", sf.getAttributes());
+ assertEquals("p.Lys1Glu", sf.getDescription());
+ assertEquals("var1.125A>G", sf.getValue("ID"));
+ assertNull(sf.getValue("clinical_significance"));
+ assertEquals("ID=var1.125A>G", sf.getAttributes());
assertEquals(1, sf.links.size());
+ // link to variation is urlencoded
assertEquals(
- "p.Lys1Asn var4|http://www.ensembl.org/Homo_sapiens/Variation/Summary?v=var4",
+ "p.Lys1Glu var1.125A>G|http://www.ensembl.org/Homo_sapiens/Variation/Summary?v=var1.125A%3EG",
sf.links.get(0));
assertEquals(ensembl, sf.getFeatureGroup());
- // var5 generates two distinct protein variant features
- sf = sfs[3];
+ sf = sfs.get(3);
assertEquals(3, sf.getBegin());
assertEquals(3, sf.getEnd());
- assertEquals("p.Pro3His", sf.getDescription());
+ assertEquals("p.Pro3Arg", sf.getDescription());
assertEquals("var6", sf.getValue("ID"));
assertEquals("Good", sf.getValue("clinical_significance"));
assertEquals("ID=var6;clinical_significance=Good", sf.getAttributes());
assertEquals(1, sf.links.size());
assertEquals(
- "p.Pro3His var6|http://www.ensembl.org/Homo_sapiens/Variation/Summary?v=var6",
+ "p.Pro3Arg var6|http://www.ensembl.org/Homo_sapiens/Variation/Summary?v=var6",
sf.links.get(0));
assertEquals(cosmic, sf.getFeatureGroup());
- sf = sfs[4];
+ // var5 generates two distinct protein variant features
+ sf = sfs.get(4);
assertEquals(3, sf.getBegin());
assertEquals(3, sf.getEnd());
- assertEquals("p.Pro3Arg", sf.getDescription());
+ assertEquals("p.Pro3His", sf.getDescription());
assertEquals("var6", sf.getValue("ID"));
assertEquals("Good", sf.getValue("clinical_significance"));
assertEquals("ID=var6;clinical_significance=Good", sf.getAttributes());
assertEquals(1, sf.links.size());
assertEquals(
- "p.Pro3Arg var6|http://www.ensembl.org/Homo_sapiens/Variation/Summary?v=var6",
+ "p.Pro3His var6|http://www.ensembl.org/Homo_sapiens/Variation/Summary?v=var6",
sf.links.get(0));
assertEquals(cosmic, sf.getFeatureGroup());
}
assertEquals(s_as3, uas3.getSequenceAsString());
}
+ /**
+ * Tests for the method that maps nucleotide to protein based on CDS features
+ */
+ @Test(groups = "Functional")
+ public void testMapCdsToProtein()
+ {
+ SequenceI peptide = new Sequence("pep", "KLQ");
+
+ /*
+ * Case 1: CDS 3 times length of peptide
+ * NB method only checks lengths match, not translation
+ */
+ SequenceI dna = new Sequence("dna", "AACGacgtCTCCT");
+ dna.createDatasetSequence();
+ dna.addSequenceFeature(new SequenceFeature("CDS", "", 1, 4, null));
+ dna.addSequenceFeature(new SequenceFeature("CDS", "", 9, 13, null));
+ MapList ml = AlignmentUtils.mapCdsToProtein(dna, peptide);
+ assertEquals(3, ml.getFromRatio());
+ assertEquals(1, ml.getToRatio());
+ assertEquals("[[1, 3]]",
+ Arrays.deepToString(ml.getToRanges().toArray()));
+ assertEquals("[[1, 4], [9, 13]]",
+ Arrays.deepToString(ml.getFromRanges().toArray()));
+
+ /*
+ * Case 2: CDS 3 times length of peptide + stop codon
+ * (note code does not currently check trailing codon is a stop codon)
+ */
+ dna = new Sequence("dna", "AACGacgtCTCCTTGA");
+ dna.createDatasetSequence();
+ dna.addSequenceFeature(new SequenceFeature("CDS", "", 1, 4, null));
+ dna.addSequenceFeature(new SequenceFeature("CDS", "", 9, 16, null));
+ ml = AlignmentUtils.mapCdsToProtein(dna, peptide);
+ assertEquals(3, ml.getFromRatio());
+ assertEquals(1, ml.getToRatio());
+ assertEquals("[[1, 3]]",
+ Arrays.deepToString(ml.getToRanges().toArray()));
+ assertEquals("[[1, 4], [9, 13]]",
+ Arrays.deepToString(ml.getFromRanges().toArray()));
+
+ /*
+ * Case 3: CDS not 3 times length of peptide - no mapping is made
+ */
+ dna = new Sequence("dna", "AACGacgtCTCCTTG");
+ dna.createDatasetSequence();
+ dna.addSequenceFeature(new SequenceFeature("CDS", "", 1, 4, null));
+ dna.addSequenceFeature(new SequenceFeature("CDS", "", 9, 15, null));
+ ml = AlignmentUtils.mapCdsToProtein(dna, peptide);
+ assertNull(ml);
+
+ /*
+ * Case 4: incomplete start codon corresponding to X in peptide
+ */
+ dna = new Sequence("dna", "ACGacgtCTCCTTGG");
+ dna.createDatasetSequence();
+ SequenceFeature sf = new SequenceFeature("CDS", "", 1, 3, null);
+ sf.setPhase("2"); // skip 2 positions (AC) to start of next codon (GCT)
+ dna.addSequenceFeature(sf);
+ dna.addSequenceFeature(new SequenceFeature("CDS", "", 8, 15, null));
+ peptide = new Sequence("pep", "XLQ");
+ ml = AlignmentUtils.mapCdsToProtein(dna, peptide);
+ assertEquals("[[2, 3]]",
+ Arrays.deepToString(ml.getToRanges().toArray()));
+ assertEquals("[[3, 3], [8, 12]]",
+ Arrays.deepToString(ml.getFromRanges().toArray()));
+ }
+
}
import static org.testng.AssertJUnit.fail;
import jalview.analysis.SecStrConsensus.SimpleBP;
+import jalview.datamodel.SequenceFeature;
import jalview.gui.JvOptionPane;
-import java.util.Vector;
+import java.util.List;
import org.testng.annotations.BeforeClass;
import org.testng.annotations.Test;
public void testGetSimpleBPs() throws WUSSParseException
{
String rna = "([{})]"; // JAL-1081 example
- Vector<SimpleBP> bps = Rna.getSimpleBPs(rna);
+ List<SimpleBP> bps = Rna.getSimpleBPs(rna);
assertEquals(3, bps.size());
/*
.valueOf((char) i) + " "));
}
}
+
+ @Test(groups = "Functional")
+ public void testGetHelixMap_oneHelix() throws WUSSParseException
+ {
+ String rna = ".(..[{.<..>}..].)";
+ SequenceFeature[] sfs = Rna.getHelixMap(rna);
+ assertEquals(4, sfs.length);
+
+ /*
+ * pairs are added in the order in which the closing bracket is found
+ * (see testGetSimpleBPs)
+ */
+ assertEquals(7, sfs[0].getBegin());
+ assertEquals(10, sfs[0].getEnd());
+ assertEquals("0", sfs[0].getFeatureGroup());
+ assertEquals(5, sfs[1].getBegin());
+ assertEquals(11, sfs[1].getEnd());
+ assertEquals("0", sfs[1].getFeatureGroup());
+ assertEquals(4, sfs[2].getBegin());
+ assertEquals(14, sfs[2].getEnd());
+ assertEquals("0", sfs[2].getFeatureGroup());
+ assertEquals(1, sfs[3].getBegin());
+ assertEquals(16, sfs[3].getEnd());
+ assertEquals("0", sfs[3].getFeatureGroup());
+ }
+
+ @Test(groups = "Functional")
+ public void testGetHelixMap_twoHelices() throws WUSSParseException
+ {
+ String rna = ".([.)]..{.<}.>";
+ SequenceFeature[] sfs = Rna.getHelixMap(rna);
+ assertEquals(4, sfs.length);
+
+ /*
+ * pairs are added in the order in which the closing bracket is found
+ * (see testGetSimpleBPs)
+ */
+ assertEquals(1, sfs[0].getBegin());
+ assertEquals(4, sfs[0].getEnd());
+ assertEquals("0", sfs[0].getFeatureGroup());
+ assertEquals(2, sfs[1].getBegin());
+ assertEquals(5, sfs[1].getEnd());
+ assertEquals("0", sfs[1].getFeatureGroup());
+ assertEquals(8, sfs[2].getBegin());
+ assertEquals(11, sfs[2].getEnd());
+ assertEquals("1", sfs[2].getFeatureGroup());
+ assertEquals(10, sfs[3].getBegin());
+ assertEquals(13, sfs[3].getEnd());
+ assertEquals("1", sfs[3].getFeatureGroup());
+ }
}
AlignmentI al = new Alignment(sqset);
al.setDataset(null);
AlignmentI ds = al.getDataset();
- SequenceFeature sf1 = new SequenceFeature("f1", "foo", "bleh", 2, 3,
- "far"), sf2 = new SequenceFeature("f2", "foo", "bleh", 2, 3,
- "far");
+ SequenceFeature sf1 = new SequenceFeature("f1", "foo", 2, 3, "far");
+ SequenceFeature sf2 = new SequenceFeature("f2", "foo", 2, 3, "far");
ds.getSequenceAt(0).addSequenceFeature(sf1);
Hashtable unq = SeqsetUtils.uniquify(sqset, true);
SequenceI[] sqset2 = new SequenceI[] {
new Sequence(sqset[0].getName(), sqset[0].getSequenceAsString()),
new Sequence(sqset[1].getName(), sqset[1].getSequenceAsString()) };
- Assert.assertTrue(sqset[0].getSequenceFeatures()[0] == sf1);
- Assert.assertEquals(sqset2[0].getSequenceFeatures(), null);
+ Assert.assertSame(sqset[0].getSequenceFeatures().get(0), sf1);
+ Assert.assertTrue(sqset2[0].getSequenceFeatures().isEmpty());
ds.getSequenceAt(0).addSequenceFeature(sf2);
- Assert.assertEquals(sqset[0].getSequenceFeatures().length, 2);
+ Assert.assertEquals(sqset[0].getSequenceFeatures().size(), 2);
SeqsetUtils.deuniquify(unq, sqset2);
// explicitly test that original sequence features still exist because they
// are on the shared dataset sequence
- Assert.assertEquals(sqset[0].getSequenceFeatures().length, 2);
- Assert.assertEquals(sqset2[0].getSequenceFeatures().length, 2);
- Assert.assertTrue(sqset[0].getSequenceFeatures()[0] == sqset2[0]
- .getSequenceFeatures()[0]);
- Assert.assertTrue(sqset[0].getSequenceFeatures()[1] == sqset2[0]
- .getSequenceFeatures()[1]);
+ Assert.assertEquals(sqset[0].getSequenceFeatures().size(), 2);
+ Assert.assertEquals(sqset2[0].getSequenceFeatures().size(), 2);
+ Assert.assertSame(sqset[0].getSequenceFeatures().get(0), sqset2[0]
+ .getSequenceFeatures().get(0));
+ Assert.assertSame(sqset[0].getSequenceFeatures().get(1), sqset2[0]
+ .getSequenceFeatures().get(1));
}
}
s2 = new Sequence("Seq2", "ASDFA");
s2.setStart(5);
s2.setEnd(9);
- s3 = new Sequence("Seq1", "SDFAQQQSSS");
+ s3 = new Sequence("Seq3", "SDFAQQQSSS");
}
};
as.printAlignment(ps);
- String expected = "Score = 320.0\nLength of alignment = 10\nSequence Seq1 : 3 - 18 (Sequence length = 14)\nSequence Seq1 : 1 - 10 (Sequence length = 10)\n\n"
- + "Seq1 SDFAQQQRRR\n"
- + " ||||||| \n"
- + "Seq1 SDFAQQQSSS\n\n" + "Percentage ID = 70.00\n";
+ String expected = "Score = 320.0\nLength of alignment = 10\nSequence Seq1/4-13 (Sequence length = 14)\nSequence Seq3/1-10 (Sequence length = 10)\n\n"
+ + "Seq1/4-13 SDFAQQQRRR\n"
+ + " ||||||| \n"
+ + "Seq3/1-10 SDFAQQQSSS\n\n" + "Percentage ID = 70.00\n\n";
assertEquals(expected, baos.toString());
}
}
import static org.testng.Assert.assertEquals;
import static org.testng.Assert.assertTrue;
+import jalview.api.analysis.ScoreModelI;
import jalview.api.analysis.SimilarityParamsI;
import jalview.datamodel.Alignment;
import jalview.datamodel.AlignmentI;
SequenceI ds = al.getSequenceAt(i).getDatasetSequence();
if (sf1[i * 2] > 0)
{
- ds.addSequenceFeature(new SequenceFeature("sf1", "sf1", "sf1",
- sf1[i * 2], sf1[i * 2 + 1], "sf1"));
+ ds.addSequenceFeature(new SequenceFeature("sf1", "sf1", sf1[i * 2],
+ sf1[i * 2 + 1], "sf1"));
}
if (sf2[i * 2] > 0)
{
- ds.addSequenceFeature(new SequenceFeature("sf2", "sf2", "sf2",
- sf2[i * 2], sf2[i * 2 + 1], "sf2"));
+ ds.addSequenceFeature(new SequenceFeature("sf2", "sf2", sf2[i * 2],
+ sf2[i * 2 + 1], "sf2"));
}
if (sf3[i * 2] > 0)
{
- ds.addSequenceFeature(new SequenceFeature("sf3", "sf3", "sf3",
- sf3[i * 2], sf3[i * 2 + 1], "sf3"));
+ ds.addSequenceFeature(new SequenceFeature("sf3", "sf3", sf3[i * 2],
+ sf3[i * 2 + 1], "sf3"));
}
}
alf.setShowSeqFeatures(true);
public void testFeatureScoreModel() throws Exception
{
AlignFrame alf = getTestAlignmentFrame();
- FeatureDistanceModel fsm = new FeatureDistanceModel();
- assertTrue(fsm.configureFromAlignmentView(alf.getCurrentView()
- .getAlignPanel()));
+ ScoreModelI sm = new FeatureDistanceModel();
+ sm = ScoreModels.getInstance().getScoreModel(sm.getName(),
+ alf.getCurrentView().getAlignPanel());
alf.selectAllSequenceMenuItem_actionPerformed(null);
- MatrixI dm = fsm.findDistances(
+ MatrixI dm = sm.findDistances(
alf.getViewport().getAlignmentView(true),
SimilarityParams.Jalview);
assertEquals(dm.getValue(0, 2), 0d,
AlignFrame alf = getTestAlignmentFrame();
// hiding first two columns shouldn't affect the tree
alf.getViewport().hideColumns(0, 1);
- FeatureDistanceModel fsm = new FeatureDistanceModel();
- assertTrue(fsm.configureFromAlignmentView(alf.getCurrentView()
- .getAlignPanel()));
+ ScoreModelI sm = new FeatureDistanceModel();
+ sm = ScoreModels.getInstance().getScoreModel(sm.getName(),
+ alf.getCurrentView().getAlignPanel());
alf.selectAllSequenceMenuItem_actionPerformed(null);
- MatrixI dm = fsm.findDistances(
+ MatrixI dm = sm.findDistances(
alf.getViewport().getAlignmentView(true),
SimilarityParams.Jalview);
assertEquals(dm.getValue(0, 2), 0d,
// hide columns and check tree changes
alf.getViewport().hideColumns(3, 4);
alf.getViewport().hideColumns(0, 1);
- FeatureDistanceModel fsm = new FeatureDistanceModel();
- assertTrue(fsm.configureFromAlignmentView(alf.getCurrentView()
- .getAlignPanel()));
+ // getName() can become static in Java 8
+ ScoreModelI sm = new FeatureDistanceModel();
+ sm = ScoreModels.getInstance().getScoreModel(sm.getName(),
+ alf.getCurrentView().getAlignPanel());
alf.selectAllSequenceMenuItem_actionPerformed(null);
- MatrixI dm = fsm.findDistances(
+ MatrixI dm = sm.findDistances(
alf.getViewport().getAlignmentView(true),
SimilarityParams.Jalview);
assertEquals(
Assert.assertEquals(af.getFeatureRenderer().getDisplayedFeatureTypes()
.size(), 1, "Should be just one feature type displayed");
// step through and check for pointwise feature presence/absence
- Assert.assertEquals(af.getFeatureRenderer().findFeaturesAtRes(aseq, 1)
+ Assert.assertEquals(af.getFeatureRenderer().findFeaturesAtColumn(aseq, 1)
.size(), 0);
// step through and check for pointwise feature presence/absence
- Assert.assertEquals(af.getFeatureRenderer().findFeaturesAtRes(aseq, 2)
+ Assert.assertEquals(af.getFeatureRenderer().findFeaturesAtColumn(aseq, 2)
.size(), 1);
// step through and check for pointwise feature presence/absence
- Assert.assertEquals(af.getFeatureRenderer().findFeaturesAtRes(aseq, 3)
+ Assert.assertEquals(af.getFeatureRenderer().findFeaturesAtColumn(aseq, 3)
.size(), 0);
// step through and check for pointwise feature presence/absence
- Assert.assertEquals(af.getFeatureRenderer().findFeaturesAtRes(aseq, 4)
+ Assert.assertEquals(af.getFeatureRenderer().findFeaturesAtColumn(aseq, 4)
.size(), 0);
// step through and check for pointwise feature presence/absence
- Assert.assertEquals(af.getFeatureRenderer().findFeaturesAtRes(aseq, 5)
+ Assert.assertEquals(af.getFeatureRenderer().findFeaturesAtColumn(aseq, 5)
.size(), 1);
// step through and check for pointwise feature presence/absence
- Assert.assertEquals(af.getFeatureRenderer().findFeaturesAtRes(aseq, 6)
+ Assert.assertEquals(af.getFeatureRenderer().findFeaturesAtColumn(aseq, 6)
.size(), 0);
}
alf.setShowSeqFeatures(true);
alf.getFeatureRenderer().findAllFeatures(true);
- FeatureDistanceModel fsm = new FeatureDistanceModel();
- assertTrue(fsm.configureFromAlignmentView(alf.getCurrentView()
- .getAlignPanel()));
+ ScoreModelI sm = new FeatureDistanceModel();
+ sm = ScoreModels.getInstance().getScoreModel(sm.getName(),
+ alf.getCurrentView().getAlignPanel());
alf.selectAllSequenceMenuItem_actionPerformed(null);
- MatrixI distances = fsm.findDistances(alf.getViewport()
- .getAlignmentView(true), SimilarityParams.Jalview);
+ AlignmentView alignmentView = alf.getViewport()
+ .getAlignmentView(true);
+ MatrixI distances = sm.findDistances(alignmentView,
+ SimilarityParams.Jalview);
assertEquals(distances.width(), 2);
assertEquals(distances.height(), 2);
assertEquals(distances.getValue(0, 0), 0d);
AlignViewport viewport = af.getViewport();
AlignmentView view = viewport.getAlignmentView(false);
- FeatureDistanceModel sm = new FeatureDistanceModel();
- sm.configureFromAlignmentView(af.alignPanel);
-
+ ScoreModelI sm = new FeatureDistanceModel();
+ sm = ScoreModels.getInstance().getScoreModel(sm.getName(),
+ af.alignPanel);
+
/*
* feature distance model always normalises by region width
* gap-gap is always included (but scores zero)
package jalview.commands;
import static org.testng.AssertJUnit.assertEquals;
+import static org.testng.AssertJUnit.assertNull;
import static org.testng.AssertJUnit.assertSame;
import jalview.commands.EditCommand.Action;
import jalview.datamodel.Alignment;
import jalview.datamodel.AlignmentI;
import jalview.datamodel.Sequence;
+import jalview.datamodel.SequenceFeature;
import jalview.datamodel.SequenceI;
+import jalview.datamodel.features.SequenceFeatures;
import jalview.gui.JvOptionPane;
+import java.util.List;
import java.util.Map;
+import org.testng.Assert;
import org.testng.annotations.BeforeClass;
import org.testng.annotations.BeforeMethod;
import org.testng.annotations.Test;
*/
public class EditCommandTest
{
+ /*
+ * compute n(n+1)/2 e.g.
+ * func(5) = 5 + 4 + 3 + 2 + 1 = 15
+ */
+ private static int func(int i)
+ {
+ return i * (i + 1) / 2;
+ }
@BeforeClass(alwaysRun = true)
public void setUpJvOptionPane()
assertEquals(ds2, unwound.get(ds2).getDatasetSequence());
assertEquals(ds3, unwound.get(ds3).getDatasetSequence());
}
+
+ /**
+ * Test a cut action's relocation of sequence features
+ */
+ @Test(groups = { "Functional" })
+ public void testCut_withFeatures()
+ {
+ /*
+ * create sequence features before, after and overlapping
+ * a cut of columns/residues 4-7
+ */
+ SequenceI seq0 = seqs[0];
+ seq0.addSequenceFeature(new SequenceFeature("before", "", 1, 3, 0f,
+ null));
+ seq0.addSequenceFeature(new SequenceFeature("overlap left", "", 2, 6,
+ 0f, null));
+ seq0.addSequenceFeature(new SequenceFeature("internal", "", 5, 6, 0f,
+ null));
+ seq0.addSequenceFeature(new SequenceFeature("overlap right", "", 7, 8,
+ 0f, null));
+ seq0.addSequenceFeature(new SequenceFeature("after", "", 8, 10, 0f,
+ null));
+
+ Edit ec = testee.new Edit(Action.CUT, seqs, 3, 4, al); // cols 3-6 base 0
+ EditCommand.cut(ec, new AlignmentI[] { al });
+
+ List<SequenceFeature> sfs = seq0.getSequenceFeatures();
+ SequenceFeatures.sortFeatures(sfs, true);
+
+ assertEquals(4, sfs.size()); // feature internal to cut has been deleted
+ SequenceFeature sf = sfs.get(0);
+ assertEquals("before", sf.getType());
+ assertEquals(1, sf.getBegin());
+ assertEquals(3, sf.getEnd());
+ sf = sfs.get(1);
+ assertEquals("overlap left", sf.getType());
+ assertEquals(2, sf.getBegin());
+ assertEquals(3, sf.getEnd()); // truncated by cut
+ sf = sfs.get(2);
+ assertEquals("overlap right", sf.getType());
+ assertEquals(4, sf.getBegin()); // shifted left by cut
+ assertEquals(5, sf.getEnd()); // truncated by cut
+ sf = sfs.get(3);
+ assertEquals("after", sf.getType());
+ assertEquals(4, sf.getBegin()); // shifted left by cut
+ assertEquals(6, sf.getEnd()); // shifted left by cut
+ }
+
+ /**
+ * Test a cut action's relocation of sequence features, with full coverage of
+ * all possible feature and cut locations for a 5-position ungapped sequence
+ */
+ @Test(groups = { "Functional" })
+ public void testCut_withFeatures_exhaustive()
+ {
+ /*
+ * create a sequence features on each subrange of 1-5
+ */
+ SequenceI seq0 = new Sequence("seq", "ABCDE");
+ AlignmentI alignment = new Alignment(new SequenceI[] { seq0 });
+ alignment.setDataset(null);
+ for (int from = 1; from <= seq0.getLength(); from++)
+ {
+ for (int to = from; to <= seq0.getLength(); to++)
+ {
+ String desc = String.format("%d-%d", from, to);
+ SequenceFeature sf = new SequenceFeature("test", desc, from, to,
+ 0f,
+ null);
+ sf.setValue("from", Integer.valueOf(from));
+ sf.setValue("to", Integer.valueOf(to));
+ seq0.addSequenceFeature(sf);
+ }
+ }
+ // sanity check
+ List<SequenceFeature> sfs = seq0.getSequenceFeatures();
+ assertEquals(func(5), sfs.size());
+
+ /*
+ * now perform all possible cuts of subranges of 1-5 (followed by Undo)
+ * and validate the resulting remaining sequence features!
+ */
+ SequenceI[] sqs = new SequenceI[] { seq0 };
+
+ // goal is to have this passing for all from/to values!!
+ // for (int from = 0; from < seq0.getLength(); from++)
+ // {
+ // for (int to = from; to < seq0.getLength(); to++)
+ for (int from = 1; from < 3; from++)
+ {
+ for (int to = 2; to < 3; to++)
+ {
+ testee.appendEdit(Action.CUT, sqs, from, (to - from + 1),
+ alignment, true);
+
+ sfs = seq0.getSequenceFeatures();
+
+ /*
+ * confirm the number of features has reduced by the
+ * number of features within the cut region i.e. by
+ * func(length of cut)
+ */
+ String msg = String.format("Cut %d-%d ", from, to);
+ if (to - from == 4)
+ {
+ // all columns cut
+ assertNull(sfs);
+ }
+ else
+ {
+ assertEquals(msg + "wrong number of features left", func(5)
+ - func(to - from + 1), sfs.size());
+ }
+
+ /*
+ * inspect individual features
+ */
+ if (sfs != null)
+ {
+ for (SequenceFeature sf : sfs)
+ {
+ checkFeatureRelocation(sf, from + 1, to + 1);
+ }
+ }
+ /*
+ * undo ready for next cut
+ */
+ testee.undoCommand(new AlignmentI[] { alignment });
+ assertEquals(func(5), seq0.getSequenceFeatures().size());
+ }
+ }
+ }
+
+ /**
+ * Helper method to check a feature has been correctly relocated after a cut
+ *
+ * @param sf
+ * @param from
+ * start of cut (first residue cut)
+ * @param to
+ * end of cut (last residue cut)
+ */
+ private void checkFeatureRelocation(SequenceFeature sf, int from, int to)
+ {
+ // TODO handle the gapped sequence case as well
+ int cutSize = to - from + 1;
+ int oldFrom = ((Integer) sf.getValue("from")).intValue();
+ int oldTo = ((Integer) sf.getValue("to")).intValue();
+
+ String msg = String.format(
+ "Feature %s relocated to %d-%d after cut of %d-%d",
+ sf.getDescription(), sf.getBegin(), sf.getEnd(), from, to);
+ if (oldTo < from)
+ {
+ // before cut region so unchanged
+ assertEquals("1: " + msg, oldFrom, sf.getBegin());
+ assertEquals("2: " + msg, oldTo, sf.getEnd());
+ }
+ else if (oldFrom > to)
+ {
+ // follows cut region - shift by size of cut
+ assertEquals("3: " + msg, oldFrom - cutSize, sf.getBegin());
+ assertEquals("4: " + msg, oldTo - cutSize, sf.getEnd());
+ }
+ else if (oldFrom < from && oldTo > to)
+ {
+ // feature encloses cut region - shrink it right
+ assertEquals("5: " + msg, oldFrom, sf.getBegin());
+ assertEquals("6: " + msg, oldTo - cutSize, sf.getEnd());
+ }
+ else if (oldFrom < from)
+ {
+ // feature overlaps left side of cut region - truncated right
+ assertEquals("7: " + msg, from - 1, sf.getEnd());
+ }
+ else if (oldTo > to)
+ {
+ // feature overlaps right side of cut region - truncated left
+ assertEquals("8: " + msg, from, sf.getBegin());
+ assertEquals("9: " + msg, from + oldTo - to - 1, sf.getEnd());
+ }
+ else
+ {
+ // feature internal to cut - should have been deleted!
+ Assert.fail(msg + " - should have been deleted");
+ }
+ }
+
+ /**
+ * Test a cut action's relocation of sequence features
+ */
+ @Test(groups = { "Functional" })
+ public void testCut_gappedWithFeatures()
+ {
+ /*
+ * create sequence features before, after and overlapping
+ * a cut of columns/residues 4-7
+ */
+ SequenceI seq0 = new Sequence("seq", "A-BCC");
+ seq0.addSequenceFeature(new SequenceFeature("", "", 3, 4, 0f,
+ null));
+ AlignmentI alignment = new Alignment(new SequenceI[] { seq0 });
+ // cut columns of A-B
+ Edit ec = testee.new Edit(Action.CUT, seqs, 0, 3, alignment); // cols 0-3
+ // base 0
+ EditCommand.cut(ec, new AlignmentI[] { alignment });
+
+ /*
+ * feature on CC(3-4) should now be on CC(1-2)
+ */
+ List<SequenceFeature> sfs = seq0.getSequenceFeatures();
+ assertEquals(1, sfs.size());
+ SequenceFeature sf = sfs.get(0);
+ assertEquals(1, sf.getBegin());
+ assertEquals(2, sf.getEnd());
+
+ // TODO add further cases including Undo - see JAL-2541
+ }
}
AlignmentI alignment = new Alignment(new SequenceI[] { seq });
alignment.setDataset(alignment);
}
+
+ @Test(groups = "Functional")
+ public void testAppend()
+ {
+ SequenceI seq = new Sequence("seq1", "FRMLPSRT-A--L-");
+ AlignmentI alignment = new Alignment(new SequenceI[] { seq });
+ alignment.setGapCharacter('-');
+ SequenceI seq2 = new Sequence("seq1", "KP..L.FQII.");
+ AlignmentI alignment2 = new Alignment(new SequenceI[] { seq2 });
+ alignment2.setGapCharacter('.');
+
+ alignment.append(alignment2);
+
+ assertEquals('-', alignment.getGapCharacter());
+ assertSame(seq, alignment.getSequenceAt(0));
+ assertEquals("KP--L-FQII-", alignment.getSequenceAt(1)
+ .getSequenceAsString());
+
+ // todo test coverage for annotations, mappings, groups,
+ // hidden sequences, properties
+ }
}
--- /dev/null
+/*
+ * Jalview - A Sequence Alignment Editor and Viewer ($$Version-Rel$$)
+ * Copyright (C) $$Year-Rel$$ The Jalview Authors
+ *
+ * This file is part of Jalview.
+ *
+ * Jalview is free software: you can redistribute it and/or
+ * modify it under the terms of the GNU General Public License
+ * as published by the Free Software Foundation, either version 3
+ * of the License, or (at your option) any later version.
+ *
+ * Jalview is distributed in the hope that it will be useful, but
+ * WITHOUT ANY WARRANTY; without even the implied warranty
+ * of MERCHANTABILITY or FITNESS FOR A PARTICULAR
+ * PURPOSE. See the GNU General Public License for more details.
+ *
+ * You should have received a copy of the GNU General Public License
+ * along with Jalview. If not, see <http://www.gnu.org/licenses/>.
+ * The Jalview Authors are detailed in the 'AUTHORS' file.
+ */
+package jalview.datamodel;
+
+import static org.testng.Assert.assertEquals;
+
+import jalview.gui.JvOptionPane;
+
+import org.testng.annotations.BeforeClass;
+import org.testng.annotations.Test;
+
+public class CigarArrayTest
+{
+ @BeforeClass(alwaysRun = true)
+ public void setUpJvOptionPane()
+ {
+ JvOptionPane.setInteractiveMode(false);
+ JvOptionPane.setMockResponse(JvOptionPane.CANCEL_OPTION);
+ }
+
+ @Test(groups = "Functional")
+ public void testConstructor()
+ {
+ SequenceI seq1 = new Sequence("sq1",
+ "ASFDDABACBACBACBACBACBACBABCABCBACBABCAB");
+ Sequence seq2 = new Sequence("sq2",
+ "TTTTTTACBCBABCABCABCABCBACBACBABCABCABCBA");
+
+ // construct alignment
+ AlignmentI al = new Alignment(new SequenceI[] { seq1, seq2 });
+
+ // hide columns
+ HiddenColumns hc = new HiddenColumns();
+ hc.hideColumns(3, 6);
+ hc.hideColumns(16, 20);
+
+ // select group
+ SequenceGroup sg1 = new SequenceGroup();
+ sg1.addSequence(seq1, false);
+ sg1.setStartRes(2);
+ sg1.setEndRes(23);
+
+ // Cigar array meanings:
+ // M = match
+ // D = deletion
+ // I = insertion
+ // number preceding M/D/I is the number of residues which
+ // match/are deleted/are inserted
+ // In the CigarArray constructor only matches or deletions are created, as
+ // we are comparing a sequence to its own subsequence (the group) + hidden
+ // columns.
+
+ // no hidden columns case
+ CigarArray cig = new CigarArray(al, null, sg1);
+ String result = cig.getCigarstring();
+ assertEquals(result, "22M");
+
+ cig = new CigarArray(al, hc, sg1);
+ result = cig.getCigarstring();
+ assertEquals(result, "1M4D9M5D3M");
+
+ // group starts at hidden cols
+ sg1.setStartRes(3);
+ cig = new CigarArray(al, hc, sg1);
+ result = cig.getCigarstring();
+ assertEquals(result, "4D9M5D3M");
+
+ // group starts at last but 1 hidden col
+ sg1.setStartRes(5);
+ cig = new CigarArray(al, hc, sg1);
+ result = cig.getCigarstring();
+ assertEquals(result, "2D9M5D3M");
+
+ // group starts at last hidden col
+ sg1.setStartRes(6);
+ cig = new CigarArray(al, hc, sg1);
+ result = cig.getCigarstring();
+ assertEquals(result, "1D9M5D3M");
+
+ // group starts just after hidden region
+ sg1.setStartRes(7);
+ cig = new CigarArray(al, hc, sg1);
+ result = cig.getCigarstring();
+ assertEquals(result, "9M5D3M");
+
+ // group ends just before start of hidden region
+ sg1.setStartRes(5);
+ sg1.setEndRes(15);
+ cig = new CigarArray(al, hc, sg1);
+ result = cig.getCigarstring();
+ assertEquals(result, "2D9M");
+
+ // group ends at start of hidden region
+ sg1.setEndRes(16);
+ cig = new CigarArray(al, hc, sg1);
+ result = cig.getCigarstring();
+ assertEquals(result, "2D9M1D");
+
+ // group ends 1 after start of hidden region
+ sg1.setEndRes(17);
+ cig = new CigarArray(al, hc, sg1);
+ result = cig.getCigarstring();
+ assertEquals(result, "2D9M2D");
+
+ // group ends at end of hidden region
+ sg1.setEndRes(20);
+ cig = new CigarArray(al, hc, sg1);
+ result = cig.getCigarstring();
+ assertEquals(result, "2D9M5D");
+
+ // group ends just after end of hidden region
+ sg1.setEndRes(21);
+ cig = new CigarArray(al, hc, sg1);
+ result = cig.getCigarstring();
+ assertEquals(result, "2D9M5D1M");
+
+ // group ends 2 after end of hidden region
+ sg1.setEndRes(22);
+ cig = new CigarArray(al, hc, sg1);
+ result = cig.getCigarstring();
+ assertEquals(result, "2D9M5D2M");
+ }
+}
/*
* TODO: can we add assertions to the sysouts that follow?
*/
- System.out.println("Original sequence align:\n" + sub_gapped_s
+ System.out.println("\nOriginal sequence align:\n" + sub_gapped_s
+ "\nReconstructed window from 8 to 48\n" + "XXXXXXXX"
+ sub_se_gp.getSequenceString('-') + "..." + "\nCigar String:"
+ sub_se_gp.getCigarstring() + "\n");
SequenceI gen_sgapped_s = gen_sgapped.getSeq('-');
// assertEquals("Couldn't reconstruct sequence", s_gapped.getSequence(),
// gen_sgapped_s);
- if (!gen_sgapped_s.getSequence().equals(s_gapped.getSequence()))
+ if (!gen_sgapped_s.getSequenceAsString().equals(
+ s_gapped.getSequenceAsString()))
{
// TODO: investigate errors reported here, to allow full conversion to
// passing JUnit assertion form
}
@Test(groups = { "Functional" })
- public void testCopyConstructor()
+ public void testCopyConstructors()
{
SequenceFeature sf1 = new SequenceFeature("type", "desc", 22, 33,
12.5f, "group");
assertEquals("desc", sf2.getDescription());
assertEquals(22, sf2.getBegin());
assertEquals(33, sf2.getEnd());
+ assertEquals(12.5f, sf2.getScore());
assertEquals("+", sf2.getValue("STRAND"));
assertEquals("Testing", sf2.getValue("Note"));
// shallow clone of otherDetails map - contains the same object values!
assertSame(count, sf2.getValue("Count"));
+
+ /*
+ * copy constructor modifying begin/end/group/score
+ */
+ SequenceFeature sf3 = new SequenceFeature(sf1, 11, 14, "group2", 17.4f);
+ assertEquals("type", sf3.getType());
+ assertEquals("desc", sf3.getDescription());
+ assertEquals(11, sf3.getBegin());
+ assertEquals(14, sf3.getEnd());
+ assertEquals(17.4f, sf3.getScore());
+ assertEquals("+", sf3.getValue("STRAND"));
+ assertEquals("Testing", sf3.getValue("Note"));
+ // shallow clone of otherDetails map - contains the same object values!
+ assertSame(count, sf3.getValue("Count"));
+
+ /*
+ * copy constructor modifying type/begin/end/group/score
+ */
+ SequenceFeature sf4 = new SequenceFeature(sf1, "Disulfide bond", 12,
+ 15, "group3", -9.1f);
+ assertEquals("Disulfide bond", sf4.getType());
+ assertTrue(sf4.isContactFeature());
+ assertEquals("desc", sf4.getDescription());
+ assertEquals(12, sf4.getBegin());
+ assertEquals(15, sf4.getEnd());
+ assertEquals(-9.1f, sf4.getScore());
+ assertEquals("+", sf4.getValue("STRAND"));
+ assertEquals("Testing", sf4.getValue("Note"));
+ // shallow clone of otherDetails map - contains the same object values!
+ assertSame(count, sf4.getValue("Count"));
}
/**
assertEquals(sf1.hashCode(), sf2.hashCode());
// changing type breaks equals:
- String restores = sf2.getType();
- sf2.setType("Type");
- assertFalse(sf1.equals(sf2));
- sf2.setType(restores);
+ SequenceFeature sf3 = new SequenceFeature("type", "desc", 22, 33,
+ 12.5f, "group");
+ SequenceFeature sf4 = new SequenceFeature("Type", "desc", 22, 33,
+ 12.5f, "group");
+ assertFalse(sf3.equals(sf4));
// changing description breaks equals:
- restores = sf2.getDescription();
+ String restores = sf2.getDescription();
sf2.setDescription("Desc");
assertFalse(sf1.equals(sf2));
sf2.setDescription(restores);
// changing score breaks equals:
float restoref = sf2.getScore();
- sf2.setScore(12.4f);
+ sf2 = new SequenceFeature(sf2, sf2.getBegin(), sf2.getEnd(),
+ sf2.getFeatureGroup(), 10f);
assertFalse(sf1.equals(sf2));
- sf2.setScore(restoref);
+ sf2 = new SequenceFeature(sf2, sf2.getBegin(), sf2.getEnd(),
+ sf2.getFeatureGroup(), restoref);
// NaN doesn't match a number
restoref = sf2.getScore();
- sf2.setScore(Float.NaN);
+ sf2 = new SequenceFeature(sf2, sf2.getBegin(), sf2.getEnd(),
+ sf2.getFeatureGroup(), Float.NaN);
assertFalse(sf1.equals(sf2));
// NaN matches NaN
- sf1.setScore(Float.NaN);
+ sf1 = new SequenceFeature(sf1, sf1.getBegin(), sf1.getEnd(),
+ sf1.getFeatureGroup(), Float.NaN);
assertTrue(sf1.equals(sf2));
- sf1.setScore(restoref);
- sf2.setScore(restoref);
+ sf1 = new SequenceFeature(sf1, sf1.getBegin(), sf1.getEnd(),
+ sf1.getFeatureGroup(), restoref);
+ sf2 = new SequenceFeature(sf2, sf2.getBegin(), sf2.getEnd(),
+ sf2.getFeatureGroup(), restoref);
// changing start position breaks equals:
int restorei = sf2.getBegin();
- sf2.setBegin(21);
+ sf2 = new SequenceFeature(sf2, 21, sf2.getEnd(), sf2.getFeatureGroup(), sf2.getScore());
assertFalse(sf1.equals(sf2));
- sf2.setBegin(restorei);
+ sf2 = new SequenceFeature(sf2, restorei, sf2.getEnd(),
+ sf2.getFeatureGroup(), sf2.getScore());
// changing end position breaks equals:
restorei = sf2.getEnd();
- sf2.setEnd(32);
+ sf2 = new SequenceFeature(sf2, sf2.getBegin(), 32,
+ sf2.getFeatureGroup(), sf2.getScore());
assertFalse(sf1.equals(sf2));
- sf2.setEnd(restorei);
+ sf2 = new SequenceFeature(sf2, sf2.getBegin(), restorei,
+ sf2.getFeatureGroup(), sf2.getScore());
// changing feature group breaks equals:
restores = sf2.getFeatureGroup();
- sf2.setFeatureGroup("Group");
+ sf2 = new SequenceFeature(sf2, sf2.getBegin(), sf2.getEnd(), "Group", sf2.getScore());
assertFalse(sf1.equals(sf2));
- sf2.setFeatureGroup(restores);
+ sf2 = new SequenceFeature(sf2, sf2.getBegin(), sf2.getEnd(), restores, sf2.getScore());
// changing ID breaks equals:
restores = (String) sf2.getValue("ID");
SequenceFeature sf = new SequenceFeature("type", "desc", 22, 33, 12.5f,
"group");
assertFalse(sf.isContactFeature());
- sf.setType("");
+ sf = new SequenceFeature("", "desc", 22, 33, 12.5f, "group");
assertFalse(sf.isContactFeature());
- sf.setType(null);
+ sf = new SequenceFeature(null, "desc", 22, 33, 12.5f, "group");
assertFalse(sf.isContactFeature());
- sf.setType("Disulfide Bond");
+ sf = new SequenceFeature("Disulfide Bond", "desc", 22, 33, 12.5f,
+ "group");
assertTrue(sf.isContactFeature());
- sf.setType("disulfide bond");
+ sf = new SequenceFeature("disulfide bond", "desc", 22, 33, 12.5f,
+ "group");
assertTrue(sf.isContactFeature());
- sf.setType("Disulphide Bond");
+ sf = new SequenceFeature("Disulphide Bond", "desc", 22, 33, 12.5f,
+ "group");
assertTrue(sf.isContactFeature());
- sf.setType("disulphide bond");
+ sf = new SequenceFeature("disulphide bond", "desc", 22, 33, 12.5f,
+ "group");
assertTrue(sf.isContactFeature());
}
}
import static org.testng.AssertJUnit.assertEquals;
import static org.testng.AssertJUnit.assertFalse;
import static org.testng.AssertJUnit.assertNotNull;
+import static org.testng.AssertJUnit.assertNotSame;
import static org.testng.AssertJUnit.assertNull;
import static org.testng.AssertJUnit.assertSame;
import static org.testng.AssertJUnit.assertTrue;
-import static org.testng.internal.junit.ArrayAsserts.assertArrayEquals;
+import jalview.commands.EditCommand;
+import jalview.commands.EditCommand.Action;
import jalview.datamodel.PDBEntry.Type;
import jalview.gui.JvOptionPane;
import jalview.util.MapList;
import java.util.List;
import java.util.Vector;
+import junit.extensions.PA;
+
import org.testng.Assert;
import org.testng.annotations.BeforeClass;
import org.testng.annotations.BeforeMethod;
// change sequence, should trigger an update of cached result
sq.setSequence("ASDFASDFADSF");
assertTrue(sq.isProtein());
- /*
- * in situ change of sequence doesn't change hashcode :-O
- * (sequence should not expose internal implementation)
- */
- for (int i = 0; i < sq.getSequence().length; i++)
- {
- sq.getSequence()[i] = "acgtu".charAt(i % 5);
- }
- assertTrue(sq.isProtein()); // but it isn't
}
@Test(groups = { "Functional" })
@Test(groups = { "Functional" })
public void testFindIndex()
{
+ /*
+ * call sequenceChanged() after each test to invalidate any cursor,
+ * forcing the 1-arg findIndex to be executed
+ */
SequenceI sq = new Sequence("test", "ABCDEF");
assertEquals(0, sq.findIndex(0));
+ sq.sequenceChanged();
assertEquals(1, sq.findIndex(1));
+ sq.sequenceChanged();
assertEquals(5, sq.findIndex(5));
+ sq.sequenceChanged();
assertEquals(6, sq.findIndex(6));
+ sq.sequenceChanged();
assertEquals(6, sq.findIndex(9));
- sq = new Sequence("test", "-A--B-C-D-E-F--");
- assertEquals(2, sq.findIndex(1));
- assertEquals(5, sq.findIndex(2));
- assertEquals(7, sq.findIndex(3));
+ sq = new Sequence("test/8-13", "-A--B-C-D-E-F--");
+ assertEquals(2, sq.findIndex(8));
+ sq.sequenceChanged();
+ assertEquals(5, sq.findIndex(9));
+ sq.sequenceChanged();
+ assertEquals(7, sq.findIndex(10));
// before start returns 0
+ sq.sequenceChanged();
assertEquals(0, sq.findIndex(0));
+ sq.sequenceChanged();
assertEquals(0, sq.findIndex(-1));
// beyond end returns last residue column
+ sq.sequenceChanged();
assertEquals(13, sq.findIndex(99));
-
}
/**
- * Tests for the method that returns a dataset sequence position (base 1) for
+ * Tests for the method that returns a dataset sequence position (start..) for
* an aligned column position (base 0).
*/
@Test(groups = { "Functional" })
public void testFindPosition()
{
- SequenceI sq = new Sequence("test", "ABCDEF");
- assertEquals(1, sq.findPosition(0));
- assertEquals(6, sq.findPosition(5));
+ /*
+ * call sequenceChanged() after each test to invalidate any cursor,
+ * forcing the 1-arg findPosition to be executed
+ */
+ SequenceI sq = new Sequence("test/8-13", "ABCDEF");
+ assertEquals(8, sq.findPosition(0));
+ // Sequence should now hold a cursor at [8, 0]
+ assertEquals("test:Pos8:Col1:startCol1:endCol0:tok0",
+ PA.getValue(sq, "cursor").toString());
+ SequenceCursor cursor = (SequenceCursor) PA.getValue(sq, "cursor");
+ int token = (int) PA.getValue(sq, "changeCount");
+ assertEquals(new SequenceCursor(sq, 8, 1, token), cursor);
+
+ sq.sequenceChanged();
+
+ /*
+ * find F13 at column offset 5, cursor should update to [13, 6]
+ * endColumn is found and saved in cursor
+ */
+ assertEquals(13, sq.findPosition(5));
+ cursor = (SequenceCursor) PA.getValue(sq, "cursor");
+ assertEquals(++token, (int) PA.getValue(sq, "changeCount"));
+ assertEquals(new SequenceCursor(sq, 13, 6, token), cursor);
+ assertEquals("test:Pos13:Col6:startCol1:endCol6:tok1",
+ PA.getValue(sq, "cursor").toString());
+
// assertEquals(-1, seq.findPosition(6)); // fails
- sq = new Sequence("test", "AB-C-D--");
- assertEquals(1, sq.findPosition(0));
- assertEquals(2, sq.findPosition(1));
+ sq = new Sequence("test/8-11", "AB-C-D--");
+ token = (int) PA.getValue(sq, "changeCount"); // 0
+ assertEquals(8, sq.findPosition(0));
+ cursor = (SequenceCursor) PA.getValue(sq, "cursor");
+ assertEquals(new SequenceCursor(sq, 8, 1, token), cursor);
+ assertEquals("test:Pos8:Col1:startCol1:endCol0:tok0",
+ PA.getValue(sq, "cursor").toString());
+
+ sq.sequenceChanged();
+ assertEquals(9, sq.findPosition(1));
+ cursor = (SequenceCursor) PA.getValue(sq, "cursor");
+ assertEquals(new SequenceCursor(sq, 9, 2, ++token), cursor);
+ assertEquals("test:Pos9:Col2:startCol1:endCol0:tok1",
+ PA.getValue(sq, "cursor").toString());
+
+ sq.sequenceChanged();
// gap position 'finds' residue to the right (not the left as per javadoc)
- assertEquals(3, sq.findPosition(2));
- assertEquals(3, sq.findPosition(3));
- assertEquals(4, sq.findPosition(4));
- assertEquals(4, sq.findPosition(5));
+ // cursor is set to the last residue position found [B 2]
+ assertEquals(10, sq.findPosition(2));
+ cursor = (SequenceCursor) PA.getValue(sq, "cursor");
+ assertEquals(new SequenceCursor(sq, 9, 2, ++token), cursor);
+ assertEquals("test:Pos9:Col2:startCol1:endCol0:tok2",
+ PA.getValue(sq, "cursor").toString());
+
+ sq.sequenceChanged();
+ assertEquals(10, sq.findPosition(3));
+ cursor = (SequenceCursor) PA.getValue(sq, "cursor");
+ assertEquals(new SequenceCursor(sq, 10, 4, ++token), cursor);
+ assertEquals("test:Pos10:Col4:startCol1:endCol0:tok3",
+ PA.getValue(sq, "cursor").toString());
+
+ sq.sequenceChanged();
+ // column[4] is the gap after C - returns D11
+ // cursor is set to [C 4]
+ assertEquals(11, sq.findPosition(4));
+ cursor = (SequenceCursor) PA.getValue(sq, "cursor");
+ assertEquals(new SequenceCursor(sq, 10, 4, ++token), cursor);
+ assertEquals("test:Pos10:Col4:startCol1:endCol0:tok4",
+ PA.getValue(sq, "cursor").toString());
+
+ sq.sequenceChanged();
+ assertEquals(11, sq.findPosition(5)); // D
+ cursor = (SequenceCursor) PA.getValue(sq, "cursor");
+ assertEquals(new SequenceCursor(sq, 11, 6, ++token), cursor);
+ // lastCol has been found and saved in the cursor
+ assertEquals("test:Pos11:Col6:startCol1:endCol6:tok5",
+ PA.getValue(sq, "cursor").toString());
+
+ sq.sequenceChanged();
// returns 1 more than sequence length if off the end ?!?
- assertEquals(5, sq.findPosition(6));
- assertEquals(5, sq.findPosition(7));
+ assertEquals(12, sq.findPosition(6));
- sq = new Sequence("test", "--AB-C-DEF--");
- assertEquals(1, sq.findPosition(0));
- assertEquals(1, sq.findPosition(1));
- assertEquals(1, sq.findPosition(2));
- assertEquals(2, sq.findPosition(3));
- assertEquals(3, sq.findPosition(4));
- assertEquals(3, sq.findPosition(5));
- assertEquals(4, sq.findPosition(6));
- assertEquals(4, sq.findPosition(7));
- assertEquals(5, sq.findPosition(8));
- assertEquals(6, sq.findPosition(9));
- assertEquals(7, sq.findPosition(10));
- assertEquals(7, sq.findPosition(11));
+ sq.sequenceChanged();
+ assertEquals(12, sq.findPosition(7));
+
+ /*
+ * first findPosition should also set firstResCol in cursor
+ */
+ sq = new Sequence("test/8-13", "--AB-C-DEF--");
+ assertEquals(8, sq.findPosition(0));
+ assertNull(PA.getValue(sq, "cursor"));
+
+ sq.sequenceChanged();
+ assertEquals(8, sq.findPosition(1));
+ assertNull(PA.getValue(sq, "cursor"));
+
+ sq.sequenceChanged();
+ assertEquals(8, sq.findPosition(2));
+ assertEquals("test:Pos8:Col3:startCol3:endCol0:tok2",
+ PA.getValue(sq, "cursor").toString());
+
+ sq.sequenceChanged();
+ assertEquals(9, sq.findPosition(3));
+ assertEquals("test:Pos9:Col4:startCol3:endCol0:tok3",
+ PA.getValue(sq, "cursor").toString());
+
+ sq.sequenceChanged();
+ // column[4] is a gap, returns next residue pos (C10)
+ // cursor is set to last residue found [B]
+ assertEquals(10, sq.findPosition(4));
+ assertEquals("test:Pos9:Col4:startCol3:endCol0:tok4",
+ PA.getValue(sq, "cursor").toString());
+
+ sq.sequenceChanged();
+ assertEquals(10, sq.findPosition(5));
+ assertEquals("test:Pos10:Col6:startCol3:endCol0:tok5",
+ PA.getValue(sq, "cursor").toString());
+
+ sq.sequenceChanged();
+ // column[6] is a gap, returns next residue pos (D11)
+ // cursor is set to last residue found [C]
+ assertEquals(11, sq.findPosition(6));
+ assertEquals("test:Pos10:Col6:startCol3:endCol0:tok6",
+ PA.getValue(sq, "cursor").toString());
+
+ sq.sequenceChanged();
+ assertEquals(11, sq.findPosition(7));
+ assertEquals("test:Pos11:Col8:startCol3:endCol0:tok7",
+ PA.getValue(sq, "cursor").toString());
+
+ sq.sequenceChanged();
+ assertEquals(12, sq.findPosition(8));
+ assertEquals("test:Pos12:Col9:startCol3:endCol0:tok8",
+ PA.getValue(sq, "cursor").toString());
+
+ /*
+ * when the last residue column is found, it is set in the cursor
+ */
+ sq.sequenceChanged();
+ assertEquals(13, sq.findPosition(9));
+ assertEquals("test:Pos13:Col10:startCol3:endCol10:tok9",
+ PA.getValue(sq, "cursor").toString());
+
+ sq.sequenceChanged();
+ assertEquals(14, sq.findPosition(10));
+ assertEquals("test:Pos13:Col10:startCol3:endCol10:tok10",
+ PA.getValue(sq, "cursor").toString());
+
+ /*
+ * findPosition for column beyond sequence length
+ * returns 1 more than last residue position
+ */
+ sq.sequenceChanged();
+ assertEquals(14, sq.findPosition(11));
+ assertEquals("test:Pos13:Col10:startCol3:endCol10:tok11",
+ PA.getValue(sq, "cursor").toString());
+
+ sq.sequenceChanged();
+ assertEquals(14, sq.findPosition(99));
+ assertEquals("test:Pos13:Col10:startCol3:endCol10:tok12",
+ PA.getValue(sq, "cursor").toString());
+
+ /*
+ * gapped sequence ending in non-gap
+ */
+ sq = new Sequence("test/8-13", "--AB-C-DEF");
+ assertEquals(13, sq.findPosition(9));
+ assertEquals("test:Pos13:Col10:startCol3:endCol10:tok0",
+ PA.getValue(sq, "cursor").toString());
+ sq.sequenceChanged();
+ assertEquals(12, sq.findPosition(8));
+ cursor = (SequenceCursor) PA.getValue(sq, "cursor");
+ // sequenceChanged() invalidates cursor.lastResidueColumn
+ cursor = (SequenceCursor) PA.getValue(sq, "cursor");
+ assertEquals("test:Pos12:Col9:startCol3:endCol0:tok1",
+ cursor.toString());
+ // findPosition with cursor accepts base 1 column values
+ assertEquals(13, ((Sequence) sq).findPosition(10, cursor));
+ assertEquals(13, sq.findPosition(9)); // F13
+ // lastResidueColumn has now been found and saved in cursor
+ assertEquals("test:Pos13:Col10:startCol3:endCol10:tok1",
+ PA.getValue(sq, "cursor").toString());
}
@Test(groups = { "Functional" })
public void testDeleteChars()
{
+ /*
+ * internal delete
+ */
SequenceI sq = new Sequence("test", "ABCDEF");
+ assertNull(PA.getValue(sq, "datasetSequence"));
assertEquals(1, sq.getStart());
assertEquals(6, sq.getEnd());
sq.deleteChars(2, 3);
assertEquals("ABDEF", sq.getSequenceAsString());
assertEquals(1, sq.getStart());
assertEquals(5, sq.getEnd());
+ assertNull(PA.getValue(sq, "datasetSequence"));
+ /*
+ * delete at start
+ */
sq = new Sequence("test", "ABCDEF");
sq.deleteChars(0, 2);
assertEquals("CDEF", sq.getSequenceAsString());
assertEquals(3, sq.getStart());
assertEquals(6, sq.getEnd());
+ assertNull(PA.getValue(sq, "datasetSequence"));
+
+ /*
+ * delete at end
+ */
+ sq = new Sequence("test", "ABCDEF");
+ sq.deleteChars(4, 6);
+ assertEquals("ABCD", sq.getSequenceAsString());
+ assertEquals(1, sq.getStart());
+ assertEquals(4, sq.getEnd());
+ assertNull(PA.getValue(sq, "datasetSequence"));
+ }
+
+ @Test(groups = { "Functional" })
+ public void testDeleteChars_withDbRefsAndFeatures()
+ {
+ /*
+ * internal delete - new dataset sequence created
+ * gets a copy of any dbrefs
+ */
+ SequenceI sq = new Sequence("test", "ABCDEF");
+ sq.createDatasetSequence();
+ DBRefEntry dbr1 = new DBRefEntry("Uniprot", "0", "a123");
+ sq.addDBRef(dbr1);
+ Object ds = PA.getValue(sq, "datasetSequence");
+ assertNotNull(ds);
+ assertEquals(1, sq.getStart());
+ assertEquals(6, sq.getEnd());
+ sq.deleteChars(2, 3);
+ assertEquals("ABDEF", sq.getSequenceAsString());
+ assertEquals(1, sq.getStart());
+ assertEquals(5, sq.getEnd());
+ Object newDs = PA.getValue(sq, "datasetSequence");
+ assertNotNull(newDs);
+ assertNotSame(ds, newDs);
+ assertNotNull(sq.getDBRefs());
+ assertEquals(1, sq.getDBRefs().length);
+ assertNotSame(dbr1, sq.getDBRefs()[0]);
+ assertEquals(dbr1, sq.getDBRefs()[0]);
+
+ /*
+ * internal delete with sequence features
+ * (failure case for JAL-2541)
+ */
+ sq = new Sequence("test", "ABCDEF");
+ sq.createDatasetSequence();
+ SequenceFeature sf1 = new SequenceFeature("Cath", "desc", 2, 4, 2f,
+ "CathGroup");
+ sq.addSequenceFeature(sf1);
+ ds = PA.getValue(sq, "datasetSequence");
+ assertNotNull(ds);
+ assertEquals(1, sq.getStart());
+ assertEquals(6, sq.getEnd());
+ sq.deleteChars(2, 4);
+ assertEquals("ABEF", sq.getSequenceAsString());
+ assertEquals(1, sq.getStart());
+ assertEquals(4, sq.getEnd());
+ newDs = PA.getValue(sq, "datasetSequence");
+ assertNotNull(newDs);
+ assertNotSame(ds, newDs);
+ List<SequenceFeature> sfs = sq.getSequenceFeatures();
+ assertEquals(1, sfs.size());
+ assertNotSame(sf1, sfs.get(0));
+ assertEquals(sf1, sfs.get(0));
+
+ /*
+ * delete at start - no new dataset sequence created
+ * any sequence features remain as before
+ */
+ sq = new Sequence("test", "ABCDEF");
+ sq.createDatasetSequence();
+ ds = PA.getValue(sq, "datasetSequence");
+ sf1 = new SequenceFeature("Cath", "desc", 2, 4, 2f, "CathGroup");
+ sq.addSequenceFeature(sf1);
+ sq.deleteChars(0, 2);
+ assertEquals("CDEF", sq.getSequenceAsString());
+ assertEquals(3, sq.getStart());
+ assertEquals(6, sq.getEnd());
+ assertSame(ds, PA.getValue(sq, "datasetSequence"));
+ sfs = sq.getSequenceFeatures();
+ assertNotNull(sfs);
+ assertEquals(1, sfs.size());
+ assertSame(sf1, sfs.get(0));
+
+ /*
+ * delete at end - no new dataset sequence created
+ * any dbrefs remain as before
+ */
+ sq = new Sequence("test", "ABCDEF");
+ sq.createDatasetSequence();
+ ds = PA.getValue(sq, "datasetSequence");
+ dbr1 = new DBRefEntry("Uniprot", "0", "a123");
+ sq.addDBRef(dbr1);
+ sq.deleteChars(4, 6);
+ assertEquals("ABCD", sq.getSequenceAsString());
+ assertEquals(1, sq.getStart());
+ assertEquals(4, sq.getEnd());
+ assertSame(ds, PA.getValue(sq, "datasetSequence"));
+ assertNotNull(sq.getDBRefs());
+ assertEquals(1, sq.getDBRefs().length);
+ assertSame(dbr1, sq.getDBRefs()[0]);
}
@Test(groups = { "Functional" })
SequenceI sq = new Sequence("test", "GATCAT");
sq.createDatasetSequence();
- assertNull(sq.getSequenceFeatures());
+ assertTrue(sq.getSequenceFeatures().isEmpty());
/*
* SequenceFeature on sequence
*/
- SequenceFeature sf = new SequenceFeature();
+ SequenceFeature sf = new SequenceFeature("Cath", "desc", 2, 4, 2f, null);
sq.addSequenceFeature(sf);
- SequenceFeature[] sfs = sq.getSequenceFeatures();
- assertEquals(1, sfs.length);
- assertSame(sf, sfs[0]);
+ List<SequenceFeature> sfs = sq.getSequenceFeatures();
+ assertEquals(1, sfs.size());
+ assertSame(sf, sfs.get(0));
/*
* SequenceFeature on sequence and dataset sequence; returns that on
* Note JAL-2046: spurious: we have no use case for this at the moment.
* This test also buggy - as sf2.equals(sf), no new feature is added
*/
- SequenceFeature sf2 = new SequenceFeature();
+ SequenceFeature sf2 = new SequenceFeature("Cath", "desc", 2, 4, 2f,
+ null);
sq.getDatasetSequence().addSequenceFeature(sf2);
sfs = sq.getSequenceFeatures();
- assertEquals(1, sfs.length);
- assertSame(sf, sfs[0]);
+ assertEquals(1, sfs.size());
+ assertSame(sf, sfs.get(0));
/*
* SequenceFeature on dataset sequence only
* Note JAL-2046: spurious: we have no use case for setting a non-dataset sequence's feature array to null at the moment.
*/
sq.setSequenceFeatures(null);
- assertNull(sq.getDatasetSequence().getSequenceFeatures());
+ assertTrue(sq.getDatasetSequence().getSequenceFeatures().isEmpty());
/*
* Corrupt case - no SequenceFeature, dataset's dataset is the original
assertTrue(e.getMessage().toLowerCase()
.contains("implementation error"));
}
- assertNull(sq.getSequenceFeatures());
+ assertTrue(sq.getSequenceFeatures().isEmpty());
}
/**
public void testCreateDatasetSequence()
{
SequenceI sq = new Sequence("my", "ASDASD");
+ sq.addSequenceFeature(new SequenceFeature("type", "desc", 1, 10, 1f,
+ "group"));
+ sq.addDBRef(new DBRefEntry("source", "version", "accession"));
assertNull(sq.getDatasetSequence());
+ assertNotNull(PA.getValue(sq, "sequenceFeatureStore"));
+ assertNotNull(PA.getValue(sq, "dbrefs"));
+
SequenceI rds = sq.createDatasetSequence();
assertNotNull(rds);
assertNull(rds.getDatasetSequence());
- assertEquals(sq.getDatasetSequence(), rds);
+ assertSame(sq.getDatasetSequence(), rds);
+
+ // sequence features and dbrefs transferred to dataset sequence
+ assertNull(PA.getValue(sq, "sequenceFeatureStore"));
+ assertNull(PA.getValue(sq, "dbrefs"));
+ assertNotNull(PA.getValue(rds, "sequenceFeatureStore"));
+ assertNotNull(PA.getValue(rds, "dbrefs"));
}
/**
assertEquals("CD", derived.getSequenceAsString());
assertSame(sq.getDatasetSequence(), derived.getDatasetSequence());
- assertNull(sq.sequenceFeatures);
- assertNull(derived.sequenceFeatures);
// derived sequence should access dataset sequence features
assertNotNull(sq.getSequenceFeatures());
- assertArrayEquals(sq.getSequenceFeatures(),
- derived.getSequenceFeatures());
+ assertEquals(sq.getSequenceFeatures(), derived.getSequenceFeatures());
/*
* verify we have primary db refs *just* for PDB IDs with associated
assertEquals(anns[0].score, seq1.getAnnotation()[0].score);
// copy has a copy of the sequence feature:
- SequenceFeature[] sfs = copy.getSequenceFeatures();
- assertEquals(1, sfs.length);
+ List<SequenceFeature> sfs = copy.getSequenceFeatures();
+ assertEquals(1, sfs.size());
if (seq1.getDatasetSequence() != null
&& copy.getDatasetSequence() == seq1.getDatasetSequence())
{
- assertTrue(sfs[0] == seq1.getSequenceFeatures()[0]);
+ assertSame(sfs.get(0), seq1.getSequenceFeatures().get(0));
}
else
{
- assertFalse(sfs[0] == seq1.getSequenceFeatures()[0]);
+ assertNotSame(sfs.get(0), seq1.getSequenceFeatures().get(0));
}
- assertTrue(sfs[0].equals(seq1.getSequenceFeatures()[0]));
+ assertEquals(sfs.get(0), seq1.getSequenceFeatures().get(0));
// copy has a copy of the PDB entry
Vector<PDBEntry> pdbs = copy.getAllPDBEntries();
assertEquals(' ', sq.getCharAt(-1));
}
+ @Test(groups = { "Functional" })
+ public void testAddSequenceFeatures()
+ {
+ SequenceI sq = new Sequence("", "abcde");
+ // type may not be null
+ assertFalse(sq.addSequenceFeature(new SequenceFeature(null, "desc", 4,
+ 8, 0f, null)));
+ assertTrue(sq.addSequenceFeature(new SequenceFeature("Cath", "desc", 4,
+ 8, 0f, null)));
+ // can't add a duplicate feature
+ assertFalse(sq.addSequenceFeature(new SequenceFeature("Cath", "desc",
+ 4, 8, 0f, null)));
+ // can add a different feature
+ assertTrue(sq.addSequenceFeature(new SequenceFeature("Scop", "desc", 4,
+ 8, 0f, null))); // different type
+ assertTrue(sq.addSequenceFeature(new SequenceFeature("Cath",
+ "description", 4, 8, 0f, null)));// different description
+ assertTrue(sq.addSequenceFeature(new SequenceFeature("Cath", "desc", 3,
+ 8, 0f, null))); // different start position
+ assertTrue(sq.addSequenceFeature(new SequenceFeature("Cath", "desc", 4,
+ 9, 0f, null))); // different end position
+ assertTrue(sq.addSequenceFeature(new SequenceFeature("Cath", "desc", 4,
+ 8, 1f, null))); // different score
+ assertTrue(sq.addSequenceFeature(new SequenceFeature("Cath", "desc", 4,
+ 8, Float.NaN, null))); // score NaN
+ assertTrue(sq.addSequenceFeature(new SequenceFeature("Cath", "desc", 4,
+ 8, 0f, "Metal"))); // different group
+ assertEquals(8, sq.getFeatures().getAllFeatures().size());
+ }
+
/**
* Tests for adding (or updating) dbrefs
*
seq2.createDatasetSequence();
seq.setDatasetSequence(seq2);
}
+
+ @Test(groups = { "Functional" })
+ public void testFindFeatures()
+ {
+ SequenceI sq = new Sequence("test/8-16", "-ABC--DEF--GHI--");
+ sq.createDatasetSequence();
+
+ assertTrue(sq.findFeatures(1, 99).isEmpty());
+
+ // add non-positional feature
+ SequenceFeature sf0 = new SequenceFeature("Cath", "desc", 0, 0, 2f,
+ null);
+ sq.addSequenceFeature(sf0);
+ // add feature on BCD
+ SequenceFeature sfBCD = new SequenceFeature("Cath", "desc", 9, 11, 2f,
+ null);
+ sq.addSequenceFeature(sfBCD);
+ // add feature on DE
+ SequenceFeature sfDE = new SequenceFeature("Cath", "desc", 11, 12, 2f,
+ null);
+ sq.addSequenceFeature(sfDE);
+ // add contact feature at [B, H]
+ SequenceFeature sfContactBH = new SequenceFeature("Disulphide bond",
+ "desc", 9, 15, 2f, null);
+ sq.addSequenceFeature(sfContactBH);
+ // add contact feature at [F, G]
+ SequenceFeature sfContactFG = new SequenceFeature("Disulfide Bond",
+ "desc", 13, 14, 2f, null);
+ sq.addSequenceFeature(sfContactFG);
+ // add single position feature at [I]
+ SequenceFeature sfI = new SequenceFeature("Disulfide Bond",
+ "desc", 16, 16, null);
+ sq.addSequenceFeature(sfI);
+
+ // no features in columns 1-2 (-A)
+ List<SequenceFeature> found = sq.findFeatures(1, 2);
+ assertTrue(found.isEmpty());
+
+ // columns 1-6 (-ABC--) includes BCD and B/H feature but not DE
+ found = sq.findFeatures(1, 6);
+ assertEquals(2, found.size());
+ assertTrue(found.contains(sfBCD));
+ assertTrue(found.contains(sfContactBH));
+
+ // columns 5-6 (--) includes (enclosing) BCD but not (contact) B/H feature
+ found = sq.findFeatures(5, 6);
+ assertEquals(1, found.size());
+ assertTrue(found.contains(sfBCD));
+
+ // columns 7-10 (DEF-) includes BCD, DE, F/G but not B/H feature
+ found = sq.findFeatures(7, 10);
+ assertEquals(3, found.size());
+ assertTrue(found.contains(sfBCD));
+ assertTrue(found.contains(sfDE));
+ assertTrue(found.contains(sfContactFG));
+
+ // columns 10-11 (--) should find nothing
+ found = sq.findFeatures(10, 11);
+ assertEquals(0, found.size());
+
+ // columns 14-14 (I) should find variant feature
+ found = sq.findFeatures(14, 14);
+ assertEquals(1, found.size());
+ assertTrue(found.contains(sfI));
+ }
+
+ @Test(groups = { "Functional" })
+ public void testFindIndex_withCursor()
+ {
+ Sequence sq = new Sequence("test/8-13", "-A--BCD-EF--");
+
+ // find F given A
+ assertEquals(10, sq.findIndex(13, new SequenceCursor(sq, 8, 2, 0)));
+
+ // find A given F
+ assertEquals(2, sq.findIndex(8, new SequenceCursor(sq, 13, 10, 0)));
+
+ // find C given C
+ assertEquals(6, sq.findIndex(10, new SequenceCursor(sq, 10, 6, 0)));
+ }
+
+ @Test(groups = { "Functional" })
+ public void testFindPosition_withCursor()
+ {
+ Sequence sq = new Sequence("test/8-13", "-A--BCD-EF--");
+
+ // find F pos given A - lastCol gets set in cursor
+ assertEquals(13, sq.findPosition(10, new SequenceCursor(sq, 8, 2, 0)));
+ assertEquals("test:Pos13:Col10:startCol0:endCol10:tok0",
+ PA.getValue(sq, "cursor").toString());
+
+ // find A pos given F - first residue column is saved in cursor
+ assertEquals(8, sq.findPosition(2, new SequenceCursor(sq, 13, 10, 0)));
+ assertEquals("test:Pos8:Col2:startCol2:endCol10:tok0",
+ PA.getValue(sq, "cursor").toString());
+
+ // find C pos given C (neither startCol nor endCol is set)
+ assertEquals(10, sq.findPosition(6, new SequenceCursor(sq, 10, 6, 0)));
+ assertEquals("test:Pos10:Col6:startCol0:endCol0:tok0",
+ PA.getValue(sq, "cursor").toString());
+
+ // now the grey area - what residue position for a gapped column? JAL-2562
+
+ // find 'residue' for column 3 given cursor for D (so working left)
+ // returns B9; cursor is updated to [B 5]
+ assertEquals(9, sq.findPosition(3, new SequenceCursor(sq, 11, 7, 0)));
+ assertEquals("test:Pos9:Col5:startCol0:endCol0:tok0",
+ PA.getValue(sq, "cursor").toString());
+
+ // find 'residue' for column 8 given cursor for D (so working right)
+ // returns E12; cursor is updated to [D 7]
+ assertEquals(12, sq.findPosition(8, new SequenceCursor(sq, 11, 7, 0)));
+ assertEquals("test:Pos11:Col7:startCol0:endCol0:tok0",
+ PA.getValue(sq, "cursor").toString());
+
+ // find 'residue' for column 12 given cursor for B
+ // returns 1 more than last residue position; cursor is updated to [F 10]
+ // lastCol position is saved in cursor
+ assertEquals(14, sq.findPosition(12, new SequenceCursor(sq, 9, 5, 0)));
+ assertEquals("test:Pos13:Col10:startCol0:endCol10:tok0",
+ PA.getValue(sq, "cursor").toString());
+
+ /*
+ * findPosition for column beyond length of sequence
+ * returns 1 more than the last residue position
+ * cursor is set to last real residue position [F 10]
+ */
+ assertEquals(14, sq.findPosition(99, new SequenceCursor(sq, 8, 2, 0)));
+ assertEquals("test:Pos13:Col10:startCol0:endCol10:tok0",
+ PA.getValue(sq, "cursor").toString());
+
+ /*
+ * and the case without a trailing gap
+ */
+ sq = new Sequence("test/8-13", "-A--BCD-EF");
+ // first find C from A
+ assertEquals(10, sq.findPosition(6, new SequenceCursor(sq, 8, 2, 0)));
+ SequenceCursor cursor = (SequenceCursor) PA.getValue(sq, "cursor");
+ assertEquals("test:Pos10:Col6:startCol0:endCol0:tok0",
+ cursor.toString());
+ // now 'find' 99 from C
+ // cursor is set to [F 10] and saved lastCol
+ assertEquals(14, sq.findPosition(99, cursor));
+ assertEquals("test:Pos13:Col10:startCol0:endCol10:tok0",
+ PA.getValue(sq, "cursor").toString());
+ }
+
+ @Test
+ public void testIsValidCursor()
+ {
+ Sequence sq = new Sequence("Seq", "ABC--DE-F", 8, 13);
+ assertFalse(sq.isValidCursor(null));
+
+ /*
+ * cursor is valid if it has valid sequence ref and changeCount token
+ * and positions within the range of the sequence
+ */
+ int changeCount = (int) PA.getValue(sq, "changeCount");
+ SequenceCursor cursor = new SequenceCursor(sq, 13, 1, changeCount);
+ assertTrue(sq.isValidCursor(cursor));
+
+ /*
+ * column position outside [0 - length] is rejected
+ */
+ cursor = new SequenceCursor(sq, 13, -1, changeCount);
+ assertFalse(sq.isValidCursor(cursor));
+ cursor = new SequenceCursor(sq, 13, 10, changeCount);
+ assertFalse(sq.isValidCursor(cursor));
+ cursor = new SequenceCursor(sq, 7, 8, changeCount);
+ assertFalse(sq.isValidCursor(cursor));
+ cursor = new SequenceCursor(sq, 14, 2, changeCount);
+ assertFalse(sq.isValidCursor(cursor));
+
+ /*
+ * wrong sequence is rejected
+ */
+ cursor = new SequenceCursor(null, 13, 1, changeCount);
+ assertFalse(sq.isValidCursor(cursor));
+ cursor = new SequenceCursor(new Sequence("Seq", "abc"), 13, 1,
+ changeCount);
+ assertFalse(sq.isValidCursor(cursor));
+
+ /*
+ * wrong token value is rejected
+ */
+ cursor = new SequenceCursor(sq, 13, 1, changeCount + 1);
+ assertFalse(sq.isValidCursor(cursor));
+ cursor = new SequenceCursor(sq, 13, 1, changeCount - 1);
+ assertFalse(sq.isValidCursor(cursor));
+ }
+
+ @Test(groups = { "Functional" })
+ public void testFindPosition_withCursorAndEdits()
+ {
+ Sequence sq = new Sequence("test/8-13", "-A--BCD-EF--");
+
+ // find F pos given A
+ assertEquals(13, sq.findPosition(10, new SequenceCursor(sq, 8, 2, 0)));
+ int token = (int) PA.getValue(sq, "changeCount"); // 0
+ SequenceCursor cursor = (SequenceCursor) PA.getValue(sq, "cursor");
+ assertEquals(new SequenceCursor(sq, 13, 10, token), cursor);
+
+ /*
+ * setSequence should invalidate the cursor cached by the sequence
+ */
+ sq.setSequence("-A-BCD-EF---"); // one gap removed
+ assertEquals(8, sq.getStart()); // sanity check
+ assertEquals(11, sq.findPosition(5)); // D11
+ // cursor should now be at [D 6]
+ cursor = (SequenceCursor) PA.getValue(sq, "cursor");
+ assertEquals(new SequenceCursor(sq, 11, 6, ++token), cursor);
+
+ /*
+ * deleteChars should invalidate the cached cursor
+ */
+ sq.deleteChars(2, 5); // delete -BC
+ assertEquals("-AD-EF---", sq.getSequenceAsString());
+ assertEquals(8, sq.getStart()); // sanity check
+ assertEquals(10, sq.findPosition(4)); // E10
+ // cursor should now be at [E 5]
+ cursor = (SequenceCursor) PA.getValue(sq, "cursor");
+ assertEquals(new SequenceCursor(sq, 10, 5, ++token), cursor);
+
+ /*
+ * Edit to insert gaps should invalidate the cached cursor
+ * insert 2 gaps at column[3] to make -AD---EF---
+ */
+ SequenceI[] seqs = new SequenceI[] { sq };
+ AlignmentI al = new Alignment(seqs);
+ new EditCommand().appendEdit(Action.INSERT_GAP, seqs, 3, 2, al, true);
+ assertEquals("-AD---EF---", sq.getSequenceAsString());
+ assertEquals(10, sq.findPosition(4)); // E10
+ // cursor should now be at [D 3]
+ cursor = (SequenceCursor) PA.getValue(sq, "cursor");
+ assertEquals(new SequenceCursor(sq, 9, 3, ++token), cursor);
+
+ /*
+ * insertCharAt should invalidate the cached cursor
+ * insert CC at column[4] to make -AD-CC--EF---
+ */
+ sq.insertCharAt(4, 2, 'C');
+ assertEquals("-AD-CC--EF---", sq.getSequenceAsString());
+ assertEquals(13, sq.findPosition(9)); // F13
+ // cursor should now be at [F 10]
+ cursor = (SequenceCursor) PA.getValue(sq, "cursor");
+ assertEquals(new SequenceCursor(sq, 13, 10, ++token), cursor);
+ }
+
+ @Test(groups = { "Functional" })
+ public void testGetSequence()
+ {
+ String seqstring = "-A--BCD-EF--";
+ Sequence sq = new Sequence("test/8-13", seqstring);
+ sq.createDatasetSequence();
+ assertTrue(Arrays.equals(sq.getSequence(), seqstring.toCharArray()));
+ assertTrue(Arrays.equals(sq.getDatasetSequence().getSequence(),
+ "ABCDEF".toCharArray()));
+
+ // verify a copy of the sequence array is returned
+ char[] theSeq = (char[]) PA.getValue(sq, "sequence");
+ assertNotSame(theSeq, sq.getSequence());
+ theSeq = (char[]) PA.getValue(sq.getDatasetSequence(), "sequence");
+ assertNotSame(theSeq, sq.getDatasetSequence().getSequence());
+ }
+
+ @Test(groups = { "Functional" })
+ public void testReplace()
+ {
+ String seqstring = "-A--BCD-EF--";
+ SequenceI sq = new Sequence("test/8-13", seqstring);
+ assertEquals(0, PA.getValue(sq, "changeCount"));
+
+ assertEquals(0, sq.replace('A', 'A')); // same char
+ assertEquals(seqstring, sq.getSequenceAsString());
+ assertEquals(0, PA.getValue(sq, "changeCount"));
+
+ assertEquals(0, sq.replace('X', 'Y')); // not there
+ assertEquals(seqstring, sq.getSequenceAsString());
+ assertEquals(0, PA.getValue(sq, "changeCount"));
+
+ assertEquals(1, sq.replace('A', 'K'));
+ assertEquals("-K--BCD-EF--", sq.getSequenceAsString());
+ assertEquals(1, PA.getValue(sq, "changeCount"));
+
+ assertEquals(6, sq.replace('-', '.'));
+ assertEquals(".K..BCD.EF..", sq.getSequenceAsString());
+ assertEquals(2, PA.getValue(sq, "changeCount"));
+ }
+
+ @Test(groups = { "Functional" })
+ public void testFindPositions()
+ {
+ SequenceI sq = new Sequence("test/8-13", "-ABC---DE-F--");
+
+ /*
+ * invalid inputs
+ */
+ assertNull(sq.findPositions(6, 5));
+ assertNull(sq.findPositions(0, 5));
+ assertNull(sq.findPositions(-1, 5));
+
+ /*
+ * all gapped ranges
+ */
+ assertNull(sq.findPositions(1, 1)); // 1-based columns
+ assertNull(sq.findPositions(5, 5));
+ assertNull(sq.findPositions(5, 6));
+ assertNull(sq.findPositions(5, 7));
+
+ /*
+ * all ungapped ranges
+ */
+ assertEquals(new Range(8, 8), sq.findPositions(2, 2)); // A
+ assertEquals(new Range(8, 9), sq.findPositions(2, 3)); // AB
+ assertEquals(new Range(8, 10), sq.findPositions(2, 4)); // ABC
+ assertEquals(new Range(9, 10), sq.findPositions(3, 4)); // BC
+
+ /*
+ * gap to ungapped range
+ */
+ assertEquals(new Range(8, 10), sq.findPositions(1, 4)); // ABC
+ assertEquals(new Range(11, 12), sq.findPositions(6, 9)); // DE
+
+ /*
+ * ungapped to gapped range
+ */
+ assertEquals(new Range(10, 10), sq.findPositions(4, 5)); // C
+ assertEquals(new Range(9, 13), sq.findPositions(3, 11)); // BCDEF
+
+ /*
+ * ungapped to ungapped enclosing gaps
+ */
+ assertEquals(new Range(10, 11), sq.findPositions(4, 8)); // CD
+ assertEquals(new Range(8, 13), sq.findPositions(2, 11)); // ABCDEF
+
+ /*
+ * gapped to gapped enclosing ungapped
+ */
+ assertEquals(new Range(8, 10), sq.findPositions(1, 5)); // ABC
+ assertEquals(new Range(11, 12), sq.findPositions(5, 10)); // DE
+ assertEquals(new Range(8, 13), sq.findPositions(1, 13)); // the lot
+ assertEquals(new Range(8, 13), sq.findPositions(1, 99));
+ }
+
+ @Test(groups = { "Functional" })
+ public void testFindFeatures_largeEndPos()
+ {
+ /*
+ * imitate a PDB sequence where end is larger than end position
+ */
+ SequenceI sq = new Sequence("test", "-ABC--DEF--", 1, 20);
+ sq.createDatasetSequence();
+
+ assertTrue(sq.findFeatures(1, 9).isEmpty());
+ // should be no array bounds exception - JAL-2772
+ assertTrue(sq.findFeatures(1, 15).isEmpty());
+
+ // add feature on BCD
+ SequenceFeature sfBCD = new SequenceFeature("Cath", "desc", 2, 4, 2f,
+ null);
+ sq.addSequenceFeature(sfBCD);
+
+ // no features in columns 1-2 (-A)
+ List<SequenceFeature> found = sq.findFeatures(1, 2);
+ assertTrue(found.isEmpty());
+
+ // columns 1-6 (-ABC--) includes BCD
+ found = sq.findFeatures(1, 6);
+ assertEquals(1, found.size());
+ assertTrue(found.contains(sfBCD));
+
+ // columns 10-11 (--) should find nothing
+ found = sq.findFeatures(10, 11);
+ assertEquals(0, found.size());
+ }
+
+ @Test(groups = { "Functional" })
+ public void testSetName()
+ {
+ SequenceI sq = new Sequence("test", "-ABC---DE-F--");
+ assertEquals("test", sq.getName());
+ assertEquals(1, sq.getStart());
+ assertEquals(6, sq.getEnd());
+
+ sq.setName("testing");
+ assertEquals("testing", sq.getName());
+
+ sq.setName("test/8-10");
+ assertEquals("test", sq.getName());
+ assertEquals(8, sq.getStart());
+ assertEquals(13, sq.getEnd()); // note end is recomputed
+
+ sq.setName("testing/7-99");
+ assertEquals("testing", sq.getName());
+ assertEquals(7, sq.getStart());
+ assertEquals(99, sq.getEnd()); // end may be beyond physical end
+
+ sq.setName("/2-3");
+ assertEquals("", sq.getName());
+ assertEquals(2, sq.getStart());
+ assertEquals(7, sq.getEnd());
+
+ sq.setName("test/"); // invalid
+ assertEquals("test/", sq.getName());
+ assertEquals(2, sq.getStart());
+ assertEquals(7, sq.getEnd());
+
+ sq.setName("test/6-13/7-99");
+ assertEquals("test/6-13", sq.getName());
+ assertEquals(7, sq.getStart());
+ assertEquals(99, sq.getEnd());
+
+ sq.setName("test/0-5"); // 0 is invalid - ignored
+ assertEquals("test/0-5", sq.getName());
+ assertEquals(7, sq.getStart());
+ assertEquals(99, sq.getEnd());
+
+ sq.setName("test/a-5"); // a is invalid - ignored
+ assertEquals("test/a-5", sq.getName());
+ assertEquals(7, sq.getStart());
+ assertEquals(99, sq.getEnd());
+
+ sq.setName("test/6-5"); // start > end is invalid - ignored
+ assertEquals("test/6-5", sq.getName());
+ assertEquals(7, sq.getStart());
+ assertEquals(99, sq.getEnd());
+
+ sq.setName("test/5"); // invalid - ignored
+ assertEquals("test/5", sq.getName());
+ assertEquals(7, sq.getStart());
+ assertEquals(99, sq.getEnd());
+
+ sq.setName("test/-5"); // invalid - ignored
+ assertEquals("test/-5", sq.getName());
+ assertEquals(7, sq.getStart());
+ assertEquals(99, sq.getEnd());
+
+ sq.setName("test/5-"); // invalid - ignored
+ assertEquals("test/5-", sq.getName());
+ assertEquals(7, sq.getStart());
+ assertEquals(99, sq.getEnd());
+
+ sq.setName("test/5-6-7"); // invalid - ignored
+ assertEquals("test/5-6-7", sq.getName());
+ assertEquals(7, sq.getStart());
+ assertEquals(99, sq.getEnd());
+
+ sq.setName(null); // invalid, gets converted to space
+ assertEquals("", sq.getName());
+ assertEquals(7, sq.getStart());
+ assertEquals(99, sq.getEnd());
+ }
+
+ @Test(groups = { "Functional" })
+ public void testCheckValidRange()
+ {
+ Sequence sq = new Sequence("test/7-12", "-ABC---DE-F--");
+ assertEquals(7, sq.getStart());
+ assertEquals(12, sq.getEnd());
+
+ /*
+ * checkValidRange ensures end is at least the last residue position
+ */
+ PA.setValue(sq, "end", 2);
+ sq.checkValidRange();
+ assertEquals(12, sq.getEnd());
+
+ /*
+ * end may be beyond the last residue position
+ */
+ PA.setValue(sq, "end", 22);
+ sq.checkValidRange();
+ assertEquals(22, sq.getEnd());
+ }
+
+ @Test(groups = { "Functional" })
+ public void testDeleteChars_withGaps()
+ {
+ /*
+ * delete gaps only
+ */
+ SequenceI sq = new Sequence("test/8-10", "A-B-C");
+ sq.createDatasetSequence();
+ assertEquals("ABC", sq.getDatasetSequence().getSequenceAsString());
+ sq.deleteChars(1, 2); // delete first gap
+ assertEquals("AB-C", sq.getSequenceAsString());
+ assertEquals(8, sq.getStart());
+ assertEquals(10, sq.getEnd());
+ assertEquals("ABC", sq.getDatasetSequence().getSequenceAsString());
+
+ /*
+ * delete gaps and residues at start (no new dataset sequence)
+ */
+ sq = new Sequence("test/8-10", "A-B-C");
+ sq.createDatasetSequence();
+ sq.deleteChars(0, 3); // delete A-B
+ assertEquals("-C", sq.getSequenceAsString());
+ assertEquals(10, sq.getStart());
+ assertEquals(10, sq.getEnd());
+ assertEquals("ABC", sq.getDatasetSequence().getSequenceAsString());
+
+ /*
+ * delete gaps and residues at end (no new dataset sequence)
+ */
+ sq = new Sequence("test/8-10", "A-B-C");
+ sq.createDatasetSequence();
+ sq.deleteChars(2, 5); // delete B-C
+ assertEquals("A-", sq.getSequenceAsString());
+ assertEquals(8, sq.getStart());
+ assertEquals(8, sq.getEnd());
+ assertEquals("ABC", sq.getDatasetSequence().getSequenceAsString());
+
+ /*
+ * delete gaps and residues internally (new dataset sequence)
+ * first delete from gap to residue
+ */
+ sq = new Sequence("test/8-10", "A-B-C");
+ sq.createDatasetSequence();
+ sq.deleteChars(1, 3); // delete -B
+ assertEquals("A-C", sq.getSequenceAsString());
+ assertEquals(8, sq.getStart());
+ assertEquals(9, sq.getEnd());
+ assertEquals("AC", sq.getDatasetSequence().getSequenceAsString());
+ assertEquals(8, sq.getDatasetSequence().getStart());
+ assertEquals(9, sq.getDatasetSequence().getEnd());
+
+ /*
+ * internal delete from gap to gap
+ */
+ sq = new Sequence("test/8-10", "A-B-C");
+ sq.createDatasetSequence();
+ sq.deleteChars(1, 4); // delete -B-
+ assertEquals("AC", sq.getSequenceAsString());
+ assertEquals(8, sq.getStart());
+ assertEquals(9, sq.getEnd());
+ assertEquals("AC", sq.getDatasetSequence().getSequenceAsString());
+ assertEquals(8, sq.getDatasetSequence().getStart());
+ assertEquals(9, sq.getDatasetSequence().getEnd());
+
+ /*
+ * internal delete from residue to residue
+ */
+ sq = new Sequence("test/8-10", "A-B-C");
+ sq.createDatasetSequence();
+ sq.deleteChars(2, 3); // delete B
+ assertEquals("A--C", sq.getSequenceAsString());
+ assertEquals(8, sq.getStart());
+ assertEquals(9, sq.getEnd());
+ assertEquals("AC", sq.getDatasetSequence().getSequenceAsString());
+ assertEquals(8, sq.getDatasetSequence().getStart());
+ assertEquals(9, sq.getDatasetSequence().getEnd());
+ }
}
--- /dev/null
+package jalview.datamodel.features;
+
+import static org.testng.Assert.assertEquals;
+import static org.testng.Assert.assertFalse;
+import static org.testng.Assert.assertTrue;
+
+import jalview.datamodel.SequenceFeature;
+
+import java.util.ArrayList;
+import java.util.List;
+import java.util.Set;
+
+import org.testng.annotations.Test;
+
+public class FeatureStoreTest
+{
+
+ @Test(groups = "Functional")
+ public void testFindFeatures_nonNested()
+ {
+ FeatureStore fs = new FeatureStore();
+ fs.addFeature(new SequenceFeature("", "", 10, 20, Float.NaN,
+ null));
+ // same range different description
+ fs.addFeature(new SequenceFeature("", "desc", 10, 20, Float.NaN, null));
+ fs.addFeature(new SequenceFeature("", "", 15, 25, Float.NaN, null));
+ fs.addFeature(new SequenceFeature("", "", 20, 35, Float.NaN, null));
+
+ List<SequenceFeature> overlaps = fs.findOverlappingFeatures(1, 9);
+ assertTrue(overlaps.isEmpty());
+
+ overlaps = fs.findOverlappingFeatures(8, 10);
+ assertEquals(overlaps.size(), 2);
+ assertEquals(overlaps.get(0).getEnd(), 20);
+ assertEquals(overlaps.get(1).getEnd(), 20);
+
+ overlaps = fs.findOverlappingFeatures(12, 16);
+ assertEquals(overlaps.size(), 3);
+ assertEquals(overlaps.get(0).getEnd(), 20);
+ assertEquals(overlaps.get(1).getEnd(), 20);
+ assertEquals(overlaps.get(2).getEnd(), 25);
+
+ overlaps = fs.findOverlappingFeatures(33, 33);
+ assertEquals(overlaps.size(), 1);
+ assertEquals(overlaps.get(0).getEnd(), 35);
+ }
+
+ @Test(groups = "Functional")
+ public void testFindFeatures_nested()
+ {
+ FeatureStore fs = new FeatureStore();
+ SequenceFeature sf1 = addFeature(fs, 10, 50);
+ SequenceFeature sf2 = addFeature(fs, 10, 40);
+ SequenceFeature sf3 = addFeature(fs, 20, 30);
+ // fudge feature at same location but different group (so is added)
+ SequenceFeature sf4 = new SequenceFeature("", "", 20, 30, Float.NaN,
+ "different group");
+ fs.addFeature(sf4);
+ SequenceFeature sf5 = addFeature(fs, 35, 36);
+
+ List<SequenceFeature> overlaps = fs.findOverlappingFeatures(1, 9);
+ assertTrue(overlaps.isEmpty());
+
+ overlaps = fs.findOverlappingFeatures(10, 15);
+ assertEquals(overlaps.size(), 2);
+ assertTrue(overlaps.contains(sf1));
+ assertTrue(overlaps.contains(sf2));
+
+ overlaps = fs.findOverlappingFeatures(45, 60);
+ assertEquals(overlaps.size(), 1);
+ assertTrue(overlaps.contains(sf1));
+
+ overlaps = fs.findOverlappingFeatures(32, 38);
+ assertEquals(overlaps.size(), 3);
+ assertTrue(overlaps.contains(sf1));
+ assertTrue(overlaps.contains(sf2));
+ assertTrue(overlaps.contains(sf5));
+
+ overlaps = fs.findOverlappingFeatures(15, 25);
+ assertEquals(overlaps.size(), 4);
+ assertTrue(overlaps.contains(sf1));
+ assertTrue(overlaps.contains(sf2));
+ assertTrue(overlaps.contains(sf3));
+ assertTrue(overlaps.contains(sf4));
+ }
+
+ @Test(groups = "Functional")
+ public void testFindFeatures_mixed()
+ {
+ FeatureStore fs = new FeatureStore();
+ SequenceFeature sf1 = addFeature(fs, 10, 50);
+ SequenceFeature sf2 = addFeature(fs, 1, 15);
+ SequenceFeature sf3 = addFeature(fs, 20, 30);
+ SequenceFeature sf4 = addFeature(fs, 40, 100);
+ SequenceFeature sf5 = addFeature(fs, 60, 100);
+ SequenceFeature sf6 = addFeature(fs, 70, 70);
+
+ List<SequenceFeature> overlaps = fs.findOverlappingFeatures(200, 200);
+ assertTrue(overlaps.isEmpty());
+
+ overlaps = fs.findOverlappingFeatures(1, 9);
+ assertEquals(overlaps.size(), 1);
+ assertTrue(overlaps.contains(sf2));
+
+ overlaps = fs.findOverlappingFeatures(5, 18);
+ assertEquals(overlaps.size(), 2);
+ assertTrue(overlaps.contains(sf1));
+ assertTrue(overlaps.contains(sf2));
+
+ overlaps = fs.findOverlappingFeatures(30, 40);
+ assertEquals(overlaps.size(), 3);
+ assertTrue(overlaps.contains(sf1));
+ assertTrue(overlaps.contains(sf3));
+ assertTrue(overlaps.contains(sf4));
+
+ overlaps = fs.findOverlappingFeatures(80, 90);
+ assertEquals(overlaps.size(), 2);
+ assertTrue(overlaps.contains(sf4));
+ assertTrue(overlaps.contains(sf5));
+
+ overlaps = fs.findOverlappingFeatures(68, 70);
+ assertEquals(overlaps.size(), 3);
+ assertTrue(overlaps.contains(sf4));
+ assertTrue(overlaps.contains(sf5));
+ assertTrue(overlaps.contains(sf6));
+ }
+
+ /**
+ * Helper method to add a feature of no particular type
+ *
+ * @param fs
+ * @param from
+ * @param to
+ * @return
+ */
+ SequenceFeature addFeature(FeatureStore fs, int from, int to)
+ {
+ SequenceFeature sf1 = new SequenceFeature("", "", from, to, Float.NaN,
+ null);
+ fs.addFeature(sf1);
+ return sf1;
+ }
+
+ @Test(groups = "Functional")
+ public void testFindFeatures_contactFeatures()
+ {
+ FeatureStore fs = new FeatureStore();
+
+ SequenceFeature sf = new SequenceFeature("disulphide bond", "bond", 10,
+ 20, Float.NaN, null);
+ fs.addFeature(sf);
+
+ /*
+ * neither contact point in range
+ */
+ List<SequenceFeature> overlaps = fs.findOverlappingFeatures(1, 9);
+ assertTrue(overlaps.isEmpty());
+
+ /*
+ * neither contact point in range
+ */
+ overlaps = fs.findOverlappingFeatures(11, 19);
+ assertTrue(overlaps.isEmpty());
+
+ /*
+ * first contact point in range
+ */
+ overlaps = fs.findOverlappingFeatures(5, 15);
+ assertEquals(overlaps.size(), 1);
+ assertTrue(overlaps.contains(sf));
+
+ /*
+ * second contact point in range
+ */
+ overlaps = fs.findOverlappingFeatures(15, 25);
+ assertEquals(overlaps.size(), 1);
+ assertTrue(overlaps.contains(sf));
+
+ /*
+ * both contact points in range
+ */
+ overlaps = fs.findOverlappingFeatures(5, 25);
+ assertEquals(overlaps.size(), 1);
+ assertTrue(overlaps.contains(sf));
+ }
+
+ /**
+ * Tests for the method that returns false for an attempt to add a feature
+ * that would enclose, or be enclosed by, another feature
+ */
+ @Test(groups = "Functional")
+ public void testAddNonNestedFeature()
+ {
+ FeatureStore fs = new FeatureStore();
+
+ String type = "Domain";
+ SequenceFeature sf1 = new SequenceFeature(type, type, 10, 20,
+ Float.NaN, null);
+ assertTrue(fs.addNonNestedFeature(sf1));
+
+ // co-located feature is ok
+ SequenceFeature sf2 = new SequenceFeature(type, type, 10, 20,
+ Float.NaN, null);
+ assertTrue(fs.addNonNestedFeature(sf2));
+
+ // overlap left is ok
+ SequenceFeature sf3 = new SequenceFeature(type, type, 5, 15, Float.NaN,
+ null);
+ assertTrue(fs.addNonNestedFeature(sf3));
+
+ // overlap right is ok
+ SequenceFeature sf4 = new SequenceFeature(type, type, 15, 25,
+ Float.NaN, null);
+ assertTrue(fs.addNonNestedFeature(sf4));
+
+ // add enclosing feature is not ok
+ SequenceFeature sf5 = new SequenceFeature(type, type, 10, 21,
+ Float.NaN, null);
+ assertFalse(fs.addNonNestedFeature(sf5));
+ SequenceFeature sf6 = new SequenceFeature(type, type, 4, 15, Float.NaN,
+ null);
+ assertFalse(fs.addNonNestedFeature(sf6));
+ SequenceFeature sf7 = new SequenceFeature(type, type, 1, 50, Float.NaN,
+ null);
+ assertFalse(fs.addNonNestedFeature(sf7));
+
+ // add enclosed feature is not ok
+ SequenceFeature sf8 = new SequenceFeature(type, type, 10, 19,
+ Float.NaN, null);
+ assertFalse(fs.addNonNestedFeature(sf8));
+ SequenceFeature sf9 = new SequenceFeature(type, type, 16, 25,
+ Float.NaN, null);
+ assertFalse(fs.addNonNestedFeature(sf9));
+ SequenceFeature sf10 = new SequenceFeature(type, type, 7, 7, Float.NaN,
+ null);
+ assertFalse(fs.addNonNestedFeature(sf10));
+ }
+
+ @Test(groups = "Functional")
+ public void testGetPositionalFeatures()
+ {
+ FeatureStore store = new FeatureStore();
+ SequenceFeature sf1 = new SequenceFeature("Metal", "desc", 10, 20,
+ Float.NaN, null);
+ store.addFeature(sf1);
+ // same range, different description
+ SequenceFeature sf2 = new SequenceFeature("Metal", "desc2", 10, 20,
+ Float.NaN, null);
+ store.addFeature(sf2);
+ // discontiguous range
+ SequenceFeature sf3 = new SequenceFeature("Metal", "desc", 30, 40,
+ Float.NaN, null);
+ store.addFeature(sf3);
+ // overlapping range
+ SequenceFeature sf4 = new SequenceFeature("Metal", "desc", 15, 35,
+ Float.NaN, null);
+ store.addFeature(sf4);
+ // enclosing range
+ SequenceFeature sf5 = new SequenceFeature("Metal", "desc", 5, 50,
+ Float.NaN, null);
+ store.addFeature(sf5);
+ // non-positional feature
+ SequenceFeature sf6 = new SequenceFeature("Metal", "desc", 0, 0,
+ Float.NaN, null);
+ store.addFeature(sf6);
+ // contact feature
+ SequenceFeature sf7 = new SequenceFeature("Disulphide bond", "desc",
+ 18, 45, Float.NaN, null);
+ store.addFeature(sf7);
+
+ List<SequenceFeature> features = store.getPositionalFeatures();
+ assertEquals(features.size(), 6);
+ assertTrue(features.contains(sf1));
+ assertTrue(features.contains(sf2));
+ assertTrue(features.contains(sf3));
+ assertTrue(features.contains(sf4));
+ assertTrue(features.contains(sf5));
+ assertFalse(features.contains(sf6));
+ assertTrue(features.contains(sf7));
+
+ features = store.getNonPositionalFeatures();
+ assertEquals(features.size(), 1);
+ assertTrue(features.contains(sf6));
+ }
+
+ @Test(groups = "Functional")
+ public void testDelete()
+ {
+ FeatureStore store = new FeatureStore();
+ SequenceFeature sf1 = addFeature(store, 10, 20);
+ assertTrue(store.getPositionalFeatures().contains(sf1));
+
+ /*
+ * simple deletion
+ */
+ assertTrue(store.delete(sf1));
+ assertTrue(store.getPositionalFeatures().isEmpty());
+
+ /*
+ * non-positional feature deletion
+ */
+ SequenceFeature sf2 = addFeature(store, 0, 0);
+ assertFalse(store.getPositionalFeatures().contains(sf2));
+ assertTrue(store.getNonPositionalFeatures().contains(sf2));
+ assertTrue(store.delete(sf2));
+ assertTrue(store.getNonPositionalFeatures().isEmpty());
+
+ /*
+ * contact feature deletion
+ */
+ SequenceFeature sf3 = new SequenceFeature("", "Disulphide Bond", 11,
+ 23, Float.NaN, null);
+ store.addFeature(sf3);
+ assertEquals(store.getPositionalFeatures().size(), 1);
+ assertTrue(store.getPositionalFeatures().contains(sf3));
+ assertTrue(store.delete(sf3));
+ assertTrue(store.getPositionalFeatures().isEmpty());
+
+ /*
+ * nested feature deletion
+ */
+ SequenceFeature sf4 = addFeature(store, 20, 30);
+ SequenceFeature sf5 = addFeature(store, 22, 26); // to NCList
+ SequenceFeature sf6 = addFeature(store, 23, 24); // child of sf5
+ SequenceFeature sf7 = addFeature(store, 25, 25); // sibling of sf6
+ SequenceFeature sf8 = addFeature(store, 24, 24); // child of sf6
+ SequenceFeature sf9 = addFeature(store, 23, 23); // child of sf6
+ assertEquals(store.getPositionalFeatures().size(), 6);
+
+ // delete a node with children - they take its place
+ assertTrue(store.delete(sf6)); // sf8, sf9 should become children of sf5
+ assertEquals(store.getPositionalFeatures().size(), 5);
+ assertFalse(store.getPositionalFeatures().contains(sf6));
+
+ // delete a node with no children
+ assertTrue(store.delete(sf7));
+ assertEquals(store.getPositionalFeatures().size(), 4);
+ assertFalse(store.getPositionalFeatures().contains(sf7));
+
+ // delete root of NCList
+ assertTrue(store.delete(sf5));
+ assertEquals(store.getPositionalFeatures().size(), 3);
+ assertFalse(store.getPositionalFeatures().contains(sf5));
+
+ // continue the killing fields
+ assertTrue(store.delete(sf4));
+ assertEquals(store.getPositionalFeatures().size(), 2);
+ assertFalse(store.getPositionalFeatures().contains(sf4));
+
+ assertTrue(store.delete(sf9));
+ assertEquals(store.getPositionalFeatures().size(), 1);
+ assertFalse(store.getPositionalFeatures().contains(sf9));
+
+ assertTrue(store.delete(sf8));
+ assertTrue(store.getPositionalFeatures().isEmpty());
+ }
+
+ @Test(groups = "Functional")
+ public void testAddFeature()
+ {
+ FeatureStore fs = new FeatureStore();
+
+ SequenceFeature sf1 = new SequenceFeature("Cath", "", 10, 20,
+ Float.NaN, null);
+ SequenceFeature sf2 = new SequenceFeature("Cath", "", 10, 20,
+ Float.NaN, null);
+
+ assertTrue(fs.addFeature(sf1));
+ assertEquals(fs.getFeatureCount(true), 1); // positional
+ assertEquals(fs.getFeatureCount(false), 0); // non-positional
+
+ /*
+ * re-adding the same or an identical feature should fail
+ */
+ assertFalse(fs.addFeature(sf1));
+ assertEquals(fs.getFeatureCount(true), 1);
+ assertFalse(fs.addFeature(sf2));
+ assertEquals(fs.getFeatureCount(true), 1);
+
+ /*
+ * add non-positional
+ */
+ SequenceFeature sf3 = new SequenceFeature("Cath", "", 0, 0, Float.NaN,
+ null);
+ assertTrue(fs.addFeature(sf3));
+ assertEquals(fs.getFeatureCount(true), 1); // positional
+ assertEquals(fs.getFeatureCount(false), 1); // non-positional
+ SequenceFeature sf4 = new SequenceFeature("Cath", "", 0, 0, Float.NaN,
+ null);
+ assertFalse(fs.addFeature(sf4)); // already stored
+ assertEquals(fs.getFeatureCount(true), 1); // positional
+ assertEquals(fs.getFeatureCount(false), 1); // non-positional
+
+ /*
+ * add contact
+ */
+ SequenceFeature sf5 = new SequenceFeature("Disulfide bond", "", 10, 20,
+ Float.NaN, null);
+ assertTrue(fs.addFeature(sf5));
+ assertEquals(fs.getFeatureCount(true), 2); // positional - add 1 for contact
+ assertEquals(fs.getFeatureCount(false), 1); // non-positional
+ SequenceFeature sf6 = new SequenceFeature("Disulfide bond", "", 10, 20,
+ Float.NaN, null);
+ assertFalse(fs.addFeature(sf6)); // already stored
+ assertEquals(fs.getFeatureCount(true), 2); // no change
+ assertEquals(fs.getFeatureCount(false), 1); // no change
+ }
+
+ @Test(groups = "Functional")
+ public void testIsEmpty()
+ {
+ FeatureStore fs = new FeatureStore();
+ assertTrue(fs.isEmpty());
+ assertEquals(fs.getFeatureCount(true), 0);
+
+ /*
+ * non-nested feature
+ */
+ SequenceFeature sf1 = new SequenceFeature("Cath", "", 10, 20,
+ Float.NaN, null);
+ fs.addFeature(sf1);
+ assertFalse(fs.isEmpty());
+ assertEquals(fs.getFeatureCount(true), 1);
+ fs.delete(sf1);
+ assertTrue(fs.isEmpty());
+ assertEquals(fs.getFeatureCount(true), 0);
+
+ /*
+ * non-positional feature
+ */
+ sf1 = new SequenceFeature("Cath", "", 0, 0, Float.NaN, null);
+ fs.addFeature(sf1);
+ assertFalse(fs.isEmpty());
+ assertEquals(fs.getFeatureCount(false), 1); // non-positional
+ assertEquals(fs.getFeatureCount(true), 0); // positional
+ fs.delete(sf1);
+ assertTrue(fs.isEmpty());
+ assertEquals(fs.getFeatureCount(false), 0);
+
+ /*
+ * contact feature
+ */
+ sf1 = new SequenceFeature("Disulfide bond", "", 19, 49, Float.NaN, null);
+ fs.addFeature(sf1);
+ assertFalse(fs.isEmpty());
+ assertEquals(fs.getFeatureCount(true), 1);
+ fs.delete(sf1);
+ assertTrue(fs.isEmpty());
+ assertEquals(fs.getFeatureCount(true), 0);
+
+ /*
+ * sf2, sf3 added as nested features
+ */
+ sf1 = new SequenceFeature("Cath", "", 19, 49, Float.NaN, null);
+ SequenceFeature sf2 = new SequenceFeature("Cath", "", 20, 40,
+ Float.NaN, null);
+ SequenceFeature sf3 = new SequenceFeature("Cath", "", 25, 35,
+ Float.NaN, null);
+ fs.addFeature(sf1);
+ fs.addFeature(sf2);
+ fs.addFeature(sf3);
+ assertEquals(fs.getFeatureCount(true), 3);
+ assertTrue(fs.delete(sf1));
+ assertEquals(fs.getFeatureCount(true), 2);
+ // FeatureStore should now only contain features in the NCList
+ assertTrue(fs.nonNestedFeatures.isEmpty());
+ assertEquals(fs.nestedFeatures.size(), 2);
+ assertFalse(fs.isEmpty());
+ assertTrue(fs.delete(sf2));
+ assertEquals(fs.getFeatureCount(true), 1);
+ assertFalse(fs.isEmpty());
+ assertTrue(fs.delete(sf3));
+ assertEquals(fs.getFeatureCount(true), 0);
+ assertTrue(fs.isEmpty()); // all gone
+ }
+
+ @Test(groups = "Functional")
+ public void testGetFeatureGroups()
+ {
+ FeatureStore fs = new FeatureStore();
+ assertTrue(fs.getFeatureGroups(true).isEmpty());
+ assertTrue(fs.getFeatureGroups(false).isEmpty());
+
+ SequenceFeature sf1 = new SequenceFeature("Cath", "desc", 10, 20, 1f, "group1");
+ fs.addFeature(sf1);
+ Set<String> groups = fs.getFeatureGroups(true);
+ assertEquals(groups.size(), 1);
+ assertTrue(groups.contains("group1"));
+
+ /*
+ * add another feature of the same group, delete one, delete both
+ */
+ SequenceFeature sf2 = new SequenceFeature("Cath", "desc", 20, 30, 1f, "group1");
+ fs.addFeature(sf2);
+ groups = fs.getFeatureGroups(true);
+ assertEquals(groups.size(), 1);
+ assertTrue(groups.contains("group1"));
+ fs.delete(sf2);
+ groups = fs.getFeatureGroups(true);
+ assertEquals(groups.size(), 1);
+ assertTrue(groups.contains("group1"));
+ fs.delete(sf1);
+ groups = fs.getFeatureGroups(true);
+ assertTrue(fs.getFeatureGroups(true).isEmpty());
+
+ SequenceFeature sf3 = new SequenceFeature("Cath", "desc", 20, 30, 1f, "group2");
+ fs.addFeature(sf3);
+ SequenceFeature sf4 = new SequenceFeature("Cath", "desc", 20, 30, 1f, "Group2");
+ fs.addFeature(sf4);
+ SequenceFeature sf5 = new SequenceFeature("Cath", "desc", 20, 30, 1f, null);
+ fs.addFeature(sf5);
+ groups = fs.getFeatureGroups(true);
+ assertEquals(groups.size(), 3);
+ assertTrue(groups.contains("group2"));
+ assertTrue(groups.contains("Group2")); // case sensitive
+ assertTrue(groups.contains(null)); // null allowed
+ assertTrue(fs.getFeatureGroups(false).isEmpty()); // non-positional
+
+ fs.delete(sf3);
+ groups = fs.getFeatureGroups(true);
+ assertEquals(groups.size(), 2);
+ assertFalse(groups.contains("group2"));
+ fs.delete(sf4);
+ groups = fs.getFeatureGroups(true);
+ assertEquals(groups.size(), 1);
+ assertFalse(groups.contains("Group2"));
+ fs.delete(sf5);
+ groups = fs.getFeatureGroups(true);
+ assertTrue(groups.isEmpty());
+
+ /*
+ * add non-positional feature
+ */
+ SequenceFeature sf6 = new SequenceFeature("Cath", "desc", 0, 0, 1f,
+ "CathGroup");
+ fs.addFeature(sf6);
+ groups = fs.getFeatureGroups(false);
+ assertEquals(groups.size(), 1);
+ assertTrue(groups.contains("CathGroup"));
+ assertTrue(fs.delete(sf6));
+ assertTrue(fs.getFeatureGroups(false).isEmpty());
+ }
+
+ @Test(groups = "Functional")
+ public void testGetTotalFeatureLength()
+ {
+ FeatureStore fs = new FeatureStore();
+ assertEquals(fs.getTotalFeatureLength(), 0);
+
+ addFeature(fs, 10, 20); // 11
+ assertEquals(fs.getTotalFeatureLength(), 11);
+ addFeature(fs, 17, 37); // 21
+ SequenceFeature sf1 = addFeature(fs, 14, 74); // 61
+ assertEquals(fs.getTotalFeatureLength(), 93);
+
+ // non-positional features don't count
+ SequenceFeature sf2 = new SequenceFeature("Cath", "desc", 0, 0, 1f,
+ "group1");
+ fs.addFeature(sf2);
+ assertEquals(fs.getTotalFeatureLength(), 93);
+
+ // contact features count 1
+ SequenceFeature sf3 = new SequenceFeature("disulphide bond", "desc",
+ 15, 35, 1f, "group1");
+ fs.addFeature(sf3);
+ assertEquals(fs.getTotalFeatureLength(), 94);
+
+ assertTrue(fs.delete(sf1));
+ assertEquals(fs.getTotalFeatureLength(), 33);
+ assertFalse(fs.delete(sf1));
+ assertEquals(fs.getTotalFeatureLength(), 33);
+ assertTrue(fs.delete(sf2));
+ assertEquals(fs.getTotalFeatureLength(), 33);
+ assertTrue(fs.delete(sf3));
+ assertEquals(fs.getTotalFeatureLength(), 32);
+ }
+
+ @Test(groups = "Functional")
+ public void testGetFeatureLength()
+ {
+ /*
+ * positional feature
+ */
+ SequenceFeature sf1 = new SequenceFeature("Cath", "desc", 10, 20, 1f, "group1");
+ assertEquals(FeatureStore.getFeatureLength(sf1), 11);
+
+ /*
+ * non-positional feature
+ */
+ SequenceFeature sf2 = new SequenceFeature("Cath", "desc", 0, 0, 1f,
+ "CathGroup");
+ assertEquals(FeatureStore.getFeatureLength(sf2), 0);
+
+ /*
+ * contact feature counts 1
+ */
+ SequenceFeature sf3 = new SequenceFeature("Disulphide Bond", "desc",
+ 14, 28, 1f, "AGroup");
+ assertEquals(FeatureStore.getFeatureLength(sf3), 1);
+ }
+
+ @Test(groups = "Functional")
+ public void testMin()
+ {
+ assertEquals(FeatureStore.min(Float.NaN, Float.NaN), Float.NaN);
+ assertEquals(FeatureStore.min(Float.NaN, 2f), 2f);
+ assertEquals(FeatureStore.min(-2f, Float.NaN), -2f);
+ assertEquals(FeatureStore.min(2f, -3f), -3f);
+ }
+
+ @Test(groups = "Functional")
+ public void testMax()
+ {
+ assertEquals(FeatureStore.max(Float.NaN, Float.NaN), Float.NaN);
+ assertEquals(FeatureStore.max(Float.NaN, 2f), 2f);
+ assertEquals(FeatureStore.max(-2f, Float.NaN), -2f);
+ assertEquals(FeatureStore.max(2f, -3f), 2f);
+ }
+
+ @Test(groups = "Functional")
+ public void testGetMinimumScore_getMaximumScore()
+ {
+ FeatureStore fs = new FeatureStore();
+ assertEquals(fs.getMinimumScore(true), Float.NaN); // positional
+ assertEquals(fs.getMaximumScore(true), Float.NaN);
+ assertEquals(fs.getMinimumScore(false), Float.NaN); // non-positional
+ assertEquals(fs.getMaximumScore(false), Float.NaN);
+
+ // add features with no score
+ SequenceFeature sf1 = new SequenceFeature("type", "desc", 0, 0,
+ Float.NaN, "group");
+ fs.addFeature(sf1);
+ SequenceFeature sf2 = new SequenceFeature("type", "desc", 10, 20,
+ Float.NaN, "group");
+ fs.addFeature(sf2);
+ assertEquals(fs.getMinimumScore(true), Float.NaN);
+ assertEquals(fs.getMaximumScore(true), Float.NaN);
+ assertEquals(fs.getMinimumScore(false), Float.NaN);
+ assertEquals(fs.getMaximumScore(false), Float.NaN);
+
+ // add positional features with score
+ SequenceFeature sf3 = new SequenceFeature("type", "desc", 10, 20, 1f,
+ "group");
+ fs.addFeature(sf3);
+ SequenceFeature sf4 = new SequenceFeature("type", "desc", 12, 16, 4f,
+ "group");
+ fs.addFeature(sf4);
+ assertEquals(fs.getMinimumScore(true), 1f);
+ assertEquals(fs.getMaximumScore(true), 4f);
+ assertEquals(fs.getMinimumScore(false), Float.NaN);
+ assertEquals(fs.getMaximumScore(false), Float.NaN);
+
+ // add non-positional features with score
+ SequenceFeature sf5 = new SequenceFeature("type", "desc", 0, 0, 11f,
+ "group");
+ fs.addFeature(sf5);
+ SequenceFeature sf6 = new SequenceFeature("type", "desc", 0, 0, -7f,
+ "group");
+ fs.addFeature(sf6);
+ assertEquals(fs.getMinimumScore(true), 1f);
+ assertEquals(fs.getMaximumScore(true), 4f);
+ assertEquals(fs.getMinimumScore(false), -7f);
+ assertEquals(fs.getMaximumScore(false), 11f);
+
+ // delete one positional and one non-positional
+ // min-max should be recomputed
+ assertTrue(fs.delete(sf6));
+ assertTrue(fs.delete(sf3));
+ assertEquals(fs.getMinimumScore(true), 4f);
+ assertEquals(fs.getMaximumScore(true), 4f);
+ assertEquals(fs.getMinimumScore(false), 11f);
+ assertEquals(fs.getMaximumScore(false), 11f);
+
+ // delete remaining features with score
+ assertTrue(fs.delete(sf4));
+ assertTrue(fs.delete(sf5));
+ assertEquals(fs.getMinimumScore(true), Float.NaN);
+ assertEquals(fs.getMaximumScore(true), Float.NaN);
+ assertEquals(fs.getMinimumScore(false), Float.NaN);
+ assertEquals(fs.getMaximumScore(false), Float.NaN);
+
+ // delete all features
+ assertTrue(fs.delete(sf1));
+ assertTrue(fs.delete(sf2));
+ assertTrue(fs.isEmpty());
+ assertEquals(fs.getMinimumScore(true), Float.NaN);
+ assertEquals(fs.getMaximumScore(true), Float.NaN);
+ assertEquals(fs.getMinimumScore(false), Float.NaN);
+ assertEquals(fs.getMaximumScore(false), Float.NaN);
+ }
+
+ @Test(groups = "Functional")
+ public void testListContains()
+ {
+ assertFalse(FeatureStore.listContains(null, null));
+ List<SequenceFeature> features = new ArrayList<SequenceFeature>();
+ assertFalse(FeatureStore.listContains(features, null));
+
+ SequenceFeature sf1 = new SequenceFeature("type1", "desc1", 20, 30, 3f,
+ "group1");
+ assertFalse(FeatureStore.listContains(null, sf1));
+ assertFalse(FeatureStore.listContains(features, sf1));
+
+ features.add(sf1);
+ SequenceFeature sf2 = new SequenceFeature("type1", "desc1", 20, 30, 3f,
+ "group1");
+ SequenceFeature sf3 = new SequenceFeature("type1", "desc1", 20, 40, 3f,
+ "group1");
+
+ // sf2.equals(sf1) so contains should return true
+ assertTrue(FeatureStore.listContains(features, sf2));
+ assertFalse(FeatureStore.listContains(features, sf3));
+ }
+
+ @Test(groups = "Functional")
+ public void testGetFeaturesForGroup()
+ {
+ FeatureStore fs = new FeatureStore();
+
+ /*
+ * with no features
+ */
+ assertTrue(fs.getFeaturesForGroup(true, null).isEmpty());
+ assertTrue(fs.getFeaturesForGroup(false, null).isEmpty());
+ assertTrue(fs.getFeaturesForGroup(true, "uniprot").isEmpty());
+ assertTrue(fs.getFeaturesForGroup(false, "uniprot").isEmpty());
+
+ /*
+ * sf1: positional feature in the null group
+ */
+ SequenceFeature sf1 = new SequenceFeature("Pfam", "desc", 4, 10, 0f,
+ null);
+ fs.addFeature(sf1);
+ assertTrue(fs.getFeaturesForGroup(true, "uniprot").isEmpty());
+ assertTrue(fs.getFeaturesForGroup(false, "uniprot").isEmpty());
+ assertTrue(fs.getFeaturesForGroup(false, null).isEmpty());
+ List<SequenceFeature> features = fs.getFeaturesForGroup(true, null);
+ assertEquals(features.size(), 1);
+ assertTrue(features.contains(sf1));
+
+ /*
+ * sf2: non-positional feature in the null group
+ * sf3: positional feature in a non-null group
+ * sf4: non-positional feature in a non-null group
+ */
+ SequenceFeature sf2 = new SequenceFeature("Pfam", "desc", 0, 0, 0f,
+ null);
+ SequenceFeature sf3 = new SequenceFeature("Pfam", "desc", 4, 10, 0f,
+ "Uniprot");
+ SequenceFeature sf4 = new SequenceFeature("Pfam", "desc", 0, 0, 0f,
+ "Rfam");
+ fs.addFeature(sf2);
+ fs.addFeature(sf3);
+ fs.addFeature(sf4);
+
+ features = fs.getFeaturesForGroup(true, null);
+ assertEquals(features.size(), 1);
+ assertTrue(features.contains(sf1));
+
+ features = fs.getFeaturesForGroup(false, null);
+ assertEquals(features.size(), 1);
+ assertTrue(features.contains(sf2));
+
+ features = fs.getFeaturesForGroup(true, "Uniprot");
+ assertEquals(features.size(), 1);
+ assertTrue(features.contains(sf3));
+
+ features = fs.getFeaturesForGroup(false, "Rfam");
+ assertEquals(features.size(), 1);
+ assertTrue(features.contains(sf4));
+ }
+
+ @Test(groups = "Functional")
+ public void testShiftFeatures()
+ {
+ FeatureStore fs = new FeatureStore();
+ assertFalse(fs.shiftFeatures(1));
+
+ SequenceFeature sf1 = new SequenceFeature("Cath", "", 2, 5, 0f, null);
+ fs.addFeature(sf1);
+ // nested feature:
+ SequenceFeature sf2 = new SequenceFeature("Cath", "", 8, 14, 0f, null);
+ fs.addFeature(sf2);
+ // contact feature:
+ SequenceFeature sf3 = new SequenceFeature("Disulfide bond", "", 23, 32,
+ 0f, null);
+ fs.addFeature(sf3);
+ // non-positional feature:
+ SequenceFeature sf4 = new SequenceFeature("Cath", "", 0, 0, 0f, null);
+ fs.addFeature(sf4);
+
+ /*
+ * shift features right by 5
+ */
+ assertTrue(fs.shiftFeatures(5));
+
+ // non-positional features untouched:
+ List<SequenceFeature> nonPos = fs.getNonPositionalFeatures();
+ assertEquals(nonPos.size(), 1);
+ assertTrue(nonPos.contains(sf4));
+
+ // positional features are replaced
+ List<SequenceFeature> pos = fs.getPositionalFeatures();
+ assertEquals(pos.size(), 3);
+ assertFalse(pos.contains(sf1));
+ assertFalse(pos.contains(sf2));
+ assertFalse(pos.contains(sf3));
+ SequenceFeatures.sortFeatures(pos, true); // ascending start pos
+ assertEquals(pos.get(0).getBegin(), 7);
+ assertEquals(pos.get(0).getEnd(), 10);
+ assertEquals(pos.get(1).getBegin(), 13);
+ assertEquals(pos.get(1).getEnd(), 19);
+ assertEquals(pos.get(2).getBegin(), 28);
+ assertEquals(pos.get(2).getEnd(), 37);
+
+ /*
+ * now shift left by 15
+ * feature at [7-10] should be removed
+ * feature at [13-19] should become [1-4]
+ */
+ assertTrue(fs.shiftFeatures(-15));
+ pos = fs.getPositionalFeatures();
+ assertEquals(pos.size(), 2);
+ SequenceFeatures.sortFeatures(pos, true);
+ assertEquals(pos.get(0).getBegin(), 1);
+ assertEquals(pos.get(0).getEnd(), 4);
+ assertEquals(pos.get(1).getBegin(), 13);
+ assertEquals(pos.get(1).getEnd(), 22);
+ }
+
+ @Test(groups = "Functional")
+ public void testDelete_readd()
+ {
+ /*
+ * add a feature and a nested feature
+ */
+ FeatureStore store = new FeatureStore();
+ SequenceFeature sf1 = addFeature(store, 10, 20);
+ // sf2 is nested in sf1 so will be stored in nestedFeatures
+ SequenceFeature sf2 = addFeature(store, 12, 14);
+ List<SequenceFeature> features = store.getPositionalFeatures();
+ assertEquals(features.size(), 2);
+ assertTrue(features.contains(sf1));
+ assertTrue(features.contains(sf2));
+ assertTrue(store.nonNestedFeatures.contains(sf1));
+ assertTrue(store.nestedFeatures.contains(sf2));
+
+ /*
+ * delete the first feature
+ */
+ assertTrue(store.delete(sf1));
+ features = store.getPositionalFeatures();
+ assertFalse(features.contains(sf1));
+ assertTrue(features.contains(sf2));
+
+ /*
+ * re-add the 'nested' feature; is it now duplicated?
+ */
+ store.addFeature(sf2);
+ features = store.getPositionalFeatures();
+ assertEquals(features.size(), 1);
+ assertTrue(features.contains(sf2));
+ }
+
+ @Test(groups = "Functional")
+ public void testContains()
+ {
+ FeatureStore fs = new FeatureStore();
+ SequenceFeature sf1 = new SequenceFeature("Cath", "", 10, 20,
+ Float.NaN, "group1");
+ SequenceFeature sf2 = new SequenceFeature("Cath", "", 10, 20,
+ Float.NaN, "group2");
+ SequenceFeature sf3 = new SequenceFeature("Cath", "", 0, 0, Float.NaN,
+ "group1");
+ SequenceFeature sf4 = new SequenceFeature("Cath", "", 0, 0, 0f,
+ "group1");
+ SequenceFeature sf5 = new SequenceFeature("Disulphide Bond", "", 5, 15,
+ Float.NaN, "group1");
+ SequenceFeature sf6 = new SequenceFeature("Disulphide Bond", "", 5, 15,
+ Float.NaN, "group2");
+
+ fs.addFeature(sf1);
+ fs.addFeature(sf3);
+ fs.addFeature(sf5);
+ assertTrue(fs.contains(sf1)); // positional feature
+ assertTrue(fs.contains(new SequenceFeature(sf1))); // identical feature
+ assertFalse(fs.contains(sf2)); // different group
+ assertTrue(fs.contains(sf3)); // non-positional
+ assertTrue(fs.contains(new SequenceFeature(sf3)));
+ assertFalse(fs.contains(sf4)); // different score
+ assertTrue(fs.contains(sf5)); // contact feature
+ assertTrue(fs.contains(new SequenceFeature(sf5)));
+ assertFalse(fs.contains(sf6)); // different group
+
+ /*
+ * add a nested feature
+ */
+ SequenceFeature sf7 = new SequenceFeature("Cath", "", 12, 16,
+ Float.NaN, "group1");
+ fs.addFeature(sf7);
+ assertTrue(fs.contains(sf7));
+ assertTrue(fs.contains(new SequenceFeature(sf7)));
+
+ /*
+ * delete the outer (enclosing, non-nested) feature
+ */
+ fs.delete(sf1);
+ assertFalse(fs.contains(sf1));
+ assertTrue(fs.contains(sf7));
+ }
+}
--- /dev/null
+package jalview.datamodel.features;
+import static org.testng.Assert.assertEquals;
+import static org.testng.Assert.assertFalse;
+import static org.testng.Assert.assertSame;
+import static org.testng.Assert.assertTrue;
+
+import jalview.datamodel.ContiguousI;
+import jalview.datamodel.Range;
+import jalview.datamodel.SequenceFeature;
+
+import java.util.ArrayList;
+import java.util.Collections;
+import java.util.Comparator;
+import java.util.List;
+import java.util.Random;
+
+import junit.extensions.PA;
+
+import org.testng.annotations.DataProvider;
+import org.testng.annotations.Test;
+
+public class NCListTest
+{
+
+ private Random random = new Random(107);
+
+ private Comparator<ContiguousI> sorter = new RangeComparator(true);
+
+ /**
+ * A basic sanity test of the constructor
+ */
+ @Test(groups = "Functional")
+ public void testConstructor()
+ {
+ List<Range> ranges = new ArrayList<Range>();
+ ranges.add(new Range(20, 20));
+ ranges.add(new Range(10, 20));
+ ranges.add(new Range(15, 30));
+ ranges.add(new Range(10, 30));
+ ranges.add(new Range(11, 19));
+ ranges.add(new Range(10, 20));
+ ranges.add(new Range(1, 100));
+
+ NCList<Range> ncl = new NCList<Range>(ranges);
+ String expected = "[1-100 [10-30 [10-20 [10-20 [11-19]]]], 15-30 [20-20]]";
+ assertEquals(ncl.toString(), expected);
+ assertTrue(ncl.isValid());
+
+ Collections.reverse(ranges);
+ ncl = new NCList<Range>(ranges);
+ assertEquals(ncl.toString(), expected);
+ assertTrue(ncl.isValid());
+ }
+
+ @Test(groups = "Functional")
+ public void testFindOverlaps()
+ {
+ List<Range> ranges = new ArrayList<Range>();
+ ranges.add(new Range(20, 50));
+ ranges.add(new Range(30, 70));
+ ranges.add(new Range(1, 100));
+ ranges.add(new Range(70, 120));
+
+ NCList<Range> ncl = new NCList<Range>(ranges);
+
+ List<Range> overlaps = ncl.findOverlaps(121, 122);
+ assertEquals(overlaps.size(), 0);
+
+ overlaps = ncl.findOverlaps(21, 22);
+ assertEquals(overlaps.size(), 2);
+ assertEquals(((ContiguousI) overlaps.get(0)).getBegin(), 1);
+ assertEquals(((ContiguousI) overlaps.get(0)).getEnd(), 100);
+ assertEquals(((ContiguousI) overlaps.get(1)).getBegin(), 20);
+ assertEquals(((ContiguousI) overlaps.get(1)).getEnd(), 50);
+
+ overlaps = ncl.findOverlaps(110, 110);
+ assertEquals(overlaps.size(), 1);
+ assertEquals(((ContiguousI) overlaps.get(0)).getBegin(), 70);
+ assertEquals(((ContiguousI) overlaps.get(0)).getEnd(), 120);
+ }
+
+ @Test(groups = "Functional")
+ public void testAdd_onTheEnd()
+ {
+ List<Range> ranges = new ArrayList<Range>();
+ ranges.add(new Range(20, 50));
+ NCList<Range> ncl = new NCList<Range>(ranges);
+ assertEquals(ncl.toString(), "[20-50]");
+ assertTrue(ncl.isValid());
+
+ ncl.add(new Range(60, 70));
+ assertEquals(ncl.toString(), "[20-50, 60-70]");
+ assertTrue(ncl.isValid());
+ }
+
+ @Test(groups = "Functional")
+ public void testAdd_inside()
+ {
+ List<Range> ranges = new ArrayList<Range>();
+ ranges.add(new Range(20, 50));
+ NCList<Range> ncl = new NCList<Range>(ranges);
+ assertEquals(ncl.toString(), "[20-50]");
+ assertTrue(ncl.isValid());
+
+ ncl.add(new Range(30, 40));
+ assertEquals(ncl.toString(), "[20-50 [30-40]]");
+ }
+
+ @Test(groups = "Functional")
+ public void testAdd_onTheFront()
+ {
+ List<Range> ranges = new ArrayList<Range>();
+ ranges.add(new Range(20, 50));
+ NCList<Range> ncl = new NCList<Range>(ranges);
+ assertEquals(ncl.toString(), "[20-50]");
+ assertTrue(ncl.isValid());
+
+ ncl.add(new Range(5, 15));
+ assertEquals(ncl.toString(), "[5-15, 20-50]");
+ assertTrue(ncl.isValid());
+ }
+
+ @Test(groups = "Functional")
+ public void testAdd_enclosing()
+ {
+ List<Range> ranges = new ArrayList<Range>();
+ ranges.add(new Range(20, 50));
+ ranges.add(new Range(30, 60));
+ NCList<Range> ncl = new NCList<Range>(ranges);
+ assertEquals(ncl.toString(), "[20-50, 30-60]");
+ assertTrue(ncl.isValid());
+ assertEquals(ncl.getStart(), 20);
+
+ ncl.add(new Range(10, 70));
+ assertEquals(ncl.toString(), "[10-70 [20-50, 30-60]]");
+ assertTrue(ncl.isValid());
+ }
+
+ @Test(groups = "Functional")
+ public void testAdd_spanning()
+ {
+ List<Range> ranges = new ArrayList<Range>();
+ ranges.add(new Range(20, 40));
+ ranges.add(new Range(60, 70));
+ NCList<Range> ncl = new NCList<Range>(ranges);
+ assertEquals(ncl.toString(), "[20-40, 60-70]");
+ assertTrue(ncl.isValid());
+
+ ncl.add(new Range(30, 50));
+ assertEquals(ncl.toString(), "[20-40, 30-50, 60-70]");
+ assertTrue(ncl.isValid());
+
+ ncl.add(new Range(40, 65));
+ assertEquals(ncl.toString(), "[20-40, 30-50, 40-65, 60-70]");
+ assertTrue(ncl.isValid());
+ }
+
+ /**
+ * Provides the scales for pseudo-random NCLists i.e. the range of the maximal
+ * [0-scale] interval to be stored
+ *
+ * @return
+ */
+ @DataProvider(name = "scalesOfLife")
+ public Object[][] getScales()
+ {
+ return new Object[][] { new Integer[] { 10 }, new Integer[] { 100 } };
+ }
+
+ /**
+ * Do a number of pseudo-random (reproducible) builds of an NCList, to
+ * exercise as many methods of the class as possible while generating the
+ * range of possible structure topologies
+ * <ul>
+ * <li>verify that add adds an entry and increments size</li>
+ * <li>...except where the entry is already contained (by equals test)</li>
+ * <li>verify that the structure is valid at all stages of construction</li>
+ * <li>generate, run and verify a range of overlap queries</li>
+ * <li>tear down the structure by deleting entries, verifying correctness at
+ * each stage</li>
+ * </ul>
+ */
+ @Test(groups = "Functional", dataProvider = "scalesOfLife")
+ public void test_pseudoRandom(Integer scale)
+ {
+ NCList<SequenceFeature> ncl = new NCList<SequenceFeature>();
+ List<SequenceFeature> features = new ArrayList<SequenceFeature>(scale);
+
+ testAdd_pseudoRandom(scale, ncl, features);
+
+ /*
+ * sort the list of added ranges - this doesn't affect the test,
+ * just makes it easier to inspect the data in the debugger
+ */
+ Collections.sort(features, sorter);
+
+ testFindOverlaps_pseudoRandom(ncl, scale, features);
+
+ testDelete_pseudoRandom(ncl, features);
+ }
+
+ /**
+ * Pick randomly selected entries to delete in turn, checking the NCList size
+ * and validity at each stage, until it is empty
+ *
+ * @param ncl
+ * @param features
+ */
+ protected void testDelete_pseudoRandom(NCList<SequenceFeature> ncl,
+ List<SequenceFeature> features)
+ {
+ int deleted = 0;
+
+ while (!features.isEmpty())
+ {
+ assertEquals(ncl.size(), features.size());
+ int toDelete = random.nextInt(features.size());
+ SequenceFeature entry = features.get(toDelete);
+ assertTrue(ncl.contains(entry), String.format(
+ "NCList doesn't contain entry [%d] '%s'!", deleted,
+ entry.toString()));
+
+ ncl.delete(entry);
+ assertFalse(ncl.contains(entry), String.format(
+ "NCList still contains deleted entry [%d] '%s'!", deleted,
+ entry.toString()));
+ features.remove(toDelete);
+ deleted++;
+
+ assertTrue(ncl.isValid(), String.format(
+ "NCList invalid after %d deletions, last deleted was '%s'",
+ deleted, entry.toString()));
+
+ /*
+ * brute force check that deleting one entry didn't delete any others
+ */
+ for (int i = 0; i < features.size(); i++)
+ {
+ SequenceFeature sf = features.get(i);
+ assertTrue(ncl.contains(sf), String.format(
+ "NCList doesn't contain entry [%d] %s after deleting '%s'!",
+ i, sf.toString(), entry.toString()));
+ }
+ }
+ assertEquals(ncl.size(), 0); // all gone
+ }
+
+ /**
+ * Randomly generate entries and add them to the NCList, checking its validity
+ * and size at each stage. A few entries should be duplicates (by equals test)
+ * so not get added.
+ *
+ * @param scale
+ * @param ncl
+ * @param features
+ */
+ protected void testAdd_pseudoRandom(Integer scale,
+ NCList<SequenceFeature> ncl,
+ List<SequenceFeature> features)
+ {
+ int count = 0;
+ final int size = 50;
+
+ for (int i = 0; i < size; i++)
+ {
+ int r1 = random.nextInt(scale + 1);
+ int r2 = random.nextInt(scale + 1);
+ int from = Math.min(r1, r2);
+ int to = Math.max(r1, r2);
+
+ /*
+ * choice of two feature values means that occasionally an identical
+ * feature may be generated, in which case it should not be added
+ */
+ float value = (float) i % 2;
+ SequenceFeature feature = new SequenceFeature("Pfam", "", from, to,
+ value, "group");
+
+ /*
+ * add to NCList - with duplicate entries (by equals) disallowed
+ */
+ ncl.add(feature, false);
+ if (features.contains(feature))
+ {
+ System.out.println("Duplicate feature generated "
+ + feature.toString());
+ }
+ else
+ {
+ features.add(feature);
+ count++;
+ }
+
+ /*
+ * check list format is valid at each stage of its construction
+ */
+ assertTrue(ncl.isValid(),
+ String.format("Failed for scale = %d, i=%d", scale, i));
+ assertEquals(ncl.size(), count);
+ }
+ // System.out.println(ncl.prettyPrint());
+ }
+
+ /**
+ * A helper method that generates pseudo-random range queries and veries that
+ * findOverlaps returns the correct matches
+ *
+ * @param ncl
+ * the NCList to query
+ * @param scale
+ * ncl maximal range is [0, scale]
+ * @param features
+ * a list of the ranges stored in ncl
+ */
+ protected void testFindOverlaps_pseudoRandom(NCList<SequenceFeature> ncl,
+ int scale,
+ List<SequenceFeature> features)
+ {
+ int halfScale = scale / 2;
+ int minIterations = 20;
+
+ /*
+ * generates ranges in [-halfScale, scale+halfScale]
+ * - some should be internal to [0, scale] P = 1/4
+ * - some should lie before 0 P = 1/16
+ * - some should lie after scale P = 1/16
+ * - some should overlap left P = 1/4
+ * - some should overlap right P = 1/4
+ * - some should enclose P = 1/8
+ *
+ * 50 iterations give a 96% probability of including the
+ * unlikeliest case; keep going until we have done all!
+ */
+ boolean inside = false;
+ boolean enclosing = false;
+ boolean before = false;
+ boolean after = false;
+ boolean overlapLeft = false;
+ boolean overlapRight = false;
+ boolean allCasesCovered = false;
+
+ int i = 0;
+ while (i < minIterations || !allCasesCovered)
+ {
+ i++;
+ int r1 = random.nextInt((scale + 1) * 2);
+ int r2 = random.nextInt((scale + 1) * 2);
+ int from = Math.min(r1, r2) - halfScale;
+ int to = Math.max(r1, r2) - halfScale;
+
+ /*
+ * ensure all cases of interest get covered
+ */
+ inside |= from >= 0 && to <= scale;
+ enclosing |= from <= 0 && to >= scale;
+ before |= to < 0;
+ after |= from > scale;
+ overlapLeft |= from < 0 && to >= 0 && to <= scale;
+ overlapRight |= from >= 0 && from <= scale && to > scale;
+ if (!allCasesCovered)
+ {
+ allCasesCovered |= inside && enclosing && before && after
+ && overlapLeft && overlapRight;
+ if (allCasesCovered)
+ {
+ System.out
+ .println(String
+ .format("Covered all findOverlaps cases after %d iterations for scale %d",
+ i, scale));
+ }
+ }
+
+ verifyFindOverlaps(ncl, from, to, features);
+ }
+ }
+
+ /**
+ * A helper method that verifies that overlaps found by interrogating an
+ * NCList correctly match those found by brute force search
+ *
+ * @param ncl
+ * @param from
+ * @param to
+ * @param features
+ */
+ protected void verifyFindOverlaps(NCList<SequenceFeature> ncl, int from,
+ int to, List<SequenceFeature> features)
+ {
+ List<SequenceFeature> overlaps = ncl.findOverlaps(from, to);
+
+ /*
+ * check returned entries do indeed overlap from-to range
+ */
+ for (ContiguousI sf : overlaps)
+ {
+ int begin = sf.getBegin();
+ int end = sf.getEnd();
+ assertTrue(begin <= to && end >= from, String.format(
+ "[%d, %d] does not overlap query range [%d, %d]", begin, end,
+ from, to));
+ }
+
+ /*
+ * check overlapping ranges are included in the results
+ * (the test above already shows non-overlapping ranges are not)
+ */
+ for (ContiguousI sf : features)
+ {
+ int begin = sf.getBegin();
+ int end = sf.getEnd();
+ if (begin <= to && end >= from)
+ {
+ boolean found = overlaps.contains(sf);
+ assertTrue(found, String.format(
+ "[%d, %d] missing in query range [%d, %d]", begin, end,
+ from, to));
+ }
+ }
+ }
+
+ @Test(groups = "Functional")
+ public void testGetEntries()
+ {
+ List<Range> ranges = new ArrayList<Range>();
+ Range r1 = new Range(20, 20);
+ Range r2 = new Range(10, 20);
+ Range r3 = new Range(15, 30);
+ Range r4 = new Range(10, 30);
+ Range r5 = new Range(11, 19);
+ Range r6 = new Range(10, 20);
+ ranges.add(r1);
+ ranges.add(r2);
+ ranges.add(r3);
+ ranges.add(r4);
+ ranges.add(r5);
+ ranges.add(r6);
+
+ NCList<Range> ncl = new NCList<Range>(ranges);
+ Range r7 = new Range(1, 100);
+ ncl.add(r7);
+
+ List<Range> contents = ncl.getEntries();
+ assertEquals(contents.size(), 7);
+ assertTrue(contents.contains(r1));
+ assertTrue(contents.contains(r2));
+ assertTrue(contents.contains(r3));
+ assertTrue(contents.contains(r4));
+ assertTrue(contents.contains(r5));
+ assertTrue(contents.contains(r6));
+ assertTrue(contents.contains(r7));
+
+ ncl = new NCList<Range>();
+ assertTrue(ncl.getEntries().isEmpty());
+ }
+
+ @Test(groups = "Functional")
+ public void testDelete()
+ {
+ List<Range> ranges = new ArrayList<Range>();
+ Range r1 = new Range(20, 30);
+ ranges.add(r1);
+ NCList<Range> ncl = new NCList<Range>(ranges);
+ assertTrue(ncl.getEntries().contains(r1));
+
+ Range r2 = new Range(20, 30);
+ assertFalse(ncl.delete(null)); // null argument
+ assertFalse(ncl.delete(r2)); // never added
+ assertTrue(ncl.delete(r1)); // success
+ assertTrue(ncl.getEntries().isEmpty());
+
+ /*
+ * tests where object.equals() == true
+ */
+ NCList<SequenceFeature> features = new NCList<SequenceFeature>();
+ SequenceFeature sf1 = new SequenceFeature("type", "desc", 1, 10, 2f,
+ "group");
+ SequenceFeature sf2 = new SequenceFeature("type", "desc", 1, 10, 2f,
+ "group");
+ features.add(sf1);
+ assertEquals(sf1, sf2); // sf1.equals(sf2)
+ assertFalse(features.delete(sf2)); // equality is not enough for deletion
+ assertTrue(features.getEntries().contains(sf1)); // still there!
+ assertTrue(features.delete(sf1));
+ assertTrue(features.getEntries().isEmpty()); // gone now
+
+ /*
+ * test with duplicate objects in NCList
+ */
+ features.add(sf1);
+ features.add(sf1);
+ assertEquals(features.getEntries().size(), 2);
+ assertSame(features.getEntries().get(0), sf1);
+ assertSame(features.getEntries().get(1), sf1);
+ assertTrue(features.delete(sf1)); // first match only is deleted
+ assertTrue(features.contains(sf1));
+ assertEquals(features.size(), 1);
+ assertTrue(features.delete(sf1));
+ assertTrue(features.getEntries().isEmpty());
+ }
+
+ @Test(groups = "Functional")
+ public void testAdd_overlapping()
+ {
+ List<Range> ranges = new ArrayList<Range>();
+ ranges.add(new Range(40, 50));
+ ranges.add(new Range(20, 30));
+ NCList<Range> ncl = new NCList<Range>(ranges);
+ assertEquals(ncl.toString(), "[20-30, 40-50]");
+ assertTrue(ncl.isValid());
+
+ /*
+ * add range overlapping internally
+ */
+ ncl.add(new Range(25, 35));
+ assertEquals(ncl.toString(), "[20-30, 25-35, 40-50]");
+ assertTrue(ncl.isValid());
+
+ /*
+ * add range overlapping last range
+ */
+ ncl.add(new Range(45, 55));
+ assertEquals(ncl.toString(), "[20-30, 25-35, 40-50, 45-55]");
+ assertTrue(ncl.isValid());
+
+ /*
+ * add range overlapping first range
+ */
+ ncl.add(new Range(15, 25));
+ assertEquals(ncl.toString(), "[15-25, 20-30, 25-35, 40-50, 45-55]");
+ assertTrue(ncl.isValid());
+ }
+
+ /**
+ * Test the contains method (which uses object equals test)
+ */
+ @Test(groups = "Functional")
+ public void testContains()
+ {
+ NCList<SequenceFeature> ncl = new NCList<SequenceFeature>();
+ SequenceFeature sf1 = new SequenceFeature("type", "desc", 1, 10, 2f,
+ "group");
+ SequenceFeature sf2 = new SequenceFeature("type", "desc", 1, 10, 2f,
+ "group");
+ SequenceFeature sf3 = new SequenceFeature("type", "desc", 1, 10, 2f,
+ "anothergroup");
+ ncl.add(sf1);
+
+ assertTrue(ncl.contains(sf1));
+ assertTrue(ncl.contains(sf2)); // sf1.equals(sf2)
+ assertFalse(ncl.contains(sf3)); // !sf1.equals(sf3)
+
+ /*
+ * make some deeper structure in the NCList
+ */
+ SequenceFeature sf4 = new SequenceFeature("type", "desc", 2, 9, 2f,
+ "group");
+ ncl.add(sf4);
+ assertTrue(ncl.contains(sf4));
+ SequenceFeature sf5 = new SequenceFeature("type", "desc", 4, 5, 2f,
+ "group");
+ SequenceFeature sf6 = new SequenceFeature("type", "desc", 6, 8, 2f,
+ "group");
+ ncl.add(sf5);
+ ncl.add(sf6);
+ assertTrue(ncl.contains(sf5));
+ assertTrue(ncl.contains(sf6));
+ }
+
+ @Test(groups = "Functional")
+ public void testIsValid()
+ {
+ List<Range> ranges = new ArrayList<Range>();
+ Range r1 = new Range(40, 50);
+ ranges.add(r1);
+ NCList<Range> ncl = new NCList<Range>(ranges);
+ assertTrue(ncl.isValid());
+
+ Range r2 = new Range(42, 44);
+ ncl.add(r2);
+ assertTrue(ncl.isValid());
+ Range r3 = new Range(46, 48);
+ ncl.add(r3);
+ assertTrue(ncl.isValid());
+ Range r4 = new Range(43, 43);
+ ncl.add(r4);
+ assertTrue(ncl.isValid());
+
+ assertEquals(ncl.toString(), "[40-50 [42-44 [43-43], 46-48]]");
+ assertTrue(ncl.isValid());
+
+ PA.setValue(r1, "start", 43);
+ assertFalse(ncl.isValid()); // r2 not inside r1
+ PA.setValue(r1, "start", 40);
+ assertTrue(ncl.isValid());
+
+ PA.setValue(r3, "start", 41);
+ assertFalse(ncl.isValid()); // r3 should precede r2
+ PA.setValue(r3, "start", 46);
+ assertTrue(ncl.isValid());
+
+ PA.setValue(r4, "start", 41);
+ assertFalse(ncl.isValid()); // r4 not inside r2
+ PA.setValue(r4, "start", 43);
+ assertTrue(ncl.isValid());
+
+ PA.setValue(r4, "start", 44);
+ assertFalse(ncl.isValid()); // r4 has reverse range
+ }
+
+ @Test(groups = "Functional")
+ public void testPrettyPrint()
+ {
+ /*
+ * construct NCList from a list of ranges
+ * they are sorted then assembled into NCList subregions
+ * notice that 42-42 end up inside 41-46
+ */
+ List<Range> ranges = new ArrayList<Range>();
+ ranges.add(new Range(40, 50));
+ ranges.add(new Range(45, 55));
+ ranges.add(new Range(40, 45));
+ ranges.add(new Range(41, 46));
+ ranges.add(new Range(42, 42));
+ ranges.add(new Range(42, 42));
+ NCList<Range> ncl = new NCList<Range>(ranges);
+ assertTrue(ncl.isValid());
+ assertEquals(ncl.toString(),
+ "[40-50 [40-45], 41-46 [42-42 [42-42]], 45-55]");
+ String expected = "40-50\n 40-45\n41-46\n 42-42\n 42-42\n45-55\n";
+ assertEquals(ncl.prettyPrint(), expected);
+
+ /*
+ * repeat but now add ranges one at a time
+ * notice that 42-42 end up inside 40-50 so we get
+ * a different but equal valid NCList structure
+ */
+ ranges.clear();
+ ncl = new NCList<Range>(ranges);
+ ncl.add(new Range(40, 50));
+ ncl.add(new Range(45, 55));
+ ncl.add(new Range(40, 45));
+ ncl.add(new Range(41, 46));
+ ncl.add(new Range(42, 42));
+ ncl.add(new Range(42, 42));
+ assertTrue(ncl.isValid());
+ assertEquals(ncl.toString(),
+ "[40-50 [40-45 [42-42 [42-42]], 41-46], 45-55]");
+ expected = "40-50\n 40-45\n 42-42\n 42-42\n 41-46\n45-55\n";
+ assertEquals(ncl.prettyPrint(), expected);
+ }
+
+ /**
+ * A test that shows different valid trees can be constructed from the same
+ * set of ranges, depending on the order of construction
+ */
+ @Test(groups = "Functional")
+ public void testConstructor_alternativeTrees()
+ {
+ List<Range> ranges = new ArrayList<Range>();
+ ranges.add(new Range(10, 60));
+ ranges.add(new Range(20, 30));
+ ranges.add(new Range(40, 50));
+
+ /*
+ * constructor with greedy traversal of sorted ranges to build nested
+ * containment lists results in 20-30 inside 10-60, 40-50 a sibling
+ */
+ NCList<Range> ncl = new NCList<Range>(ranges);
+ assertEquals(ncl.toString(), "[10-60 [20-30], 40-50]");
+ assertTrue(ncl.isValid());
+
+ /*
+ * adding ranges one at a time results in 40-50
+ * a sibling of 20-30 inside 10-60
+ */
+ ncl = new NCList<Range>(new Range(10, 60));
+ ncl.add(new Range(20, 30));
+ ncl.add(new Range(40, 50));
+ assertEquals(ncl.toString(), "[10-60 [20-30, 40-50]]");
+ assertTrue(ncl.isValid());
+ }
+}
--- /dev/null
+package jalview.datamodel.features;
+
+import static org.testng.Assert.assertEquals;
+import static org.testng.Assert.assertFalse;
+import static org.testng.Assert.assertTrue;
+
+import jalview.datamodel.Range;
+import jalview.datamodel.SequenceFeature;
+
+import java.util.ArrayList;
+import java.util.List;
+
+import junit.extensions.PA;
+
+import org.testng.annotations.Test;
+
+public class NCNodeTest
+{
+ @Test(groups = "Functional")
+ public void testAdd()
+ {
+ Range r1 = new Range(10, 20);
+ NCNode<Range> node = new NCNode<Range>(r1);
+ assertEquals(node.getBegin(), 10);
+ Range r2 = new Range(10, 15);
+ node.add(r2);
+
+ List<Range> contents = new ArrayList<Range>();
+ node.getEntries(contents);
+ assertEquals(contents.size(), 2);
+ assertTrue(contents.contains(r1));
+ assertTrue(contents.contains(r2));
+ }
+
+ @Test(
+ groups = "Functional",
+ expectedExceptions = { IllegalArgumentException.class })
+ public void testAdd_invalidRangeStart()
+ {
+ Range r1 = new Range(10, 20);
+ NCNode<Range> node = new NCNode<Range>(r1);
+ assertEquals(node.getBegin(), 10);
+ Range r2 = new Range(9, 15);
+ node.add(r2);
+ }
+
+ @Test(
+ groups = "Functional",
+ expectedExceptions = { IllegalArgumentException.class })
+ public void testAdd_invalidRangeEnd()
+ {
+ Range r1 = new Range(10, 20);
+ NCNode<Range> node = new NCNode<Range>(r1);
+ assertEquals(node.getBegin(), 10);
+ Range r2 = new Range(12, 21);
+ node.add(r2);
+ }
+
+ @Test(groups = "Functional")
+ public void testGetEntries()
+ {
+ Range r1 = new Range(10, 20);
+ NCNode<Range> node = new NCNode<Range>(r1);
+ List<Range> entries = new ArrayList<Range>();
+
+ node.getEntries(entries);
+ assertEquals(entries.size(), 1);
+ assertTrue(entries.contains(r1));
+
+ // clearing the returned list does not affect the NCNode
+ entries.clear();
+ node.getEntries(entries);
+ assertEquals(entries.size(), 1);
+ assertTrue(entries.contains(r1));
+
+ Range r2 = new Range(15, 18);
+ node.add(r2);
+ entries.clear();
+ node.getEntries(entries);
+ assertEquals(entries.size(), 2);
+ assertTrue(entries.contains(r1));
+ assertTrue(entries.contains(r2));
+ }
+
+ /**
+ * Tests for the contains method (uses entry.equals() test)
+ */
+ @Test(groups = "Functional")
+ public void testContains()
+ {
+ SequenceFeature sf1 = new SequenceFeature("type", "desc", 1, 10, 2f,
+ "group");
+ SequenceFeature sf2 = new SequenceFeature("type", "desc", 1, 10, 2f,
+ "group");
+ SequenceFeature sf3 = new SequenceFeature("type", "desc", 1, 10, 2f,
+ "anothergroup");
+ NCNode<SequenceFeature> node = new NCNode<SequenceFeature>(sf1);
+
+ assertFalse(node.contains(null));
+ assertTrue(node.contains(sf1));
+ assertTrue(node.contains(sf2)); // sf1.equals(sf2)
+ assertFalse(node.contains(sf3)); // !sf1.equals(sf3)
+ }
+
+ /**
+ * Test method that checks for valid structure. Valid means that all
+ * subregions (if any) lie within the root range, and that all subregions have
+ * valid structure.
+ */
+ @Test(groups = "Functional")
+ public void testIsValid()
+ {
+ Range r1 = new Range(10, 20);
+ Range r2 = new Range(14, 15);
+ Range r3 = new Range(16, 17);
+ NCNode<Range> node = new NCNode<Range>(r1);
+ node.add(r2);
+ node.add(r3);
+
+ /*
+ * node has root range [10-20] and contains an
+ * NCList of [14-15, 16-17]
+ */
+ assertTrue(node.isValid());
+ PA.setValue(r1, "start", 15);
+ assertFalse(node.isValid()); // r2 not within r1
+ PA.setValue(r1, "start", 10);
+ assertTrue(node.isValid());
+ PA.setValue(r1, "end", 16);
+ assertFalse(node.isValid()); // r3 not within r1
+ PA.setValue(r1, "end", 20);
+ assertTrue(node.isValid());
+ PA.setValue(r3, "start", 12);
+ assertFalse(node.isValid()); // r3 should precede r2
+ }
+}
--- /dev/null
+package jalview.datamodel.features;
+
+import static org.testng.Assert.assertEquals;
+
+import jalview.datamodel.ContiguousI;
+import jalview.datamodel.Range;
+
+import java.util.Comparator;
+
+import org.testng.annotations.Test;
+
+public class RangeComparatorTest
+{
+
+ @Test(groups = "Functional")
+ public void testCompare()
+ {
+ RangeComparator comp = new RangeComparator(true);
+
+ // same position, same length
+ assertEquals(comp.compare(10, 10, 20, 20), 0);
+ // same position, len1 > len2
+ assertEquals(comp.compare(10, 10, 20, 19), -1);
+ // same position, len1 < len2
+ assertEquals(comp.compare(10, 10, 20, 21), 1);
+ // pos1 > pos2
+ assertEquals(comp.compare(11, 10, 20, 20), 1);
+ // pos1 < pos2
+ assertEquals(comp.compare(10, 11, 20, 10), -1);
+ }
+
+ @Test(groups = "Functional")
+ public void testCompare_byStart()
+ {
+ Comparator<ContiguousI> comp = RangeComparator.BY_START_POSITION;
+
+ // same start position, same length
+ assertEquals(comp.compare(new Range(10, 20), new Range(10, 20)), 0);
+ // same start position, len1 > len2
+ assertEquals(comp.compare(new Range(10, 20), new Range(10, 19)), -1);
+ // same start position, len1 < len2
+ assertEquals(comp.compare(new Range(10, 18), new Range(10, 20)), 1);
+ // pos1 > pos2
+ assertEquals(comp.compare(new Range(11, 20), new Range(10, 20)), 1);
+ // pos1 < pos2
+ assertEquals(comp.compare(new Range(10, 20), new Range(11, 20)), -1);
+ }
+
+ @Test(groups = "Functional")
+ public void testCompare_byEnd()
+ {
+ Comparator<ContiguousI> comp = RangeComparator.BY_END_POSITION;
+
+ // same end position, same length
+ assertEquals(comp.compare(new Range(10, 20), new Range(10, 20)), 0);
+ // same end position, len1 > len2
+ assertEquals(comp.compare(new Range(10, 20), new Range(11, 20)), -1);
+ // same end position, len1 < len2
+ assertEquals(comp.compare(new Range(11, 20), new Range(10, 20)), 1);
+ // end1 > end2
+ assertEquals(comp.compare(new Range(10, 21), new Range(10, 20)), 1);
+ // end1 < end2
+ assertEquals(comp.compare(new Range(10, 20), new Range(10, 21)), -1);
+ }
+}
--- /dev/null
+package jalview.datamodel.features;
+
+import static org.testng.Assert.assertEquals;
+import static org.testng.Assert.assertFalse;
+import static org.testng.Assert.assertSame;
+import static org.testng.Assert.assertTrue;
+
+import jalview.datamodel.SequenceFeature;
+
+import java.util.ArrayList;
+import java.util.Iterator;
+import java.util.List;
+import java.util.Map;
+import java.util.Set;
+
+import junit.extensions.PA;
+
+import org.testng.annotations.Test;
+
+public class SequenceFeaturesTest
+{
+ @Test(groups = "Functional")
+ public void testConstructor()
+ {
+ SequenceFeaturesI store = new SequenceFeatures();
+ assertFalse(store.hasFeatures());
+
+ store = new SequenceFeatures((List<SequenceFeature>) null);
+ assertFalse(store.hasFeatures());
+
+ List<SequenceFeature> features = new ArrayList<>();
+ store = new SequenceFeatures(features);
+ assertFalse(store.hasFeatures());
+
+ SequenceFeature sf1 = new SequenceFeature("Metal", "desc", 10, 20,
+ Float.NaN, null);
+ features.add(sf1);
+ SequenceFeature sf2 = new SequenceFeature("Metal", "desc", 15, 18,
+ Float.NaN, null);
+ features.add(sf2); // nested
+ SequenceFeature sf3 = new SequenceFeature("Pfam", "desc2", 0, 0,
+ Float.NaN, null); // non-positional
+ features.add(sf3);
+ store = new SequenceFeatures(features);
+ assertTrue(store.hasFeatures());
+ assertEquals(2, store.getFeatureCount(true)); // positional
+ assertEquals(1, store.getFeatureCount(false)); // non-positional
+ assertFalse(store.add(sf1)); // already contained
+ assertFalse(store.add(sf2)); // already contained
+ assertFalse(store.add(sf3)); // already contained
+ }
+
+ @Test(groups = "Functional")
+ public void testGetPositionalFeatures()
+ {
+ SequenceFeaturesI store = new SequenceFeatures();
+ SequenceFeature sf1 = new SequenceFeature("Metal", "desc", 10, 20,
+ Float.NaN, null);
+ store.add(sf1);
+ // same range, different description
+ SequenceFeature sf2 = new SequenceFeature("Metal", "desc2", 10, 20,
+ Float.NaN, null);
+ store.add(sf2);
+ // discontiguous range
+ SequenceFeature sf3 = new SequenceFeature("Metal", "desc", 30, 40,
+ Float.NaN, null);
+ store.add(sf3);
+ // overlapping range
+ SequenceFeature sf4 = new SequenceFeature("Metal", "desc", 15, 35,
+ Float.NaN, null);
+ store.add(sf4);
+ // enclosing range
+ SequenceFeature sf5 = new SequenceFeature("Metal", "desc", 5, 50,
+ Float.NaN, null);
+ store.add(sf5);
+ // non-positional feature
+ SequenceFeature sf6 = new SequenceFeature("Metal", "desc", 0, 0,
+ Float.NaN, null);
+ store.add(sf6);
+ // contact feature
+ SequenceFeature sf7 = new SequenceFeature("Disulphide bond", "desc",
+ 18, 45, Float.NaN, null);
+ store.add(sf7);
+ // different feature type
+ SequenceFeature sf8 = new SequenceFeature("Pfam", "desc", 30, 40,
+ Float.NaN, null);
+ store.add(sf8);
+ SequenceFeature sf9 = new SequenceFeature("Pfam", "desc", 15, 35,
+ Float.NaN, null);
+ store.add(sf9);
+
+ /*
+ * get all positional features
+ */
+ List<SequenceFeature> features = store.getPositionalFeatures();
+ assertEquals(features.size(), 8);
+ assertTrue(features.contains(sf1));
+ assertTrue(features.contains(sf2));
+ assertTrue(features.contains(sf3));
+ assertTrue(features.contains(sf4));
+ assertTrue(features.contains(sf5));
+ assertFalse(features.contains(sf6)); // non-positional
+ assertTrue(features.contains(sf7));
+ assertTrue(features.contains(sf8));
+ assertTrue(features.contains(sf9));
+
+ /*
+ * get features by type
+ */
+ assertTrue(store.getPositionalFeatures((String) null).isEmpty());
+ assertTrue(store.getPositionalFeatures("Cath").isEmpty());
+ assertTrue(store.getPositionalFeatures("METAL").isEmpty());
+
+ features = store.getPositionalFeatures("Metal");
+ assertEquals(features.size(), 5);
+ assertTrue(features.contains(sf1));
+ assertTrue(features.contains(sf2));
+ assertTrue(features.contains(sf3));
+ assertTrue(features.contains(sf4));
+ assertTrue(features.contains(sf5));
+ assertFalse(features.contains(sf6));
+
+ features = store.getPositionalFeatures("Disulphide bond");
+ assertEquals(features.size(), 1);
+ assertTrue(features.contains(sf7));
+
+ features = store.getPositionalFeatures("Pfam");
+ assertEquals(features.size(), 2);
+ assertTrue(features.contains(sf8));
+ assertTrue(features.contains(sf9));
+ }
+
+ @Test(groups = "Functional")
+ public void testGetContactFeatures()
+ {
+ SequenceFeaturesI store = new SequenceFeatures();
+ // non-contact
+ SequenceFeature sf1 = new SequenceFeature("Metal", "desc", 10, 20,
+ Float.NaN, null);
+ store.add(sf1);
+ // non-positional
+ SequenceFeature sf2 = new SequenceFeature("Metal", "desc", 0, 0,
+ Float.NaN, null);
+ store.add(sf2);
+ // contact feature
+ SequenceFeature sf3 = new SequenceFeature("Disulphide bond", "desc",
+ 18, 45, Float.NaN, null);
+ store.add(sf3);
+ // repeat for different feature type
+ SequenceFeature sf4 = new SequenceFeature("Pfam", "desc", 10, 20,
+ Float.NaN, null);
+ store.add(sf4);
+ SequenceFeature sf5 = new SequenceFeature("Pfam", "desc", 0, 0,
+ Float.NaN, null);
+ store.add(sf5);
+ SequenceFeature sf6 = new SequenceFeature("Disulfide bond", "desc", 18,
+ 45, Float.NaN, null);
+ store.add(sf6);
+
+ /*
+ * get all contact features
+ */
+ List<SequenceFeature> features = store.getContactFeatures();
+ assertEquals(features.size(), 2);
+ assertTrue(features.contains(sf3));
+ assertTrue(features.contains(sf6));
+
+ /*
+ * get contact features by type
+ */
+ assertTrue(store.getContactFeatures((String) null).isEmpty());
+ assertTrue(store.getContactFeatures("Cath").isEmpty());
+ assertTrue(store.getContactFeatures("Pfam").isEmpty());
+ assertTrue(store.getContactFeatures("DISULPHIDE BOND").isEmpty());
+
+ features = store.getContactFeatures("Disulphide bond");
+ assertEquals(features.size(), 1);
+ assertTrue(features.contains(sf3));
+
+ features = store.getContactFeatures("Disulfide bond");
+ assertEquals(features.size(), 1);
+ assertTrue(features.contains(sf6));
+ }
+
+ @Test(groups = "Functional")
+ public void testGetNonPositionalFeatures()
+ {
+ SequenceFeaturesI store = new SequenceFeatures();
+ // positional
+ SequenceFeature sf1 = new SequenceFeature("Metal", "desc", 10, 20,
+ Float.NaN, null);
+ store.add(sf1);
+ // non-positional
+ SequenceFeature sf2 = new SequenceFeature("Metal", "desc", 0, 0,
+ Float.NaN, null);
+ store.add(sf2);
+ // contact feature
+ SequenceFeature sf3 = new SequenceFeature("Disulphide bond", "desc",
+ 18, 45, Float.NaN, null);
+ store.add(sf3);
+ // repeat for different feature type
+ SequenceFeature sf4 = new SequenceFeature("Pfam", "desc", 10, 20,
+ Float.NaN, null);
+ store.add(sf4);
+ SequenceFeature sf5 = new SequenceFeature("Pfam", "desc", 0, 0,
+ Float.NaN, null);
+ store.add(sf5);
+ SequenceFeature sf6 = new SequenceFeature("Disulfide bond", "desc", 18,
+ 45, Float.NaN, null);
+ store.add(sf6);
+ // one more non-positional, different description
+ SequenceFeature sf7 = new SequenceFeature("Pfam", "desc2", 0, 0,
+ Float.NaN, null);
+ store.add(sf7);
+
+ /*
+ * get all non-positional features
+ */
+ List<SequenceFeature> features = store.getNonPositionalFeatures();
+ assertEquals(features.size(), 3);
+ assertTrue(features.contains(sf2));
+ assertTrue(features.contains(sf5));
+ assertTrue(features.contains(sf7));
+
+ /*
+ * get non-positional features by type
+ */
+ assertTrue(store.getNonPositionalFeatures((String) null).isEmpty());
+ assertTrue(store.getNonPositionalFeatures("Cath").isEmpty());
+ assertTrue(store.getNonPositionalFeatures("PFAM").isEmpty());
+
+ features = store.getNonPositionalFeatures("Metal");
+ assertEquals(features.size(), 1);
+ assertTrue(features.contains(sf2));
+
+ features = store.getNonPositionalFeatures("Pfam");
+ assertEquals(features.size(), 2);
+ assertTrue(features.contains(sf5));
+ assertTrue(features.contains(sf7));
+ }
+
+ /**
+ * Helper method to add a feature of no particular type
+ *
+ * @param sf
+ * @param type
+ * @param from
+ * @param to
+ * @return
+ */
+ SequenceFeature addFeature(SequenceFeaturesI sf, String type, int from,
+ int to)
+ {
+ SequenceFeature sf1 = new SequenceFeature(type, "", from, to,
+ Float.NaN,
+ null);
+ sf.add(sf1);
+ return sf1;
+ }
+
+ @Test(groups = "Functional")
+ public void testFindFeatures()
+ {
+ SequenceFeaturesI sf = new SequenceFeatures();
+ SequenceFeature sf1 = addFeature(sf, "Pfam", 10, 50);
+ SequenceFeature sf2 = addFeature(sf, "Pfam", 1, 15);
+ SequenceFeature sf3 = addFeature(sf, "Pfam", 20, 30);
+ SequenceFeature sf4 = addFeature(sf, "Pfam", 40, 100);
+ SequenceFeature sf5 = addFeature(sf, "Pfam", 60, 100);
+ SequenceFeature sf6 = addFeature(sf, "Pfam", 70, 70);
+ SequenceFeature sf7 = addFeature(sf, "Cath", 10, 50);
+ SequenceFeature sf8 = addFeature(sf, "Cath", 1, 15);
+ SequenceFeature sf9 = addFeature(sf, "Cath", 20, 30);
+ SequenceFeature sf10 = addFeature(sf, "Cath", 40, 100);
+ SequenceFeature sf11 = addFeature(sf, "Cath", 60, 100);
+ SequenceFeature sf12 = addFeature(sf, "Cath", 70, 70);
+
+ List<SequenceFeature> overlaps = sf.findFeatures(200, 200, "Pfam");
+ assertTrue(overlaps.isEmpty());
+
+ overlaps = sf.findFeatures( 1, 9, "Pfam");
+ assertEquals(overlaps.size(), 1);
+ assertTrue(overlaps.contains(sf2));
+
+ overlaps = sf.findFeatures( 5, 18, "Pfam");
+ assertEquals(overlaps.size(), 2);
+ assertTrue(overlaps.contains(sf1));
+ assertTrue(overlaps.contains(sf2));
+
+ overlaps = sf.findFeatures(30, 40, "Pfam");
+ assertEquals(overlaps.size(), 3);
+ assertTrue(overlaps.contains(sf1));
+ assertTrue(overlaps.contains(sf3));
+ assertTrue(overlaps.contains(sf4));
+
+ overlaps = sf.findFeatures( 80, 90, "Pfam");
+ assertEquals(overlaps.size(), 2);
+ assertTrue(overlaps.contains(sf4));
+ assertTrue(overlaps.contains(sf5));
+
+ overlaps = sf.findFeatures( 68, 70, "Pfam");
+ assertEquals(overlaps.size(), 3);
+ assertTrue(overlaps.contains(sf4));
+ assertTrue(overlaps.contains(sf5));
+ assertTrue(overlaps.contains(sf6));
+
+ overlaps = sf.findFeatures(16, 69, "Cath");
+ assertEquals(overlaps.size(), 4);
+ assertTrue(overlaps.contains(sf7));
+ assertFalse(overlaps.contains(sf8));
+ assertTrue(overlaps.contains(sf9));
+ assertTrue(overlaps.contains(sf10));
+ assertTrue(overlaps.contains(sf11));
+ assertFalse(overlaps.contains(sf12));
+
+ assertTrue(sf.findFeatures(0, 1000, "Metal").isEmpty());
+
+ overlaps = sf.findFeatures(7, 7, (String) null);
+ assertTrue(overlaps.isEmpty());
+ }
+
+ @Test(groups = "Functional")
+ public void testDelete()
+ {
+ SequenceFeaturesI sf = new SequenceFeatures();
+ SequenceFeature sf1 = addFeature(sf, "Pfam", 10, 50);
+ assertTrue(sf.getPositionalFeatures().contains(sf1));
+
+ assertFalse(sf.delete(null));
+ SequenceFeature sf2 = new SequenceFeature("Cath", "", 10, 15, 0f, null);
+ assertFalse(sf.delete(sf2)); // not added, can't delete it
+ assertTrue(sf.delete(sf1));
+ assertTrue(sf.getPositionalFeatures().isEmpty());
+ }
+
+ @Test(groups = "Functional")
+ public void testHasFeatures()
+ {
+ SequenceFeaturesI sf = new SequenceFeatures();
+ assertFalse(sf.hasFeatures());
+
+ SequenceFeature sf1 = addFeature(sf, "Pfam", 10, 50);
+ assertTrue(sf.hasFeatures());
+
+ sf.delete(sf1);
+ assertFalse(sf.hasFeatures());
+ }
+
+ /**
+ * Tests for the method that gets feature groups for positional or
+ * non-positional features
+ */
+ @Test(groups = "Functional")
+ public void testGetFeatureGroups()
+ {
+ SequenceFeaturesI sf = new SequenceFeatures();
+ assertTrue(sf.getFeatureGroups(true).isEmpty());
+ assertTrue(sf.getFeatureGroups(false).isEmpty());
+
+ /*
+ * add a non-positional feature (begin/end = 0/0)
+ */
+ SequenceFeature sfx = new SequenceFeature("AType", "Desc", 0, 0, 0f,
+ "AGroup");
+ sf.add(sfx);
+ Set<String> groups = sf.getFeatureGroups(true); // for positional
+ assertTrue(groups.isEmpty());
+ groups = sf.getFeatureGroups(false); // for non-positional
+ assertEquals(groups.size(), 1);
+ assertTrue(groups.contains("AGroup"));
+ groups = sf.getFeatureGroups(false, "AType");
+ assertEquals(groups.size(), 1);
+ assertTrue(groups.contains("AGroup"));
+ groups = sf.getFeatureGroups(true, "AnotherType");
+ assertTrue(groups.isEmpty());
+
+ /*
+ * add, then delete, more non-positional features of different types
+ */
+ SequenceFeature sfy = new SequenceFeature("AnotherType", "Desc", 0, 0,
+ 0f,
+ "AnotherGroup");
+ sf.add(sfy);
+ SequenceFeature sfz = new SequenceFeature("AThirdType", "Desc", 0, 0,
+ 0f,
+ null);
+ sf.add(sfz);
+ groups = sf.getFeatureGroups(false);
+ assertEquals(groups.size(), 3);
+ assertTrue(groups.contains("AGroup"));
+ assertTrue(groups.contains("AnotherGroup"));
+ assertTrue(groups.contains(null)); // null is a possible group
+ sf.delete(sfz);
+ sf.delete(sfy);
+ groups = sf.getFeatureGroups(false);
+ assertEquals(groups.size(), 1);
+ assertTrue(groups.contains("AGroup"));
+
+ /*
+ * add positional features
+ */
+ SequenceFeature sf1 = new SequenceFeature("Pfam", "Desc", 10, 50, 0f,
+ "PfamGroup");
+ sf.add(sf1);
+ groups = sf.getFeatureGroups(true);
+ assertEquals(groups.size(), 1);
+ assertTrue(groups.contains("PfamGroup"));
+ groups = sf.getFeatureGroups(false); // non-positional unchanged
+ assertEquals(groups.size(), 1);
+ assertTrue(groups.contains("AGroup"));
+
+ SequenceFeature sf2 = new SequenceFeature("Cath", "Desc", 10, 50, 0f,
+ null);
+ sf.add(sf2);
+ groups = sf.getFeatureGroups(true);
+ assertEquals(groups.size(), 2);
+ assertTrue(groups.contains("PfamGroup"));
+ assertTrue(groups.contains(null));
+
+ sf.delete(sf1);
+ sf.delete(sf2);
+ assertTrue(sf.getFeatureGroups(true).isEmpty());
+
+ SequenceFeature sf3 = new SequenceFeature("CDS", "", 10, 50, 0f,
+ "Ensembl");
+ sf.add(sf3);
+ SequenceFeature sf4 = new SequenceFeature("exon", "", 10, 50, 0f,
+ "Ensembl");
+ sf.add(sf4);
+ groups = sf.getFeatureGroups(true);
+ assertEquals(groups.size(), 1);
+ assertTrue(groups.contains("Ensembl"));
+
+ /*
+ * delete last Ensembl group feature from CDS features
+ * but still have one in exon features
+ */
+ sf.delete(sf3);
+ groups = sf.getFeatureGroups(true);
+ assertEquals(groups.size(), 1);
+ assertTrue(groups.contains("Ensembl"));
+
+ /*
+ * delete the last non-positional feature
+ */
+ sf.delete(sfx);
+ groups = sf.getFeatureGroups(false);
+ assertTrue(groups.isEmpty());
+ }
+
+ @Test(groups = "Functional")
+ public void testGetFeatureTypesForGroups()
+ {
+ SequenceFeaturesI sf = new SequenceFeatures();
+ assertTrue(sf.getFeatureTypesForGroups(true, (String) null).isEmpty());
+
+ /*
+ * add feature with group = "Uniprot", type = "helix"
+ */
+ String groupUniprot = "Uniprot";
+ SequenceFeature sf1 = new SequenceFeature("helix", "Desc", 10, 50, 0f,
+ groupUniprot);
+ sf.add(sf1);
+ Set<String> groups = sf.getFeatureTypesForGroups(true, groupUniprot);
+ assertEquals(groups.size(), 1);
+ assertTrue(groups.contains("helix"));
+ assertTrue(sf.getFeatureTypesForGroups(true, (String) null).isEmpty());
+
+ /*
+ * add feature with group = "Uniprot", type = "strand"
+ */
+ SequenceFeature sf2 = new SequenceFeature("strand", "Desc", 10, 50, 0f,
+ groupUniprot);
+ sf.add(sf2);
+ groups = sf.getFeatureTypesForGroups(true, groupUniprot);
+ assertEquals(groups.size(), 2);
+ assertTrue(groups.contains("helix"));
+ assertTrue(groups.contains("strand"));
+
+ /*
+ * delete the "strand" Uniprot feature - still have "helix"
+ */
+ sf.delete(sf2);
+ groups = sf.getFeatureTypesForGroups(true, groupUniprot);
+ assertEquals(groups.size(), 1);
+ assertTrue(groups.contains("helix"));
+
+ /*
+ * delete the "helix" Uniprot feature - none left
+ */
+ sf.delete(sf1);
+ assertTrue(sf.getFeatureTypesForGroups(true, groupUniprot).isEmpty());
+
+ /*
+ * add some null group features
+ */
+ SequenceFeature sf3 = new SequenceFeature("strand", "Desc", 10, 50, 0f,
+ null);
+ sf.add(sf3);
+ SequenceFeature sf4 = new SequenceFeature("turn", "Desc", 10, 50, 0f,
+ null);
+ sf.add(sf4);
+ groups = sf.getFeatureTypesForGroups(true, (String) null);
+ assertEquals(groups.size(), 2);
+ assertTrue(groups.contains("strand"));
+ assertTrue(groups.contains("turn"));
+
+ /*
+ * add strand/Cath and turn/Scop and query for one or both groups
+ * (find feature types for groups selected in Feature Settings)
+ */
+ SequenceFeature sf5 = new SequenceFeature("strand", "Desc", 10, 50, 0f,
+ "Cath");
+ sf.add(sf5);
+ SequenceFeature sf6 = new SequenceFeature("turn", "Desc", 10, 50, 0f,
+ "Scop");
+ sf.add(sf6);
+ groups = sf.getFeatureTypesForGroups(true, "Cath");
+ assertEquals(groups.size(), 1);
+ assertTrue(groups.contains("strand"));
+ groups = sf.getFeatureTypesForGroups(true, "Scop");
+ assertEquals(groups.size(), 1);
+ assertTrue(groups.contains("turn"));
+ groups = sf.getFeatureTypesForGroups(true, "Cath", "Scop");
+ assertEquals(groups.size(), 2);
+ assertTrue(groups.contains("turn"));
+ assertTrue(groups.contains("strand"));
+ // alternative vararg syntax
+ groups = sf.getFeatureTypesForGroups(true, new String[] { "Cath",
+ "Scop" });
+ assertEquals(groups.size(), 2);
+ assertTrue(groups.contains("turn"));
+ assertTrue(groups.contains("strand"));
+ }
+
+ @Test(groups = "Functional")
+ public void testGetFeatureTypes()
+ {
+ SequenceFeaturesI store = new SequenceFeatures();
+ Set<String> types = store.getFeatureTypes();
+ assertTrue(types.isEmpty());
+
+ SequenceFeature sf1 = new SequenceFeature("Metal", "desc", 10, 20,
+ Float.NaN, null);
+ store.add(sf1);
+ types = store.getFeatureTypes();
+ assertEquals(types.size(), 1);
+ assertTrue(types.contains("Metal"));
+
+ // null type is rejected...
+ SequenceFeature sf2 = new SequenceFeature(null, "desc", 10, 20,
+ Float.NaN, null);
+ assertFalse(store.add(sf2));
+ types = store.getFeatureTypes();
+ assertEquals(types.size(), 1);
+ assertFalse(types.contains(null));
+ assertTrue(types.contains("Metal"));
+
+ /*
+ * add non-positional feature
+ */
+ SequenceFeature sf3 = new SequenceFeature("Pfam", "desc", 0, 0,
+ Float.NaN, null);
+ store.add(sf3);
+ types = store.getFeatureTypes();
+ assertEquals(types.size(), 2);
+ assertTrue(types.contains("Pfam"));
+
+ /*
+ * add contact feature
+ */
+ SequenceFeature sf4 = new SequenceFeature("Disulphide Bond", "desc",
+ 10, 20, Float.NaN, null);
+ store.add(sf4);
+ types = store.getFeatureTypes();
+ assertEquals(types.size(), 3);
+ assertTrue(types.contains("Disulphide Bond"));
+
+ /*
+ * add another Pfam
+ */
+ SequenceFeature sf5 = new SequenceFeature("Pfam", "desc", 10, 20,
+ Float.NaN, null);
+ store.add(sf5);
+ types = store.getFeatureTypes();
+ assertEquals(types.size(), 3); // unchanged
+
+ /*
+ * delete first Pfam - still have one
+ */
+ assertTrue(store.delete(sf3));
+ types = store.getFeatureTypes();
+ assertEquals(types.size(), 3);
+ assertTrue(types.contains("Pfam"));
+
+ /*
+ * delete second Pfam - no longer have one
+ */
+ assertTrue(store.delete(sf5));
+ types = store.getFeatureTypes();
+ assertEquals(types.size(), 2);
+ assertFalse(types.contains("Pfam"));
+ }
+
+ @Test(groups = "Functional")
+ public void testGetFeatureCount()
+ {
+ SequenceFeaturesI store = new SequenceFeatures();
+ assertEquals(store.getFeatureCount(true), 0);
+ assertEquals(store.getFeatureCount(false), 0);
+
+ /*
+ * add positional
+ */
+ SequenceFeature sf1 = new SequenceFeature("Metal", "desc", 10, 20,
+ Float.NaN, null);
+ store.add(sf1);
+ assertEquals(store.getFeatureCount(true), 1);
+ assertEquals(store.getFeatureCount(false), 0);
+
+ /*
+ * null feature type is rejected
+ */
+ SequenceFeature sf2 = new SequenceFeature(null, "desc", 10, 20,
+ Float.NaN, null);
+ assertFalse(store.add(sf2));
+ assertEquals(store.getFeatureCount(true), 1);
+ assertEquals(store.getFeatureCount(false), 0);
+
+ /*
+ * add non-positional feature
+ */
+ SequenceFeature sf3 = new SequenceFeature("Pfam", "desc", 0, 0,
+ Float.NaN, null);
+ store.add(sf3);
+ assertEquals(store.getFeatureCount(true), 1);
+ assertEquals(store.getFeatureCount(false), 1);
+
+ /*
+ * add contact feature (counts as 1)
+ */
+ SequenceFeature sf4 = new SequenceFeature("Disulphide Bond", "desc",
+ 10, 20, Float.NaN, null);
+ store.add(sf4);
+ assertEquals(store.getFeatureCount(true), 2);
+ assertEquals(store.getFeatureCount(false), 1);
+
+ /*
+ * add another Pfam but this time as a positional feature
+ */
+ SequenceFeature sf5 = new SequenceFeature("Pfam", "desc", 10, 20,
+ Float.NaN, null);
+ store.add(sf5);
+ assertEquals(store.getFeatureCount(true), 3); // sf1, sf4, sf5
+ assertEquals(store.getFeatureCount(false), 1); // sf3
+ assertEquals(store.getFeatureCount(true, "Pfam"), 1); // positional
+ assertEquals(store.getFeatureCount(false, "Pfam"), 1); // non-positional
+ // search for type==null
+ assertEquals(store.getFeatureCount(true, (String) null), 0);
+ // search with no type specified
+ assertEquals(store.getFeatureCount(true, (String[]) null), 3);
+ assertEquals(store.getFeatureCount(true, "Metal", "Cath"), 1);
+ assertEquals(store.getFeatureCount(true, "Disulphide Bond"), 1);
+ assertEquals(store.getFeatureCount(true, "Metal", "Pfam", null), 2);
+
+ /*
+ * delete first Pfam (non-positional)
+ */
+ assertTrue(store.delete(sf3));
+ assertEquals(store.getFeatureCount(true), 3);
+ assertEquals(store.getFeatureCount(false), 0);
+
+ /*
+ * delete second Pfam (positional)
+ */
+ assertTrue(store.delete(sf5));
+ assertEquals(store.getFeatureCount(true), 2);
+ assertEquals(store.getFeatureCount(false), 0);
+ }
+
+ @Test(groups = "Functional")
+ public void testGetAllFeatures()
+ {
+ SequenceFeaturesI store = new SequenceFeatures();
+ List<SequenceFeature> features = store.getAllFeatures();
+ assertTrue(features.isEmpty());
+
+ SequenceFeature sf1 = new SequenceFeature("Metal", "desc", 10, 20,
+ Float.NaN, null);
+ store.add(sf1);
+ features = store.getAllFeatures();
+ assertEquals(features.size(), 1);
+ assertTrue(features.contains(sf1));
+
+ SequenceFeature sf2 = new SequenceFeature("Metallic", "desc", 10, 20,
+ Float.NaN, null);
+ store.add(sf2);
+ features = store.getAllFeatures();
+ assertEquals(features.size(), 2);
+ assertTrue(features.contains(sf2));
+
+ /*
+ * add non-positional feature
+ */
+ SequenceFeature sf3 = new SequenceFeature("Pfam", "desc", 0, 0,
+ Float.NaN, null);
+ store.add(sf3);
+ features = store.getAllFeatures();
+ assertEquals(features.size(), 3);
+ assertTrue(features.contains(sf3));
+
+ /*
+ * add contact feature
+ */
+ SequenceFeature sf4 = new SequenceFeature("Disulphide Bond", "desc",
+ 10, 20, Float.NaN, null);
+ store.add(sf4);
+ features = store.getAllFeatures();
+ assertEquals(features.size(), 4);
+ assertTrue(features.contains(sf4));
+
+ /*
+ * add another Pfam
+ */
+ SequenceFeature sf5 = new SequenceFeature("Pfam", "desc", 10, 20,
+ Float.NaN, null);
+ store.add(sf5);
+ features = store.getAllFeatures();
+ assertEquals(features.size(), 5);
+ assertTrue(features.contains(sf5));
+
+ /*
+ * select by type does not apply to non-positional features
+ */
+ features = store.getAllFeatures("Cath");
+ assertEquals(features.size(), 1);
+ assertTrue(features.contains(sf3));
+
+ features = store.getAllFeatures("Pfam", "Cath", "Metal");
+ assertEquals(features.size(), 3);
+ assertTrue(features.contains(sf1));
+ assertTrue(features.contains(sf3));
+ assertTrue(features.contains(sf5));
+
+ /*
+ * delete first Pfam
+ */
+ assertTrue(store.delete(sf3));
+ features = store.getAllFeatures();
+ assertEquals(features.size(), 4);
+ assertFalse(features.contains(sf3));
+
+ /*
+ * delete second Pfam
+ */
+ assertTrue(store.delete(sf5));
+ features = store.getAllFeatures();
+ assertEquals(features.size(), 3);
+ assertFalse(features.contains(sf3));
+ }
+
+ @Test(groups = "Functional")
+ public void testGetTotalFeatureLength()
+ {
+ SequenceFeaturesI store = new SequenceFeatures();
+ assertEquals(store.getTotalFeatureLength(), 0);
+
+ SequenceFeature sf1 = new SequenceFeature("Metal", "desc", 10, 20,
+ Float.NaN, null);
+ assertTrue(store.add(sf1));
+ assertEquals(store.getTotalFeatureLength(), 11);
+ assertEquals(store.getTotalFeatureLength("Metal"), 11);
+ assertEquals(store.getTotalFeatureLength("Plastic"), 0);
+
+ // re-add does nothing!
+ assertFalse(store.add(sf1));
+ assertEquals(store.getTotalFeatureLength(), 11);
+
+ /*
+ * add non-positional feature
+ */
+ SequenceFeature sf3 = new SequenceFeature("Pfam", "desc", 0, 0,
+ Float.NaN, null);
+ store.add(sf3);
+ assertEquals(store.getTotalFeatureLength(), 11);
+
+ /*
+ * add contact feature - counts 1 to feature length
+ */
+ SequenceFeature sf4 = new SequenceFeature("Disulphide Bond", "desc",
+ 10, 20, Float.NaN, null);
+ store.add(sf4);
+ assertEquals(store.getTotalFeatureLength(), 12);
+
+ /*
+ * add another Pfam
+ */
+ SequenceFeature sf5 = new SequenceFeature("Pfam", "desc", 10, 20,
+ Float.NaN, null);
+ store.add(sf5);
+ assertEquals(store.getTotalFeatureLength(), 23);
+
+ /*
+ * delete features
+ */
+ assertTrue(store.delete(sf3)); // non-positional
+ assertEquals(store.getTotalFeatureLength(), 23); // no change
+
+ assertTrue(store.delete(sf5));
+ assertEquals(store.getTotalFeatureLength(), 12);
+
+ assertTrue(store.delete(sf4)); // contact
+ assertEquals(store.getTotalFeatureLength(), 11);
+
+ assertTrue(store.delete(sf1));
+ assertEquals(store.getTotalFeatureLength(), 0);
+ }
+
+ @Test(groups = "Functional")
+ public void testGetMinimumScore_getMaximumScore()
+ {
+ SequenceFeatures sf = new SequenceFeatures();
+ SequenceFeature sf1 = new SequenceFeature("Metal", "desc", 0, 0,
+ Float.NaN, "group"); // non-positional, no score
+ sf.add(sf1);
+ SequenceFeature sf2 = new SequenceFeature("Cath", "desc", 10, 20,
+ Float.NaN, "group"); // positional, no score
+ sf.add(sf2);
+ SequenceFeature sf3 = new SequenceFeature("Metal", "desc", 10, 20, 1f,
+ "group");
+ sf.add(sf3);
+ SequenceFeature sf4 = new SequenceFeature("Metal", "desc", 12, 16, 4f,
+ "group");
+ sf.add(sf4);
+ SequenceFeature sf5 = new SequenceFeature("Cath", "desc", 0, 0, 11f,
+ "group");
+ sf.add(sf5);
+ SequenceFeature sf6 = new SequenceFeature("Cath", "desc", 0, 0, -7f,
+ "group");
+ sf.add(sf6);
+
+ assertEquals(sf.getMinimumScore("nosuchtype", true), Float.NaN);
+ assertEquals(sf.getMinimumScore("nosuchtype", false), Float.NaN);
+ assertEquals(sf.getMaximumScore("nosuchtype", true), Float.NaN);
+ assertEquals(sf.getMaximumScore("nosuchtype", false), Float.NaN);
+
+ // positional features min-max:
+ assertEquals(sf.getMinimumScore("Metal", true), 1f);
+ assertEquals(sf.getMaximumScore("Metal", true), 4f);
+ assertEquals(sf.getMinimumScore("Cath", true), Float.NaN);
+ assertEquals(sf.getMaximumScore("Cath", true), Float.NaN);
+
+ // non-positional features min-max:
+ assertEquals(sf.getMinimumScore("Cath", false), -7f);
+ assertEquals(sf.getMaximumScore("Cath", false), 11f);
+ assertEquals(sf.getMinimumScore("Metal", false), Float.NaN);
+ assertEquals(sf.getMaximumScore("Metal", false), Float.NaN);
+
+ // delete features; min-max should get recomputed
+ sf.delete(sf6);
+ assertEquals(sf.getMinimumScore("Cath", false), 11f);
+ assertEquals(sf.getMaximumScore("Cath", false), 11f);
+ sf.delete(sf4);
+ assertEquals(sf.getMinimumScore("Metal", true), 1f);
+ assertEquals(sf.getMaximumScore("Metal", true), 1f);
+ sf.delete(sf5);
+ assertEquals(sf.getMinimumScore("Cath", false), Float.NaN);
+ assertEquals(sf.getMaximumScore("Cath", false), Float.NaN);
+ sf.delete(sf3);
+ assertEquals(sf.getMinimumScore("Metal", true), Float.NaN);
+ assertEquals(sf.getMaximumScore("Metal", true), Float.NaN);
+ sf.delete(sf1);
+ sf.delete(sf2);
+ assertFalse(sf.hasFeatures());
+ assertEquals(sf.getMinimumScore("Cath", false), Float.NaN);
+ assertEquals(sf.getMaximumScore("Cath", false), Float.NaN);
+ assertEquals(sf.getMinimumScore("Metal", true), Float.NaN);
+ assertEquals(sf.getMaximumScore("Metal", true), Float.NaN);
+ }
+
+ @Test(groups = "Functional")
+ public void testVarargsToTypes()
+ {
+ SequenceFeatures sf = new SequenceFeatures();
+ sf.add(new SequenceFeature("Metal", "desc", 0, 0, Float.NaN, "group"));
+ sf.add(new SequenceFeature("Cath", "desc", 10, 20, Float.NaN, "group"));
+
+ /*
+ * no type specified - get all types stored
+ * they are returned in keyset (alphabetical) order
+ */
+ Map<String, FeatureStore> featureStores = (Map<String, FeatureStore>) PA
+ .getValue(sf, "featureStore");
+
+ Iterable<FeatureStore> types = sf.varargToTypes();
+ Iterator<FeatureStore> iterator = types.iterator();
+ assertTrue(iterator.hasNext());
+ assertSame(iterator.next(), featureStores.get("Cath"));
+ assertTrue(iterator.hasNext());
+ assertSame(iterator.next(), featureStores.get("Metal"));
+ assertFalse(iterator.hasNext());
+
+ /*
+ * empty array is the same as no vararg parameter supplied
+ * so treated as all stored types
+ */
+ types = sf.varargToTypes(new String[] {});
+ iterator = types.iterator();
+ assertTrue(iterator.hasNext());
+ assertSame(iterator.next(), featureStores.get("Cath"));
+ assertTrue(iterator.hasNext());
+ assertSame(iterator.next(), featureStores.get("Metal"));
+ assertFalse(iterator.hasNext());
+
+ /*
+ * null type specified; this is passed as vararg
+ * String[1] {null}
+ */
+ types = sf.varargToTypes((String) null);
+ assertFalse(types.iterator().hasNext());
+
+ /*
+ * null types array specified; this is passed as vararg null
+ */
+ types = sf.varargToTypes((String[]) null);
+ iterator = types.iterator();
+ assertTrue(iterator.hasNext());
+ assertSame(iterator.next(), featureStores.get("Cath"));
+ assertTrue(iterator.hasNext());
+ assertSame(iterator.next(), featureStores.get("Metal"));
+ assertFalse(iterator.hasNext());
+
+ /*
+ * one type specified
+ */
+ types = sf.varargToTypes("Metal");
+ iterator = types.iterator();
+ assertTrue(iterator.hasNext());
+ assertSame(iterator.next(), featureStores.get("Metal"));
+ assertFalse(iterator.hasNext());
+
+ /*
+ * two types specified - get sorted alphabetically
+ */
+ types = sf.varargToTypes("Metal", "Cath");
+ iterator = types.iterator();
+ assertTrue(iterator.hasNext());
+ assertSame(iterator.next(), featureStores.get("Cath"));
+ assertTrue(iterator.hasNext());
+ assertSame(iterator.next(), featureStores.get("Metal"));
+ assertFalse(iterator.hasNext());
+
+ /*
+ * null type included - should be ignored
+ */
+ types = sf.varargToTypes("Metal", null, "Helix");
+ iterator = types.iterator();
+ assertTrue(iterator.hasNext());
+ assertSame(iterator.next(), featureStores.get("Metal"));
+ assertFalse(iterator.hasNext());
+ }
+
+ @Test(groups = "Functional")
+ public void testGetFeatureTypes_byOntology()
+ {
+ SequenceFeaturesI store = new SequenceFeatures();
+
+ SequenceFeature sf1 = new SequenceFeature("transcript", "desc", 10, 20,
+ Float.NaN, null);
+ store.add(sf1);
+ // mRNA isA mature_transcript isA transcript
+ SequenceFeature sf2 = new SequenceFeature("mRNA", "desc", 10, 20,
+ Float.NaN, null);
+ store.add(sf2);
+ // just to prove non-positional feature types are included
+ SequenceFeature sf3 = new SequenceFeature("mRNA", "desc", 0, 0,
+ Float.NaN, null);
+ store.add(sf3);
+ SequenceFeature sf4 = new SequenceFeature("CDS", "desc", 0, 0,
+ Float.NaN, null);
+ store.add(sf4);
+
+ Set<String> types = store.getFeatureTypes("transcript");
+ assertEquals(types.size(), 2);
+ assertTrue(types.contains("transcript"));
+ assertTrue(types.contains("mRNA"));
+
+ // matches include arguments whether SO terms or not
+ types = store.getFeatureTypes("transcript", "CDS");
+ assertEquals(types.size(), 3);
+ assertTrue(types.contains("transcript"));
+ assertTrue(types.contains("mRNA"));
+ assertTrue(types.contains("CDS"));
+
+ types = store.getFeatureTypes("exon");
+ assertTrue(types.isEmpty());
+ }
+
+ @Test(groups = "Functional")
+ public void testGetFeaturesByOntology()
+ {
+ SequenceFeaturesI store = new SequenceFeatures();
+ List<SequenceFeature> features = store.getFeaturesByOntology();
+ assertTrue(features.isEmpty());
+ assertTrue(store.getFeaturesByOntology(new String[] {}).isEmpty());
+ assertTrue(store.getFeaturesByOntology((String[]) null).isEmpty());
+
+ SequenceFeature sf1 = new SequenceFeature("transcript", "desc", 10, 20,
+ Float.NaN, null);
+ store.add(sf1);
+
+ // mRNA isA transcript; added here 'as if' non-positional
+ // just to show that non-positional features are included in results
+ SequenceFeature sf2 = new SequenceFeature("mRNA", "desc", 0, 0,
+ Float.NaN, null);
+ store.add(sf2);
+
+ SequenceFeature sf3 = new SequenceFeature("Pfam", "desc", 30, 40,
+ Float.NaN, null);
+ store.add(sf3);
+
+ features = store.getFeaturesByOntology("transcript");
+ assertEquals(features.size(), 2);
+ assertTrue(features.contains(sf1));
+ assertTrue(features.contains(sf2));
+
+ features = store.getFeaturesByOntology("mRNA");
+ assertEquals(features.size(), 1);
+ assertTrue(features.contains(sf2));
+
+ features = store.getFeaturesByOntology("mRNA", "Pfam");
+ assertEquals(features.size(), 2);
+ assertTrue(features.contains(sf2));
+ assertTrue(features.contains(sf3));
+
+ features = store.getFeaturesByOntology("sequence_variant");
+ assertTrue(features.isEmpty());
+ }
+
+ @Test(groups = "Functional")
+ public void testSortFeatures()
+ {
+ List<SequenceFeature> sfs = new ArrayList<SequenceFeature>();
+ SequenceFeature sf1 = new SequenceFeature("Pfam", "desc", 30, 80,
+ Float.NaN, null);
+ sfs.add(sf1);
+ SequenceFeature sf2 = new SequenceFeature("Rfam", "desc", 40, 50,
+ Float.NaN, null);
+ sfs.add(sf2);
+ SequenceFeature sf3 = new SequenceFeature("Rfam", "desc", 50, 60,
+ Float.NaN, null);
+ sfs.add(sf3);
+
+ // sort by end position descending
+ SequenceFeatures.sortFeatures(sfs, false);
+ assertSame(sfs.get(0), sf1);
+ assertSame(sfs.get(1), sf3);
+ assertSame(sfs.get(2), sf2);
+
+ // sort by start position ascending
+ SequenceFeatures.sortFeatures(sfs, true);
+ assertSame(sfs.get(0), sf1);
+ assertSame(sfs.get(1), sf2);
+ assertSame(sfs.get(2), sf3);
+ }
+
+ @Test(groups = "Functional")
+ public void testGetFeaturesForGroup()
+ {
+ SequenceFeaturesI store = new SequenceFeatures();
+
+ List<SequenceFeature> features = store.getFeaturesForGroup(true, null);
+ assertTrue(features.isEmpty());
+ assertTrue(store.getFeaturesForGroup(false, null).isEmpty());
+ assertTrue(store.getFeaturesForGroup(true, "Uniprot").isEmpty());
+ assertTrue(store.getFeaturesForGroup(false, "Uniprot").isEmpty());
+
+ SequenceFeature sf1 = new SequenceFeature("Pfam", "desc", 4, 10, 0f,
+ null);
+ SequenceFeature sf2 = new SequenceFeature("Pfam", "desc", 0, 0, 0f,
+ null);
+ SequenceFeature sf3 = new SequenceFeature("Pfam", "desc", 4, 10, 0f,
+ "Uniprot");
+ SequenceFeature sf4 = new SequenceFeature("Metal", "desc", 0, 0, 0f,
+ "Rfam");
+ SequenceFeature sf5 = new SequenceFeature("Cath", "desc", 5, 15, 0f,
+ null);
+ store.add(sf1);
+ store.add(sf2);
+ store.add(sf3);
+ store.add(sf4);
+ store.add(sf5);
+
+ // positional features for null group, any type
+ features = store.getFeaturesForGroup(true, null);
+ assertEquals(features.size(), 2);
+ assertTrue(features.contains(sf1));
+ assertTrue(features.contains(sf5));
+
+ // positional features for null group, specified type
+ features = store.getFeaturesForGroup(true, null, new String[] { "Pfam",
+ "Xfam" });
+ assertEquals(features.size(), 1);
+ assertTrue(features.contains(sf1));
+ features = store.getFeaturesForGroup(true, null, new String[] { "Pfam",
+ "Xfam", "Cath" });
+ assertEquals(features.size(), 2);
+ assertTrue(features.contains(sf1));
+ assertTrue(features.contains(sf5));
+
+ // positional features for non-null group, any type
+ features = store.getFeaturesForGroup(true, "Uniprot");
+ assertEquals(features.size(), 1);
+ assertTrue(features.contains(sf3));
+ assertTrue(store.getFeaturesForGroup(true, "Rfam").isEmpty());
+
+ // positional features for non-null group, specified type
+ features = store.getFeaturesForGroup(true, "Uniprot", "Pfam", "Xfam",
+ "Rfam");
+ assertEquals(features.size(), 1);
+ assertTrue(features.contains(sf3));
+ assertTrue(store.getFeaturesForGroup(true, "Uniprot", "Cath").isEmpty());
+
+ // non-positional features for null group, any type
+ features = store.getFeaturesForGroup(false, null);
+ assertEquals(features.size(), 1);
+ assertTrue(features.contains(sf2));
+
+ // non-positional features for null group, specified type
+ features = store.getFeaturesForGroup(false, null, "Pfam", "Xfam");
+ assertEquals(features.size(), 1);
+ assertTrue(features.contains(sf2));
+ assertTrue(store.getFeaturesForGroup(false, null, "Cath").isEmpty());
+
+ // non-positional features for non-null group, any type
+ features = store.getFeaturesForGroup(false, "Rfam");
+ assertEquals(features.size(), 1);
+ assertTrue(features.contains(sf4));
+ assertTrue(store.getFeaturesForGroup(false, "Uniprot").isEmpty());
+
+ // non-positional features for non-null group, specified type
+ features = store.getFeaturesForGroup(false, "Rfam", "Pfam", "Metal");
+ assertEquals(features.size(), 1);
+ assertTrue(features.contains(sf4));
+ assertTrue(store.getFeaturesForGroup(false, "Rfam", "Cath", "Pfam")
+ .isEmpty());
+ }
+
+ @Test(groups = "Functional")
+ public void testShiftFeatures()
+ {
+ SequenceFeatures store = new SequenceFeatures();
+ assertFalse(store.shiftFeatures(1));
+
+ SequenceFeature sf1 = new SequenceFeature("Cath", "", 2, 5, 0f, null);
+ store.add(sf1);
+ // nested feature:
+ SequenceFeature sf2 = new SequenceFeature("Metal", "", 8, 14, 0f, null);
+ store.add(sf2);
+ // contact feature:
+ SequenceFeature sf3 = new SequenceFeature("Disulfide bond", "", 23, 32,
+ 0f, null);
+ store.add(sf3);
+ // non-positional feature:
+ SequenceFeature sf4 = new SequenceFeature("Pfam", "", 0, 0, 0f, null);
+ store.add(sf4);
+
+ /*
+ * shift features right by 5
+ */
+ assertTrue(store.shiftFeatures(5));
+
+ // non-positional features untouched:
+ List<SequenceFeature> nonPos = store.getNonPositionalFeatures();
+ assertEquals(nonPos.size(), 1);
+ assertTrue(nonPos.contains(sf4));
+
+ // positional features are replaced
+ List<SequenceFeature> pos = store.getPositionalFeatures();
+ assertEquals(pos.size(), 3);
+ assertFalse(pos.contains(sf1));
+ assertFalse(pos.contains(sf2));
+ assertFalse(pos.contains(sf3));
+ SequenceFeatures.sortFeatures(pos, true); // ascending start pos
+ assertEquals(pos.get(0).getBegin(), 7);
+ assertEquals(pos.get(0).getEnd(), 10);
+ assertEquals(pos.get(0).getType(), "Cath");
+ assertEquals(pos.get(1).getBegin(), 13);
+ assertEquals(pos.get(1).getEnd(), 19);
+ assertEquals(pos.get(1).getType(), "Metal");
+ assertEquals(pos.get(2).getBegin(), 28);
+ assertEquals(pos.get(2).getEnd(), 37);
+ assertEquals(pos.get(2).getType(), "Disulfide bond");
+
+ /*
+ * now shift left by 15
+ * feature at [7-10] should be removed
+ * feature at [13-19] should become [1-4]
+ */
+ assertTrue(store.shiftFeatures(-15));
+ pos = store.getPositionalFeatures();
+ assertEquals(pos.size(), 2);
+ SequenceFeatures.sortFeatures(pos, true);
+ assertEquals(pos.get(0).getBegin(), 1);
+ assertEquals(pos.get(0).getEnd(), 4);
+ assertEquals(pos.get(0).getType(), "Metal");
+ assertEquals(pos.get(1).getBegin(), 13);
+ assertEquals(pos.get(1).getEnd(), 22);
+ assertEquals(pos.get(1).getType(), "Disulfide bond");
+ }
+
+ @Test(groups = "Functional")
+ public void testIsOntologyTerm()
+ {
+ SequenceFeatures store = new SequenceFeatures();
+ assertTrue(store.isOntologyTerm("gobbledygook"));
+ assertTrue(store.isOntologyTerm("transcript", "transcript"));
+ assertTrue(store.isOntologyTerm("mRNA", "transcript"));
+ assertFalse(store.isOntologyTerm("transcript", "mRNA"));
+ assertTrue(store.isOntologyTerm("junk", "transcript", "junk"));
+ assertTrue(store.isOntologyTerm("junk", new String[] {}));
+ assertTrue(store.isOntologyTerm("junk", (String[]) null));
+ }
+}
20500, 0f, null);
assertFalse(testee.retainFeature(sf, accId));
- sf.setType("aberrant_processed_transcript");
+ sf = new SequenceFeature("aberrant_processed_transcript", "", 20000,
+ 20500, 0f, null);
assertFalse(testee.retainFeature(sf, accId));
- sf.setType("NMD_transcript_variant");
+ sf = new SequenceFeature("NMD_transcript_variant", "", 20000, 20500,
+ 0f, null);
assertFalse(testee.retainFeature(sf, accId));
// other feature with no parent is retained
- sf.setType("sequence_variant");
+ sf = new SequenceFeature("sequence_variant", "", 20000, 20500, 0f, null);
assertTrue(testee.retainFeature(sf, accId));
// other feature with desired parent is retained
assertTrue(testee.identifiesSequence(sf, accId));
// exon sub-type with right parent is valid
- sf.setType("coding_exon");
+ sf = new SequenceFeature("coding_exon", "", 1, 2, 0f, null);
+ sf.setValue("Parent", "transcript:" + accId);
assertTrue(testee.identifiesSequence(sf, accId));
// transcript not valid:
- sf.setType("transcript");
+ sf = new SequenceFeature("transcript", "", 1, 2, 0f, null);
+ sf.setValue("Parent", "transcript:" + accId);
assertFalse(testee.identifiesSequence(sf, accId));
// CDS not valid:
- sf.setType("CDS");
+ sf = new SequenceFeature("CDS", "", 1, 2, 0f, null);
+ sf.setValue("Parent", "transcript:" + accId);
assertFalse(testee.identifiesSequence(sf, accId));
}
null);
assertFalse(testee.retainFeature(sf, accId));
- sf.setType("CDS_predicted");
+ sf = new SequenceFeature("CDS_predicted", "", 20000, 20500, 0f, null);
assertFalse(testee.retainFeature(sf, accId));
// other feature with no parent is retained
- sf.setType("sequence_variant");
+ sf = new SequenceFeature("CDS_psequence_variantredicted", "", 20000,
+ 20500, 0f, null);
assertTrue(testee.retainFeature(sf, accId));
// other feature with desired parent is retained
assertTrue(testee.identifiesSequence(sf, accId));
// cds sub-type with right parent is valid
- sf.setType("CDS_predicted");
+ sf = new SequenceFeature("CDS_predicted", "", 1, 2, 0f, null);
+ sf.setValue("Parent", "transcript:" + accId);
assertTrue(testee.identifiesSequence(sf, accId));
// transcript not valid:
- sf.setType("transcript");
+ sf = new SequenceFeature("transcript", "", 1, 2, 0f, null);
+ sf.setValue("Parent", "transcript:" + accId);
assertFalse(testee.identifiesSequence(sf, accId));
// exon not valid:
- sf.setType("exon");
+ sf = new SequenceFeature("exon", "", 1, 2, 0f, null);
+ sf.setValue("Parent", "transcript:" + accId);
assertFalse(testee.identifiesSequence(sf, accId));
}
import static org.testng.AssertJUnit.assertEquals;
import static org.testng.AssertJUnit.assertFalse;
-import static org.testng.AssertJUnit.assertSame;
import static org.testng.AssertJUnit.assertTrue;
import jalview.api.FeatureSettingsModelI;
genomic.setEnd(50000);
String geneId = "ABC123";
- // gene at (start+10000) length 501
+ // gene at (start+20000) length 501
+ // should be ignored - the first 'gene' found defines the whole range
+ // (note features are found in position order, not addition order)
SequenceFeature sf = new SequenceFeature("gene", "", 20000, 20500, 0f,
null);
sf.setValue("ID", "gene:" + geneId);
genomic.addSequenceFeature(sf);
// gene at (start + 10500) length 101
- // should be ignored - the first 'gene' found defines the whole range
sf = new SequenceFeature("gene", "", 10500, 10600, 0f, null);
sf.setValue("ID", "gene:" + geneId);
sf.setStrand("+");
23);
List<int[]> fromRanges = ranges.getFromRanges();
assertEquals(1, fromRanges.size());
- assertEquals(20000, fromRanges.get(0)[0]);
- assertEquals(20500, fromRanges.get(0)[1]);
+ assertEquals(10500, fromRanges.get(0)[0]);
+ assertEquals(10600, fromRanges.get(0)[1]);
// to range should start from given start numbering
List<int[]> toRanges = ranges.getToRanges();
assertEquals(1, toRanges.size());
assertEquals(23, toRanges.get(0)[0]);
- assertEquals(523, toRanges.get(0)[1]);
+ assertEquals(123, toRanges.get(0)[1]);
}
/**
genomic.setEnd(50000);
String geneId = "ABC123";
- // gene at (start+10000) length 501
+ // gene at (start+20000) length 501
+ // should be ignored - the first 'gene' found defines the whole range
+ // (real data would only have one such feature)
SequenceFeature sf = new SequenceFeature("ncRNA_gene", "", 20000,
20500, 0f, null);
sf.setValue("ID", "gene:" + geneId);
genomic.addSequenceFeature(sf);
// gene at (start + 10500) length 101
- // should be ignored - the first 'gene' found defines the whole range
- // (real data would only have one such feature)
sf = new SequenceFeature("gene", "", 10500, 10600, 0f, null);
sf.setValue("ID", "gene:" + geneId);
sf.setStrand("+");
List<int[]> fromRanges = ranges.getFromRanges();
assertEquals(1, fromRanges.size());
// from range on reverse strand:
- assertEquals(20500, fromRanges.get(0)[0]);
- assertEquals(20000, fromRanges.get(0)[1]);
+ assertEquals(10500, fromRanges.get(0)[0]);
+ assertEquals(10600, fromRanges.get(0)[1]);
// to range should start from given start numbering
List<int[]> toRanges = ranges.getToRanges();
assertEquals(1, toRanges.size());
assertEquals(23, toRanges.get(0)[0]);
- assertEquals(523, toRanges.get(0)[1]);
+ assertEquals(123, toRanges.get(0)[1]);
}
/**
genomic.addSequenceFeature(sf1);
// transcript sub-type feature
- SequenceFeature sf2 = new SequenceFeature("snRNA", "", 20000, 20500,
+ SequenceFeature sf2 = new SequenceFeature("snRNA", "", 21000, 21500,
0f, null);
sf2.setValue("Parent", "gene:" + geneId);
sf2.setValue("transcript_id", "transcript2");
// NMD_transcript_variant treated like transcript in Ensembl
SequenceFeature sf3 = new SequenceFeature("NMD_transcript_variant", "",
- 20000, 20500, 0f, null);
+ 22000, 22500, 0f, null);
sf3.setValue("Parent", "gene:" + geneId);
sf3.setValue("transcript_id", "transcript3");
genomic.addSequenceFeature(sf3);
// transcript for a different gene - ignored
- SequenceFeature sf4 = new SequenceFeature("snRNA", "", 20000, 20500,
+ SequenceFeature sf4 = new SequenceFeature("snRNA", "", 23000, 23500,
0f, null);
sf4.setValue("Parent", "gene:XYZ");
sf4.setValue("transcript_id", "transcript4");
List<SequenceFeature> features = testee.getTranscriptFeatures(geneId,
genomic);
assertEquals(3, features.size());
- assertSame(sf1, features.get(0));
- assertSame(sf2, features.get(1));
- assertSame(sf3, features.get(2));
+ assertTrue(features.contains(sf1));
+ assertTrue(features.contains(sf2));
+ assertTrue(features.contains(sf3));
}
/**
sf.setValue("ID", "gene:" + geneId);
assertFalse(testee.retainFeature(sf, geneId));
- sf.setType("transcript");
+ sf = new SequenceFeature("transcript", "", 20000, 20500, 0f, null);
sf.setValue("Parent", "gene:" + geneId);
assertTrue(testee.retainFeature(sf, geneId));
- sf.setType("mature_transcript");
+ sf = new SequenceFeature("mature_transcript", "", 20000, 20500, 0f,
+ null);
sf.setValue("Parent", "gene:" + geneId);
assertTrue(testee.retainFeature(sf, geneId));
- sf.setType("NMD_transcript_variant");
+ sf = new SequenceFeature("NMD_transcript_variant", "", 20000, 20500,
+ 0f, null);
sf.setValue("Parent", "gene:" + geneId);
assertTrue(testee.retainFeature(sf, geneId));
sf.setValue("Parent", "gene:XYZ");
assertFalse(testee.retainFeature(sf, geneId));
- sf.setType("anything");
+ sf = new SequenceFeature("anything", "", 20000, 20500, 0f, null);
assertTrue(testee.retainFeature(sf, geneId));
}
assertTrue(testee.identifiesSequence(sf, accId));
// gene sub-type with right ID is valid
- sf.setType("snRNA_gene");
+ sf = new SequenceFeature("snRNA_gene", "", 1, 2, 0f, null);
+ sf.setValue("ID", "gene:" + accId);
assertTrue(testee.identifiesSequence(sf, accId));
// transcript not valid:
- sf.setType("transcript");
+ sf = new SequenceFeature("transcript", "", 1, 2, 0f, null);
+ sf.setValue("ID", "gene:" + accId);
assertFalse(testee.identifiesSequence(sf, accId));
// exon not valid:
- sf.setType("exon");
+ sf = new SequenceFeature("exon", "", 1, 2, 0f, null);
+ sf.setValue("ID", "gene:" + accId);
assertFalse(testee.identifiesSequence(sf, accId));
}
assertEquals(-1, fc.compare("coding_exon", "feature_variant"));
assertEquals(1f, fc.getTransparency());
}
+
+ @Test(groups = "Network")
+ public void testGetGeneIds()
+ {
+ /*
+ * ENSG00000158828 gene id PINK1 human
+ * ENST00000321556 transcript for the same gene - should not be duplicated
+ * P30419 Uniprot identifier for ENSG00000136448
+ * ENST00000592782 transcript for Uniprot gene - should not be duplicated
+ * BRAF - gene name resolvabe (at time of writing) for 6 model species
+ */
+ String ids = "ENSG00000158828 ENST00000321556 P30419 ENST00000592782 BRAF";
+ EnsemblGene testee = new EnsemblGene();
+ List<String> geneIds = testee.getGeneIds(ids);
+ assertEquals(8, geneIds.size());
+ assertTrue(geneIds.contains("ENSG00000158828"));
+ assertTrue(geneIds.contains("ENSG00000136448"));
+ assertTrue(geneIds.contains("ENSG00000157764")); // BRAF human
+ assertTrue(geneIds.contains("ENSMUSG00000002413")); // mouse
+ assertTrue(geneIds.contains("ENSRNOG00000010957")); // rat
+ assertTrue(geneIds.contains("ENSXETG00000004845")); // xenopus
+ assertTrue(geneIds.contains("ENSDARG00000017661")); // zebrafish
+ assertTrue(geneIds.contains("ENSGALG00000012865")); // chicken
+ }
}
20500, 0f, null);
assertFalse(testee.retainFeature(sf, accId));
- sf.setType("mature_transcript");
+ sf = new SequenceFeature("mature_transcript", "", 20000, 20500, 0f,
+ null);
assertFalse(testee.retainFeature(sf, accId));
- sf.setType("NMD_transcript_variant");
+ sf = new SequenceFeature("NMD_transcript_variant", "", 20000, 20500,
+ 0f, null);
assertFalse(testee.retainFeature(sf, accId));
// other feature with no parent is kept
- sf.setType("anything");
+ sf = new SequenceFeature("anything", "", 20000, 20500, 0f, null);
assertTrue(testee.retainFeature(sf, accId));
// other feature with correct parent is kept
assertTrue(testee.identifiesSequence(sf, accId));
// transcript sub-type with right ID is valid
- sf.setType("ncRNA");
+ sf = new SequenceFeature("ncRNA", "", 1, 2, 0f, null);
+ sf.setValue("ID", "transcript:" + accId);
assertTrue(testee.identifiesSequence(sf, accId));
// Ensembl treats NMD_transcript_variant as if a transcript
- sf.setType("NMD_transcript_variant");
+ sf = new SequenceFeature("NMD_transcript_variant", "", 1, 2, 0f, null);
+ sf.setValue("ID", "transcript:" + accId);
assertTrue(testee.identifiesSequence(sf, accId));
// gene not valid:
- sf.setType("gene");
+ sf = new SequenceFeature("gene", "", 1, 2, 0f, null);
+ sf.setValue("ID", "transcript:" + accId);
assertFalse(testee.identifiesSequence(sf, accId));
// exon not valid:
- sf.setType("exon");
+ sf = new SequenceFeature("exon", "", 1, 2, 0f, null);
+ sf.setValue("ID", "transcript:" + accId);
assertFalse(testee.identifiesSequence(sf, accId));
}
*/
package jalview.ext.ensembl;
+import static org.testng.Assert.assertTrue;
+
import jalview.datamodel.AlignmentI;
import java.net.MalformedURLException;
import java.net.URL;
import java.util.List;
+import org.testng.annotations.BeforeMethod;
import org.testng.annotations.Test;
public class EnsemblRestClientTest
{
+ private EnsemblRestClient sf;
@Test(suiteName = "live")
public void testIsEnsemblAvailable()
{
- EnsemblRestClient sf = new EnsemblRestClient()
+ boolean isAvailable = sf.isEnsemblAvailable();
+ if (isAvailable)
+ {
+ System.out.println("Ensembl is UP!");
+ }
+ else
+ {
+ System.err
+ .println("Ensembl is DOWN or unreachable ******************* BAD!");
+ }
+ }
+
+ @BeforeMethod(alwaysRun = true)
+ protected void setUp()
+ {
+ sf = new EnsemblRestClient()
{
@Override
}
};
- boolean isAvailable = sf.isEnsemblAvailable();
- if (isAvailable)
- {
- System.out.println("Ensembl is UP!");
- }
- else
+ }
+
+ @Test(groups = "Network")
+ public void testCheckEnsembl_overload()
+ {
+ for (int i = 0; i < 20; i++)
{
- System.err
- .println("Ensembl is DOWN or unreachable ******************* BAD!");
+ assertTrue(sf.checkEnsembl(), "Error on " + (i + 1) + "th ping");
}
}
-
}
import static org.testng.AssertJUnit.assertEquals;
import static org.testng.AssertJUnit.assertFalse;
+import static org.testng.AssertJUnit.assertSame;
import static org.testng.AssertJUnit.assertTrue;
-import static org.testng.internal.junit.ArrayAsserts.assertArrayEquals;
import jalview.datamodel.Alignment;
import jalview.datamodel.SequenceFeature;
import jalview.datamodel.SequenceI;
+import jalview.datamodel.features.SequenceFeatures;
import jalview.gui.JvOptionPane;
import jalview.io.DataSourceType;
import jalview.io.FastaFile;
import java.lang.reflect.Method;
import java.util.Arrays;
+import java.util.List;
import org.testng.Assert;
import org.testng.annotations.AfterClass;
}
- @Test(groups = "Functional")
- public void testIsTranscriptIdentifier()
- {
- EnsemblSeqProxy testee = new EnsemblGene();
- assertFalse(testee.isTranscriptIdentifier(null));
- assertFalse(testee.isTranscriptIdentifier(""));
- assertFalse(testee.isTranscriptIdentifier("ENSG00000012345"));
- assertTrue(testee.isTranscriptIdentifier("ENST00000012345"));
- assertTrue(testee.isTranscriptIdentifier("ENSMUST00000012345"));
- assertFalse(testee.isTranscriptIdentifier("enst00000012345"));
- assertFalse(testee.isTranscriptIdentifier("ENST000000123456"));
- assertFalse(testee.isTranscriptIdentifier("ENST0000001234"));
- }
-
- @Test(groups = "Functional")
- public void testIsGeneIdentifier()
- {
- EnsemblSeqProxy testee = new EnsemblGene();
- assertFalse(testee.isGeneIdentifier(null));
- assertFalse(testee.isGeneIdentifier(""));
- assertFalse(testee.isGeneIdentifier("ENST00000012345"));
- assertTrue(testee.isGeneIdentifier("ENSG00000012345"));
- assertTrue(testee.isGeneIdentifier("ENSMUSG00000012345"));
- assertFalse(testee.isGeneIdentifier("ensg00000012345"));
- assertFalse(testee.isGeneIdentifier("ENSG000000123456"));
- assertFalse(testee.isGeneIdentifier("ENSG0000001234"));
- }
-
/**
* Test the method that appends a single allele's reverse complement to a
* string buffer
SequenceFeature sf2 = new SequenceFeature("", "", 8, 12, 0f, null);
SequenceFeature sf3 = new SequenceFeature("", "", 8, 13, 0f, null);
SequenceFeature sf4 = new SequenceFeature("", "", 11, 11, 0f, null);
- SequenceFeature[] sfs = new SequenceFeature[] { sf1, sf2, sf3, sf4 };
+ List<SequenceFeature> sfs = Arrays.asList(new SequenceFeature[] { sf1,
+ sf2, sf3, sf4 });
// sort by start position ascending (forward strand)
// sf2 and sf3 tie and should not be reordered by sorting
- EnsemblSeqProxy.sortFeatures(sfs, true);
- assertArrayEquals(new SequenceFeature[] { sf2, sf3, sf1, sf4 }, sfs);
+ SequenceFeatures.sortFeatures(sfs, true);
+ assertSame(sfs.get(0), sf2);
+ assertSame(sfs.get(1), sf3);
+ assertSame(sfs.get(2), sf1);
+ assertSame(sfs.get(3), sf4);
// sort by end position descending (reverse strand)
- EnsemblSeqProxy.sortFeatures(sfs, false);
- assertArrayEquals(new SequenceFeature[] { sf1, sf3, sf2, sf4 }, sfs);
+ SequenceFeatures.sortFeatures(sfs, false);
+ assertSame(sfs.get(0), sf1);
+ assertSame(sfs.get(1), sf3);
+ assertSame(sfs.get(2), sf2);
+ assertSame(sfs.get(3), sf4);
}
}
--- /dev/null
+package jalview.ext.ensembl;
+
+import static org.testng.Assert.assertFalse;
+import static org.testng.Assert.assertTrue;
+
+import java.util.Set;
+
+import org.testng.annotations.Test;
+
+public class SpeciesTest
+{
+ @Test
+ public void testGetModelOrganisms()
+ {
+ Set<Species> models = Species.getModelOrganisms();
+ assertTrue(models.contains(Species.human));
+ assertFalse(models.contains(Species.horse));
+ for (Species s : Species.values())
+ {
+ if (s.isModelOrganism())
+ {
+ assertTrue(models.contains(s));
+ }
+ else
+ {
+ assertFalse(models.contains(s));
+ }
+ }
+ }
+}
/*
* the ID is also the group for features derived from structure data
*/
- assertNotNull(structureData.getSeqs().get(0).getSequenceFeatures()[0].featureGroup);
- assertEquals(
- structureData.getSeqs().get(0).getSequenceFeatures()[0].featureGroup,
- "localstruct");
-
+ String featureGroup = structureData.getSeqs().get(0)
+ .getSequenceFeatures().get(0).featureGroup;
+ assertNotNull(featureGroup);
+ assertEquals(featureGroup, "localstruct");
}
}
{
{
SequenceI struseq = null;
- String sq_ = new String(sq.getSequence()).toLowerCase();
+ String sq_ = sq.getSequenceAsString().toLowerCase();
for (SequenceI _struseq : pdbf.getSeqsAsArray())
{
- final String lowerCase = new String(_struseq.getSequence())
+ final String lowerCase = _struseq.getSequenceAsString()
.toLowerCase();
if (lowerCase.equals(sq_))
{
assertEquals(model.getAtomSpec(), "#0:1-4.B,5-9.C|#1:2-5.A,8.A,5-10.B");
model.addRange(0, 3, 10, "C"); // subsumes 5-9
assertEquals(model.getAtomSpec(), "#0:1-4.B,3-10.C|#1:2-5.A,8.A,5-10.B");
+ model.addRange(5, 25, 35, " "); // empty chain code - e.g. from homology
+ // modelling
+ assertEquals(model.getAtomSpec(),
+ "#0:1-4.B,3-10.C|#1:2-5.A,8.A,5-10.B|#5:25-35.");
+
}
}
import jalview.gui.Preferences;
import jalview.gui.StructureViewer;
import jalview.gui.StructureViewer.ViewerType;
+import jalview.io.DataSourceType;
import jalview.io.FileLoader;
import jalview.structure.StructureMapping;
import jalview.structure.StructureSelectionManager;
import java.io.IOException;
import java.util.List;
import java.util.Vector;
-import jalview.io.DataSourceType;
import org.testng.annotations.AfterClass;
import org.testng.annotations.AfterMethod;
binding.copyStructureAttributesToFeatures("phi", af.getViewport()
.getAlignPanel());
fr.setVisible("phi");
- List<SequenceFeature> fs = fr.findFeaturesAtRes(fer2Arath, 54);
+ List<SequenceFeature> fs = fer2Arath.getFeatures().findFeatures(54, 54);
assertEquals(fs.size(), 3);
- assertEquals(fs.get(0).getType(), "RESNUM");
- assertEquals(fs.get(1).getType(), "phi");
- assertEquals(fs.get(2).getType(), "phi");
- assertEquals(fs.get(1).getDescription(), "A"); // chain
- assertEquals(fs.get(2).getDescription(), "B");
- assertEquals(fs.get(1).getScore(), -131.0713f, 0.001f);
- assertEquals(fs.get(2).getScore(), -127.39512, 0.001f);
+ /*
+ * order of returned features is not guaranteed
+ */
+ assertTrue("RESNUM".equals(fs.get(0).getType())
+ || "RESNUM".equals(fs.get(1).getType())
+ || "RESNUM".equals(fs.get(2).getType()));
+ assertTrue(fs.contains(new SequenceFeature("phi", "A", 54, 54,
+ -131.0713f, "Chimera")));
+ assertTrue(fs.contains(new SequenceFeature("phi", "B", 54, 54,
+ -127.39512f, "Chimera")));
/*
* tear down - also in AfterMethod
int res, String featureType)
{
String where = "at position " + res;
- List<SequenceFeature> fs = fr.findFeaturesAtRes(seq, res);
+ List<SequenceFeature> fs = seq.getFeatures().findFeatures(res, res);
+
assertEquals(fs.size(), 2, where);
assertEquals(fs.get(0).getType(), "RESNUM", where);
SequenceFeature sf = fs.get(1);
{
Jalview.main(new String[] { "-nonews", "-props",
"test/jalview/testProps.jvprops" });
+
+ /*
+ * remove any sequence mappings left lying around by other tests
+ */
+ StructureSelectionManager ssm = StructureSelectionManager
+ .getStructureSelectionManager(Desktop.instance);
+ ssm.resetAll();
}
@BeforeMethod(alwaysRun = true)
testee = new AlignViewport(al);
}
- @Test(groups = { "Functional" })
- public void testCollateForPdb()
- {
- // JBP: What behaviour is this supposed to test ?
- /*
- * Set up sequence pdb ids
- */
- PDBEntry pdb1 = new PDBEntry("1ABC", "B", Type.PDB, "1ABC.pdb");
- PDBEntry pdb2 = new PDBEntry("2ABC", "C", Type.PDB, "2ABC.pdb");
- PDBEntry pdb3 = new PDBEntry("3ABC", "D", Type.PDB, "3ABC.pdb");
-
- /*
- * seq1 and seq3 refer to 1abcB, seq2 to 2abcC, none to 3abcD
- */
- al.getSequenceAt(0).getDatasetSequence()
- .addPDBId(new PDBEntry("1ABC", "B", Type.PDB, "1ABC.pdb"));
- al.getSequenceAt(2).getDatasetSequence()
- .addPDBId(new PDBEntry("1ABC", "B", Type.PDB, "1ABC.pdb"));
- al.getSequenceAt(1).getDatasetSequence()
- .addPDBId(new PDBEntry("2ABC", "C", Type.PDB, "2ABC.pdb"));
- /*
- * Add a second chain PDB xref to Seq2 - should not result in a duplicate in
- * the results
- */
- al.getSequenceAt(1).getDatasetSequence()
- .addPDBId(new PDBEntry("2ABC", "D", Type.PDB, "2ABC.pdb"));
- /*
- * Seq3 refers to 3abc - this does not match 3ABC (as the code stands)
- */
- al.getSequenceAt(2).getDatasetSequence()
- .addPDBId(new PDBEntry("3abc", "D", Type.PDB, "3ABC.pdb"));
-
- /*
- * run method under test
- */
- SequenceI[][] seqs = testee.collateForPDB(new PDBEntry[] { pdb1, pdb2,
- pdb3 });
-
- // seq1 and seq3 refer to PDBEntry[0]
- assertEquals(2, seqs[0].length);
- assertSame(al.getSequenceAt(0), seqs[0][0]);
- assertSame(al.getSequenceAt(2), seqs[0][1]);
-
- // seq2 refers to PDBEntry[1]
- assertEquals(1, seqs[1].length);
- assertSame(al.getSequenceAt(1), seqs[1][0]);
-
- // no sequence refers to PDBEntry[2]
- assertEquals(0, seqs[2].length);
- }
-
/**
* Test that a mapping is not deregistered when a second view is closed but
* the first still holds a reference to the mapping
*/
StructureSelectionManager ssm = StructureSelectionManager
.getStructureSelectionManager(Desktop.instance);
- assertEquals(2, ssm.getSequenceMappings().size());
- assertTrue(ssm.getSequenceMappings().contains(acf1));
- assertTrue(ssm.getSequenceMappings().contains(acf2));
+ List<AlignedCodonFrame> sequenceMappings = ssm.getSequenceMappings();
+ assertEquals(2, sequenceMappings.size());
+ assertTrue(sequenceMappings.contains(acf1));
+ assertTrue(sequenceMappings.contains(acf2));
/*
* Close the second view. Verify that mappings are not removed as the first
* view still holds a reference to them.
*/
af1.closeMenuItem_actionPerformed(false);
- assertEquals(2, ssm.getSequenceMappings().size());
- assertTrue(ssm.getSequenceMappings().contains(acf1));
- assertTrue(ssm.getSequenceMappings().contains(acf2));
+ assertEquals(2, sequenceMappings.size());
+ assertTrue(sequenceMappings.contains(acf1));
+ assertTrue(sequenceMappings.contains(acf2));
}
/**
package jalview.gui;
import static org.testng.Assert.assertEquals;
+import static org.testng.Assert.assertNotEquals;
import jalview.bin.Cache;
import jalview.bin.Jalview;
.getAlignment().getWidth() - 1 - 21); // 21 is the number of hidden
// columns
}
+
+ /**
+ * Test that update layout reverts to original (unwrapped) values for endRes
+ * and endSeq when switching from wrapped to unwrapped mode (JAL-2739)
+ */
+ @Test(groups = "Functional")
+ public void TestUpdateLayout_endRes()
+ {
+ // get details of original alignment dimensions
+ ViewportRanges ranges = af.getViewport().getRanges();
+ int endres = ranges.getEndRes();
+
+ // wrap
+ af.alignPanel.getAlignViewport().setWrapAlignment(true);
+ af.alignPanel.updateLayout();
+
+ // endRes changes
+ assertNotEquals(ranges.getEndRes(), endres);
+
+ // unwrap
+ af.alignPanel.getAlignViewport().setWrapAlignment(false);
+ af.alignPanel.updateLayout();
+
+ // endRes and endSeq back to original values
+ assertEquals(ranges.getEndRes(), endres);
+
+ }
}
--- /dev/null
+package jalview.gui;
+
+import static org.testng.Assert.assertEquals;
+import static org.testng.Assert.assertTrue;
+
+import jalview.analysis.AlignmentGenerator;
+import jalview.bin.Cache;
+import jalview.bin.Jalview;
+import jalview.datamodel.AlignmentI;
+import jalview.datamodel.SequenceGroup;
+import jalview.io.DataSourceType;
+import jalview.io.FileLoader;
+
+import java.io.File;
+import java.io.IOException;
+import java.io.PrintStream;
+
+import org.testng.annotations.BeforeClass;
+import org.testng.annotations.Test;
+
+public class FreeUpMemoryTest
+{
+ private static final int ONE_MB = 1000 * 1000;
+
+ /**
+ * Configure (read-only) Jalview property settings for test
+ */
+ @BeforeClass(alwaysRun = true)
+ public void setUp()
+ {
+ Jalview.main(new String[] { "-nonews", "-props",
+ "test/jalview/testProps.jvprops" });
+ Cache.applicationProperties.setProperty("SHOW_ANNOTATIONS",
+ Boolean.TRUE.toString());
+ Cache.applicationProperties.setProperty("SHOW_QUALITY",
+ Boolean.TRUE.toString());
+ Cache.applicationProperties.setProperty("SHOW_CONSERVATION",
+ Boolean.TRUE.toString());
+ Cache.applicationProperties.setProperty("SHOW_OCCUPANCY",
+ Boolean.TRUE.toString());
+ Cache.applicationProperties.setProperty("SHOW_IDENTITY",
+ Boolean.TRUE.toString());
+ }
+
+ /**
+ * A simple test that memory is released when all windows are closed.
+ * <ul>
+ * <li>generates a reasonably large alignment and loads it</li>
+ * <li>performs various operations on the alignment</li>
+ * <li>closes all windows</li>
+ * <li>requests garbage collection</li>
+ * <li>asserts that the remaining memory footprint (heap usage) is 'not large'
+ * </li>
+ * </ul>
+ * If the test fails, this suggests that a reference to some large object
+ * (perhaps the alignment data, or some annotation / Tree / PCA data) has
+ * failed to be garbage collected. If this is the case, the heap will need to
+ * be inspected manually (suggest using jvisualvm) in order to track down
+ * where large objects are still referenced. The code (for example
+ * AlignmentViewport.dispose()) should then be updated to ensure references to
+ * large objects are set to null when they are no longer required.
+ *
+ * @throws IOException
+ */
+ @Test(groups = "Memory")
+ public void testFreeMemoryOnClose() throws IOException
+ {
+ File f = generateAlignment();
+ f.deleteOnExit();
+
+ doStuffInJalview(f);
+
+ Desktop.instance.closeAll_actionPerformed(null);
+
+ checkUsedMemory(35L);
+ }
+
+ /**
+ * Requests garbage collection and then checks whether remaining memory in use
+ * is less than the expected value (in Megabytes)
+ *
+ * @param expectedMax
+ */
+ protected void checkUsedMemory(long expectedMax)
+ {
+ /*
+ * request garbage collection and wait briefly for it to run;
+ * NB there is no guarantee when, or whether, it will do so
+ */
+ System.gc();
+ waitFor(100);
+
+ /*
+ * a second gc() call should not be necessary - but it is!
+ * the test passes with it, and fails without it
+ */
+ System.gc();
+ waitFor(100);
+
+ /*
+ * check used memory is 'reasonably low'
+ */
+ long availableMemory = Runtime.getRuntime().totalMemory() / ONE_MB;
+ long freeMemory = Runtime.getRuntime().freeMemory() / ONE_MB;
+ long usedMemory = availableMemory - freeMemory;
+
+ /*
+ * sanity check - fails if any frame was added after
+ * closeAll_actionPerformed
+ */
+ assertEquals(Desktop.instance.getAllFrames().length, 0);
+
+ /*
+ * if this assertion fails
+ * - set a breakpoint here
+ * - run jvisualvm to inspect a heap dump of Jalview
+ * - identify large objects in the heap and their referers
+ * - fix code as necessary to null the references on close
+ */
+ System.out.println("Used memory after gc = " + usedMemory + "MB");
+ assertTrue(usedMemory < expectedMax, String.format(
+ "Used memory %d should be less than %d (Recommend running test manually to verify)",
+ usedMemory,
+ expectedMax));
+ }
+
+ /**
+ * Loads an alignment from file and exercises various operations in Jalview
+ *
+ * @param f
+ */
+ protected void doStuffInJalview(File f)
+ {
+ /*
+ * load alignment, wait for consensus and other threads to complete
+ */
+ AlignFrame af = new FileLoader().LoadFileWaitTillLoaded(f.getPath(),
+ DataSourceType.FILE);
+ while (af.getViewport().isCalcInProgress())
+ {
+ waitFor(200);
+ }
+
+ /*
+ * set a selection group - potential memory leak if it retains
+ * a reference to the alignment
+ */
+ SequenceGroup sg = new SequenceGroup();
+ sg.setStartRes(0);
+ sg.setEndRes(100);
+ AlignmentI al = af.viewport.getAlignment();
+ for (int i = 0; i < al.getHeight(); i++)
+ {
+ sg.addSequence(al.getSequenceAt(i), false);
+ }
+ af.viewport.setSelectionGroup(sg);
+
+ /*
+ * compute Tree and PCA (on all sequences, 100 columns)
+ */
+ af.openTreePcaDialog();
+ CalculationChooser dialog = af.alignPanel.getCalculationDialog();
+ dialog.openPcaPanel("BLOSUM62", dialog.getSimilarityParameters(true));
+ dialog.openTreePanel("BLOSUM62", dialog.getSimilarityParameters(false));
+
+ /*
+ * wait until Tree and PCA have been computed
+ */
+ while (af.viewport.getCurrentTree() == null
+ && dialog.getPcaPanel().isWorking())
+ {
+ waitFor(10);
+ }
+
+ /*
+ * give Swing time to add the PCA panel (?!?)
+ */
+ waitFor(100);
+ }
+
+ /**
+ * Wait for waitMs miliseconds
+ *
+ * @param waitMs
+ */
+ protected void waitFor(int waitMs)
+ {
+ try
+ {
+ Thread.sleep(waitMs);
+ } catch (InterruptedException e)
+ {
+ }
+ }
+
+ /**
+ * Generates an alignment and saves it in a temporary file, to be loaded by
+ * Jalview. We use a peptide alignment (so Conservation and Quality are
+ * calculated), which is wide enough to ensure Consensus, Conservation and
+ * Occupancy have a significant memory footprint (if not removed from the
+ * heap).
+ *
+ * @return
+ * @throws IOException
+ */
+ private File generateAlignment() throws IOException
+ {
+ File f = File.createTempFile("MemoryTest", "fa");
+ PrintStream ps = new PrintStream(f);
+ AlignmentGenerator ag = new AlignmentGenerator(false, ps);
+ int width = 100000;
+ int height = 100;
+ ag.generate(width, height, 0, 10, 15);
+ return f;
+ }
+}
--- /dev/null
+package jalview.gui;
+
+import static org.testng.Assert.assertEquals;
+
+import jalview.datamodel.AlignmentI;
+import jalview.datamodel.SequenceGroup;
+import jalview.io.DataSourceType;
+import jalview.io.FileLoader;
+
+import javax.swing.JTextArea;
+
+import junit.extensions.PA;
+
+import org.testng.annotations.Test;
+
+public class PairwiseAlignmentPanelTest
+{
+ @Test(groups = "Functional")
+ public void testConstructor_withSelectionGroup()
+ {
+ AlignFrame af = new FileLoader().LoadFileWaitTillLoaded(
+ "examples/uniref50.fa", DataSourceType.FILE);
+ AlignViewport viewport = af.getViewport();
+ AlignmentI al = viewport.getAlignment();
+
+ /*
+ * select columns 29-36 of sequences 4 and 5 for alignment
+ * Q93XJ9_SOLTU/23-29 L-KAISNV
+ * FER1_PEA/26-32 V-TTTKAF
+ */
+ SequenceGroup sg = new SequenceGroup();
+ sg.addSequence(al.getSequenceAt(3), false);
+ sg.addSequence(al.getSequenceAt(4), false);
+ sg.setStartRes(28);
+ sg.setEndRes(35);
+ viewport.setSelectionGroup(sg);
+
+ PairwiseAlignPanel testee = new PairwiseAlignPanel(viewport);
+
+ String text = ((JTextArea) PA.getValue(testee, "textarea")).getText();
+ String expected = "Score = 80.0\n" + "Length of alignment = 4\n"
+ + "Sequence FER1_PEA/29-32 (Sequence length = 7)\n"
+ + "Sequence Q93XJ9_SOLTU/23-26 (Sequence length = 7)\n\n"
+ + " FER1_PEA/29-32 TKAF\n" + " ||.\n"
+ + "Q93XJ9_SOLTU/23-26 LKAI\n\n" + "Percentage ID = 50.00\n\n";
+ assertEquals(text, expected);
+ }
+
+ /**
+ * This test aligns the same sequences as testConstructor_withSelectionGroup
+ * but as a complete alignment (no selection). Note that in fact the user is
+ * currently required to make a selection in order to calculate pairwise
+ * alignments, so this case does not arise.
+ */
+ @Test(groups = "Functional")
+ public void testConstructor_noSelectionGroup()
+ {
+ String seqs = ">Q93XJ9_SOLTU/23-29\nL-KAISNV\n>FER1_PEA/26-32\nV-TTTKAF\n";
+ AlignFrame af = new FileLoader().LoadFileWaitTillLoaded(seqs,
+ DataSourceType.PASTE);
+ AlignViewport viewport = af.getViewport();
+
+ PairwiseAlignPanel testee = new PairwiseAlignPanel(viewport);
+
+ String text = ((JTextArea) PA.getValue(testee, "textarea")).getText();
+ String expected = "Score = 80.0\n" + "Length of alignment = 4\n"
+ + "Sequence FER1_PEA/29-32 (Sequence length = 7)\n"
+ + "Sequence Q93XJ9_SOLTU/23-26 (Sequence length = 7)\n\n"
+ + " FER1_PEA/29-32 TKAF\n" + " ||.\n"
+ + "Q93XJ9_SOLTU/23-26 LKAI\n\n" + "Percentage ID = 50.00\n\n";
+ assertEquals(text, expected);
+ }
+}
import javax.swing.JLabel;
import javax.swing.JPanel;
+import javax.swing.SwingUtilities;
import org.testng.Assert;
import org.testng.annotations.BeforeClass;
* @param layout
* @param msgs
*/
- private void verifyProgress(GridLayout layout, String[] msgs)
+ private void verifyProgress(final GridLayout layout, final String[] msgs)
{
+ try
+ {
+ SwingUtilities.invokeAndWait(new Runnable()
+ {
+ @Override
+ public void run()
+ {
int msgCount = msgs.length;
assertEquals(1 + msgCount, layout.getRows());
assertEquals(msgCount, statusPanel.getComponentCount());
assertEquals(msgs[i++],
((JLabel) ((JPanel) c).getComponent(0)).getText());
}
+ }
+ });
+ } catch (Exception e)
+ {
+ throw new AssertionError(
+ "Unexpected exception waiting for progress bar validation",
+ e);
+ }
}
}
--- /dev/null
+package jalview.gui;
+
+import static org.testng.Assert.assertEquals;
+
+import jalview.datamodel.AlignmentI;
+import jalview.io.DataSourceType;
+import jalview.io.FileLoader;
+
+import java.awt.Font;
+import java.awt.FontMetrics;
+
+import junit.extensions.PA;
+
+import org.testng.annotations.Test;
+
+import sun.swing.SwingUtilities2;
+
+public class SeqCanvasTest
+{
+ /**
+ * Test the method that computes wrapped width in residues, height of wrapped
+ * widths in pixels, and the number of widths visible
+ */
+ @Test(groups = "Functional")
+ public void testCalculateWrappedGeometry_noAnnotations()
+ {
+ AlignFrame af = new FileLoader().LoadFileWaitTillLoaded(
+ "examples/uniref50.fa", DataSourceType.FILE);
+ AlignViewport av = af.getViewport();
+ AlignmentI al = av.getAlignment();
+ assertEquals(al.getWidth(), 157);
+ assertEquals(al.getHeight(), 15);
+
+ av.setWrapAlignment(true);
+ av.getRanges().setStartEndSeq(0, 14);
+ av.setFont(new Font("SansSerif", Font.PLAIN, 14), true);
+ int charHeight = av.getCharHeight();
+ int charWidth = av.getCharWidth();
+ assertEquals(charHeight, 17);
+ assertEquals(charWidth, 12);
+
+ SeqCanvas testee = af.alignPanel.getSeqPanel().seqCanvas;
+
+ /*
+ * first with scales above, left, right
+ */
+ av.setShowAnnotation(false);
+ av.setScaleAboveWrapped(true);
+ av.setScaleLeftWrapped(true);
+ av.setScaleRightWrapped(true);
+ FontMetrics fm = SwingUtilities2.getFontMetrics(testee, av.getFont());
+ int labelWidth = fm.stringWidth("000") + charWidth;
+ assertEquals(labelWidth, 39); // 3 x 9 + charWidth
+
+ /*
+ * width 400 pixels leaves (400 - 2*labelWidth) for residue columns
+ * take the whole multiple of character widths
+ */
+ int canvasWidth = 400;
+ int canvasHeight = 300;
+ int residueColumns = (canvasWidth - 2 * labelWidth) / charWidth;
+ int wrappedWidth = testee.calculateWrappedGeometry(canvasWidth, canvasHeight);
+ assertEquals(wrappedWidth, residueColumns);
+ assertEquals(PA.getValue(testee, "labelWidthWest"), labelWidth);
+ assertEquals(PA.getValue(testee, "labelWidthEast"), labelWidth);
+ assertEquals(PA.getValue(testee, "wrappedSpaceAboveAlignment"),
+ 2 * charHeight);
+ int repeatingHeight = (int) PA.getValue(testee, "wrappedRepeatHeightPx");
+ assertEquals(repeatingHeight, charHeight * (2 + al.getHeight()));
+ assertEquals(PA.getValue(testee, "wrappedVisibleWidths"), 1);
+
+ /*
+ * repeat height is 17 * (2 + 15) = 289
+ * make canvas height 2 * 289 + 3 * charHeight so just enough to
+ * draw 2 widths and the first sequence of a third
+ */
+ canvasHeight = charHeight * (17 * 2 + 3);
+ testee.calculateWrappedGeometry(canvasWidth, canvasHeight);
+ assertEquals(PA.getValue(testee, "wrappedVisibleWidths"), 3);
+
+ /*
+ * reduce canvas height by 1 pixel - should not be enough height
+ * to draw 3 widths
+ */
+ canvasHeight -= 1;
+ testee.calculateWrappedGeometry(canvasWidth, canvasHeight);
+ assertEquals(PA.getValue(testee, "wrappedVisibleWidths"), 2);
+
+ /*
+ * turn off scale above - can now fit in 2 and a bit widths
+ */
+ av.setScaleAboveWrapped(false);
+ testee.calculateWrappedGeometry(canvasWidth, canvasHeight);
+ assertEquals(PA.getValue(testee, "wrappedVisibleWidths"), 3);
+
+ /*
+ * reduce height to enough for 2 widths and not quite a third
+ * i.e. two repeating heights + spacer + sequence - 1 pixel
+ */
+ canvasHeight = charHeight * (16 * 2 + 2) - 1;
+ testee.calculateWrappedGeometry(canvasWidth, canvasHeight);
+ assertEquals(PA.getValue(testee, "wrappedVisibleWidths"), 2);
+
+ /*
+ * make canvas width enough for scales and 20 residues
+ */
+ canvasWidth = 2 * labelWidth + 20 * charWidth;
+ wrappedWidth = testee.calculateWrappedGeometry(canvasWidth,
+ canvasHeight);
+ assertEquals(wrappedWidth, 20);
+
+ /*
+ * reduce width by 1 pixel - rounds down to 19 residues
+ */
+ canvasWidth -= 1;
+ wrappedWidth = testee.calculateWrappedGeometry(canvasWidth,
+ canvasHeight);
+ assertEquals(wrappedWidth, 19);
+
+ /*
+ * turn off West scale - adds labelWidth (39) to available for residues
+ * which with the 11 remainder makes 50 which is 4 more charWidths rem 2
+ */
+ av.setScaleLeftWrapped(false);
+ wrappedWidth = testee.calculateWrappedGeometry(canvasWidth,
+ canvasHeight);
+ assertEquals(wrappedWidth, 23);
+
+ /*
+ * add 10 pixels to width to fit in another whole residue column
+ */
+ canvasWidth += 9;
+ wrappedWidth = testee.calculateWrappedGeometry(canvasWidth,
+ canvasHeight);
+ assertEquals(wrappedWidth, 23);
+ canvasWidth += 1;
+ wrappedWidth = testee.calculateWrappedGeometry(canvasWidth,
+ canvasHeight);
+ assertEquals(wrappedWidth, 24);
+
+ /*
+ * turn off East scale to gain 39 more pixels (3 columns remainder 3)
+ */
+ av.setScaleRightWrapped(false);
+ wrappedWidth = testee.calculateWrappedGeometry(canvasWidth,
+ canvasHeight);
+ assertEquals(wrappedWidth, 27);
+
+ /*
+ * add 9 pixels to width to gain a residue column
+ */
+ canvasWidth += 8;
+ wrappedWidth = testee.calculateWrappedGeometry(canvasWidth,
+ canvasHeight);
+ assertEquals(wrappedWidth, 27);
+ canvasWidth += 1;
+ wrappedWidth = testee.calculateWrappedGeometry(canvasWidth,
+ canvasHeight);
+ assertEquals(wrappedWidth, 28);
+
+ /*
+ * now West but not East scale - lose 39 pixels or 4 columns
+ */
+ av.setScaleLeftWrapped(true);
+ wrappedWidth = testee.calculateWrappedGeometry(canvasWidth,
+ canvasHeight);
+ assertEquals(wrappedWidth, 24);
+
+ /*
+ * adding 3 pixels to width regains one column
+ */
+ canvasWidth += 2;
+ wrappedWidth = testee.calculateWrappedGeometry(canvasWidth,
+ canvasHeight);
+ assertEquals(wrappedWidth, 24);
+ canvasWidth += 1;
+ wrappedWidth = testee.calculateWrappedGeometry(canvasWidth,
+ canvasHeight);
+ assertEquals(wrappedWidth, 25);
+
+ /*
+ * turn off scales left and right, make width exactly 157 columns
+ */
+ av.setScaleLeftWrapped(false);
+ canvasWidth = al.getWidth() * charWidth;
+ testee.calculateWrappedGeometry(canvasWidth, canvasHeight);
+ assertEquals(PA.getValue(testee, "wrappedVisibleWidths"), 1);
+ }
+
+ /**
+ * Test the method that computes wrapped width in residues, height of wrapped
+ * widths in pixels, and the number of widths visible
+ */
+ @Test(groups = "Functional")
+ public void testCalculateWrappedGeometry_withAnnotations()
+ {
+ AlignFrame af = new FileLoader().LoadFileWaitTillLoaded(
+ "examples/uniref50.fa", DataSourceType.FILE);
+ AlignViewport av = af.getViewport();
+ AlignmentI al = av.getAlignment();
+ assertEquals(al.getWidth(), 157);
+ assertEquals(al.getHeight(), 15);
+
+ av.setWrapAlignment(true);
+ av.getRanges().setStartEndSeq(0, 14);
+ av.setFont(new Font("SansSerif", Font.PLAIN, 14), true);
+ int charHeight = av.getCharHeight();
+ int charWidth = av.getCharWidth();
+ assertEquals(charHeight, 17);
+ assertEquals(charWidth, 12);
+
+ SeqCanvas testee = af.alignPanel.getSeqPanel().seqCanvas;
+
+ /*
+ * first with scales above, left, right
+ */
+ av.setShowAnnotation(true);
+ av.setScaleAboveWrapped(true);
+ av.setScaleLeftWrapped(true);
+ av.setScaleRightWrapped(true);
+ FontMetrics fm = SwingUtilities2.getFontMetrics(testee, av.getFont());
+ int labelWidth = fm.stringWidth("000") + charWidth;
+ assertEquals(labelWidth, 39); // 3 x 9 + charWidth
+ int annotationHeight = testee.getAnnotationHeight();
+
+ /*
+ * width 400 pixels leaves (400 - 2*labelWidth) for residue columns
+ * take the whole multiple of character widths
+ */
+ int canvasWidth = 400;
+ int canvasHeight = 300;
+ int residueColumns = (canvasWidth - 2 * labelWidth) / charWidth;
+ int wrappedWidth = testee.calculateWrappedGeometry(canvasWidth, canvasHeight);
+ assertEquals(wrappedWidth, residueColumns);
+ assertEquals(PA.getValue(testee, "labelWidthWest"), labelWidth);
+ assertEquals(PA.getValue(testee, "labelWidthEast"), labelWidth);
+ assertEquals(PA.getValue(testee, "wrappedSpaceAboveAlignment"),
+ 2 * charHeight);
+ int repeatingHeight = (int) PA.getValue(testee, "wrappedRepeatHeightPx");
+ assertEquals(repeatingHeight, charHeight * (2 + al.getHeight())
+ + annotationHeight);
+ assertEquals(PA.getValue(testee, "wrappedVisibleWidths"), 1);
+
+ /*
+ * repeat height is 17 * (2 + 15) = 289 + annotationHeight = 507
+ * make canvas height 2 * 289 + 3 * charHeight so just enough to
+ * draw 2 widths and the first sequence of a third
+ */
+ canvasHeight = charHeight * (17 * 2 + 3) + 2 * annotationHeight;
+ testee.calculateWrappedGeometry(canvasWidth, canvasHeight);
+ assertEquals(PA.getValue(testee, "wrappedVisibleWidths"), 3);
+
+ /*
+ * reduce canvas height by 1 pixel - should not be enough height
+ * to draw 3 widths
+ */
+ canvasHeight -= 1;
+ testee.calculateWrappedGeometry(canvasWidth, canvasHeight);
+ assertEquals(PA.getValue(testee, "wrappedVisibleWidths"), 2);
+
+ /*
+ * turn off scale above - can now fit in 2 and a bit widths
+ */
+ av.setScaleAboveWrapped(false);
+ testee.calculateWrappedGeometry(canvasWidth, canvasHeight);
+ assertEquals(PA.getValue(testee, "wrappedVisibleWidths"), 3);
+
+ /*
+ * reduce height to enough for 2 widths and not quite a third
+ * i.e. two repeating heights + spacer + sequence - 1 pixel
+ */
+ canvasHeight = charHeight * (16 * 2 + 2) + 2 * annotationHeight - 1;
+ testee.calculateWrappedGeometry(canvasWidth, canvasHeight);
+ assertEquals(PA.getValue(testee, "wrappedVisibleWidths"), 2);
+
+ /*
+ * add 1 pixel to height - should now get 3 widths drawn
+ */
+ canvasHeight += 1;
+ testee.calculateWrappedGeometry(canvasWidth, canvasHeight);
+ assertEquals(PA.getValue(testee, "wrappedVisibleWidths"), 3);
+ }
+}
package jalview.gui;
import static org.testng.Assert.assertEquals;
+import static org.testng.Assert.assertFalse;
import static org.testng.Assert.assertNull;
+import static org.testng.Assert.assertSame;
+import static org.testng.Assert.assertTrue;
import jalview.datamodel.PDBEntry;
import jalview.datamodel.PDBEntry.Type;
+import jalview.datamodel.Sequence;
+import jalview.datamodel.SequenceI;
+
+import java.util.Map;
import org.testng.annotations.BeforeClass;
import org.testng.annotations.Test;
}
@Test(groups = "Functional")
- public void testGetUniquePdbFiles()
+ public void testGetSequencesForPdbs()
{
- assertNull(StructureViewer.getUniquePdbFiles(null));
+ StructureViewer sv = new StructureViewer(null);
+
+ assertNull(sv.getSequencesForPdbs(null, null));
PDBEntry pdbe1 = new PDBEntry("1A70", "A", Type.PDB, "path1");
PDBEntry pdbe2 = new PDBEntry("3A6S", "A", Type.PDB, "path2");
PDBEntry pdbe4 = new PDBEntry("1GAQ", "A", Type.PDB, null);
PDBEntry pdbe5 = new PDBEntry("3A6S", "B", Type.PDB, "path2");
PDBEntry pdbe6 = new PDBEntry("1GAQ", "B", Type.PDB, null);
+ PDBEntry[] pdbs = new PDBEntry[] { pdbe1, pdbe2, pdbe3, pdbe4, pdbe5,
+ pdbe6 };
+
+ /*
+ * seq1 ... seq6 associated with pdbe1 ... pdbe6
+ */
+ SequenceI[] seqs = new SequenceI[pdbs.length];
+ for (int i = 0; i < seqs.length; i++)
+ {
+ seqs[i] = new Sequence("Seq" + i, "abc");
+ }
/*
- * pdbe2 and pdbe5 get removed as having a duplicate file path
+ * pdbe3/5/6 should get removed as having a duplicate file path
*/
- PDBEntry[] uniques = StructureViewer.getUniquePdbFiles(new PDBEntry[] {
- pdbe1, pdbe2, pdbe3, pdbe4, pdbe5, pdbe6 });
- assertEquals(uniques,
- new PDBEntry[] { pdbe1, pdbe2, pdbe4, pdbe6 });
+ Map<PDBEntry, SequenceI[]> uniques = sv.getSequencesForPdbs(pdbs, seqs);
+ assertTrue(uniques.containsKey(pdbe1));
+ assertTrue(uniques.containsKey(pdbe2));
+ assertFalse(uniques.containsKey(pdbe3));
+ assertTrue(uniques.containsKey(pdbe4));
+ assertFalse(uniques.containsKey(pdbe5));
+ assertFalse(uniques.containsKey(pdbe6));
+
+ // 1A70 associates with seq1 and seq3
+ SequenceI[] ss = uniques.get(pdbe1);
+ assertEquals(ss.length, 2);
+ assertSame(seqs[0], ss[0]);
+ assertSame(seqs[2], ss[1]);
+
+ // 3A6S has seq2 and seq5
+ ss = uniques.get(pdbe2);
+ assertEquals(ss.length, 2);
+ assertSame(seqs[1], ss[0]);
+ assertSame(seqs[4], ss[1]);
+
+ // 1GAQ has seq4 and seq6
+ ss = uniques.get(pdbe4);
+ assertEquals(ss.length, 2);
+ assertSame(seqs[3], ss[0]);
+ assertSame(seqs[5], ss[1]);
}
}
import jalview.datamodel.PDBEntry;
import jalview.datamodel.SequenceFeature;
import jalview.datamodel.SequenceI;
+import jalview.datamodel.features.SequenceFeatures;
import jalview.gui.AlignFrame;
import jalview.gui.JvOptionPane;
import jalview.structure.StructureImportSettings;
import jalview.structure.StructureImportSettings.StructureParser;
import java.io.File;
+import java.util.List;
import org.testng.annotations.AfterClass;
import org.testng.annotations.BeforeClass;
/*
* 1GAQ/A
*/
- SequenceFeature[] sf = al.getSequenceAt(0).getSequenceFeatures();
- assertEquals(296, sf.length);
- assertEquals("RESNUM", sf[0].getType());
- assertEquals("GLU: 19 1gaqA", sf[0].getDescription());
- assertEquals("RESNUM", sf[295].getType());
- assertEquals("TYR: 314 1gaqA", sf[295].getDescription());
+ List<SequenceFeature> sf = al.getSequenceAt(0).getSequenceFeatures();
+ SequenceFeatures.sortFeatures(sf, true);
+ assertEquals(296, sf.size());
+ assertEquals("RESNUM", sf.get(0).getType());
+ assertEquals("GLU: 19 1gaqA", sf.get(0).getDescription());
+ assertEquals("RESNUM", sf.get(295).getType());
+ assertEquals("TYR: 314 1gaqA", sf.get(295).getDescription());
/*
* 1GAQ/B
*/
sf = al.getSequenceAt(1).getSequenceFeatures();
- assertEquals(98, sf.length);
- assertEquals("RESNUM", sf[0].getType());
- assertEquals("ALA: 1 1gaqB", sf[0].getDescription());
- assertEquals("RESNUM", sf[97].getType());
- assertEquals("ALA: 98 1gaqB", sf[97].getDescription());
+ SequenceFeatures.sortFeatures(sf, true);
+ assertEquals(98, sf.size());
+ assertEquals("RESNUM", sf.get(0).getType());
+ assertEquals("ALA: 1 1gaqB", sf.get(0).getDescription());
+ assertEquals("RESNUM", sf.get(97).getType());
+ assertEquals("ALA: 98 1gaqB", sf.get(97).getDescription());
/*
* 1GAQ/C
*/
sf = al.getSequenceAt(2).getSequenceFeatures();
- assertEquals(296, sf.length);
- assertEquals("RESNUM", sf[0].getType());
- assertEquals("GLU: 19 1gaqC", sf[0].getDescription());
- assertEquals("RESNUM", sf[295].getType());
- assertEquals("TYR: 314 1gaqC", sf[295].getDescription());
+ SequenceFeatures.sortFeatures(sf, true);
+ assertEquals(296, sf.size());
+ assertEquals("RESNUM", sf.get(0).getType());
+ assertEquals("GLU: 19 1gaqC", sf.get(0).getDescription());
+ assertEquals("RESNUM", sf.get(295).getType());
+ assertEquals("TYR: 314 1gaqC", sf.get(295).getDescription());
}
@Test(groups = { "Functional" })
import static org.testng.AssertJUnit.assertEquals;
import static org.testng.AssertJUnit.assertFalse;
import static org.testng.AssertJUnit.assertNotNull;
-import static org.testng.AssertJUnit.assertNull;
import static org.testng.AssertJUnit.assertTrue;
import jalview.api.FeatureColourI;
import jalview.datamodel.SequenceDummy;
import jalview.datamodel.SequenceFeature;
import jalview.datamodel.SequenceI;
+import jalview.datamodel.features.SequenceFeatures;
import jalview.gui.AlignFrame;
+import jalview.gui.Desktop;
import jalview.gui.JvOptionPane;
+import jalview.structure.StructureSelectionManager;
import java.awt.Color;
import java.io.File;
import java.io.IOException;
+import java.util.ArrayList;
+import java.util.Arrays;
+import java.util.HashMap;
+import java.util.List;
import java.util.Map;
+import org.testng.annotations.AfterClass;
import org.testng.annotations.BeforeClass;
import org.testng.annotations.Test;
public class FeaturesFileTest
{
+ private static String simpleGffFile = "examples/testdata/simpleGff3.gff";
+
+ @AfterClass(alwaysRun = true)
+ public void tearDownAfterClass()
+ {
+ /*
+ * remove any sequence mappings created so they don't pollute other tests
+ */
+ StructureSelectionManager ssm = StructureSelectionManager
+ .getStructureSelectionManager(Desktop.instance);
+ ssm.resetAll();
+ }
@BeforeClass(alwaysRun = true)
public void setUpJvOptionPane()
JvOptionPane.setMockResponse(JvOptionPane.CANCEL_OPTION);
}
- private static String simpleGffFile = "examples/testdata/simpleGff3.gff";
-
@Test(groups = { "Functional" })
public void testParse() throws Exception
{
/*
* verify (some) features on sequences
*/
- SequenceFeature[] sfs = al.getSequenceAt(0).getDatasetSequence()
+ List<SequenceFeature> sfs = al.getSequenceAt(0).getDatasetSequence()
.getSequenceFeatures(); // FER_CAPAA
- assertEquals(8, sfs.length);
- SequenceFeature sf = sfs[0];
+ SequenceFeatures.sortFeatures(sfs, true);
+ assertEquals(8, sfs.size());
+
+ /*
+ * verify (in ascending start position order)
+ */
+ SequenceFeature sf = sfs.get(0);
assertEquals("Pfam family%LINK%", sf.description);
assertEquals(0, sf.begin);
assertEquals(0, sf.end);
assertEquals("Pfam family|http://pfam.xfam.org/family/PF00111",
sf.links.get(0));
- sf = sfs[1];
+ sf = sfs.get(1);
+ assertEquals("Ferredoxin_fold Status: True Positive ", sf.description);
+ assertEquals(3, sf.begin);
+ assertEquals(93, sf.end);
+ assertEquals("uniprot", sf.featureGroup);
+ assertEquals("Cath", sf.type);
+
+ sf = sfs.get(2);
+ assertEquals("Fer2 Status: True Positive Pfam 8_8%LINK%",
+ sf.description);
+ assertEquals("Pfam 8_8|http://pfam.xfam.org/family/PF00111",
+ sf.links.get(0));
+ assertEquals(8, sf.begin);
+ assertEquals(83, sf.end);
+ assertEquals("uniprot", sf.featureGroup);
+ assertEquals("Pfam", sf.type);
+
+ sf = sfs.get(3);
assertEquals("Iron-sulfur (2Fe-2S)", sf.description);
assertEquals(39, sf.begin);
assertEquals(39, sf.end);
assertEquals("uniprot", sf.featureGroup);
assertEquals("METAL", sf.type);
- sf = sfs[2];
+
+ sf = sfs.get(4);
assertEquals("Iron-sulfur (2Fe-2S)", sf.description);
assertEquals(44, sf.begin);
assertEquals(44, sf.end);
assertEquals("uniprot", sf.featureGroup);
assertEquals("METAL", sf.type);
- sf = sfs[3];
+
+ sf = sfs.get(5);
assertEquals("Iron-sulfur (2Fe-2S)", sf.description);
assertEquals(47, sf.begin);
assertEquals(47, sf.end);
assertEquals("uniprot", sf.featureGroup);
assertEquals("METAL", sf.type);
- sf = sfs[4];
+
+ sf = sfs.get(6);
assertEquals("Iron-sulfur (2Fe-2S)", sf.description);
assertEquals(77, sf.begin);
assertEquals(77, sf.end);
assertEquals("uniprot", sf.featureGroup);
assertEquals("METAL", sf.type);
- sf = sfs[5];
- assertEquals("Fer2 Status: True Positive Pfam 8_8%LINK%",
- sf.description);
- assertEquals("Pfam 8_8|http://pfam.xfam.org/family/PF00111",
- sf.links.get(0));
- assertEquals(8, sf.begin);
- assertEquals(83, sf.end);
- assertEquals("uniprot", sf.featureGroup);
- assertEquals("Pfam", sf.type);
- sf = sfs[6];
- assertEquals("Ferredoxin_fold Status: True Positive ", sf.description);
- assertEquals(3, sf.begin);
- assertEquals(93, sf.end);
- assertEquals("uniprot", sf.featureGroup);
- assertEquals("Cath", sf.type);
- sf = sfs[7];
+
+ sf = sfs.get(7);
assertEquals(
"High confidence server. Only hits with scores over 0.8 are reported. PHOSPHORYLATION (T) 89_8%LINK%",
sf.description);
assertEquals(colours.get("METAL").getColour(), new Color(0xcc9900));
// verify feature on FER_CAPAA
- SequenceFeature[] sfs = al.getSequenceAt(0).getDatasetSequence()
+ List<SequenceFeature> sfs = al.getSequenceAt(0).getDatasetSequence()
.getSequenceFeatures();
- assertEquals(1, sfs.length);
- SequenceFeature sf = sfs[0];
+ assertEquals(1, sfs.size());
+ SequenceFeature sf = sfs.get(0);
assertEquals("Iron-sulfur,2Fe-2S", sf.description);
assertEquals(44, sf.begin);
assertEquals(45, sf.end);
// verify feature on FER1_SOLLC
sfs = al.getSequenceAt(2).getDatasetSequence().getSequenceFeatures();
- assertEquals(1, sfs.length);
- sf = sfs[0];
+ assertEquals(1, sfs.size());
+ sf = sfs.get(0);
assertEquals("uniprot", sf.description);
assertEquals(55, sf.begin);
assertEquals(130, sf.end);
featuresFile.parse(al.getDataset(), colours, true));
// verify feature on FER_CAPAA
- SequenceFeature[] sfs = al.getSequenceAt(0).getDatasetSequence()
+ List<SequenceFeature> sfs = al.getSequenceAt(0).getDatasetSequence()
.getSequenceFeatures();
- assertEquals(1, sfs.length);
- SequenceFeature sf = sfs[0];
+ assertEquals(1, sfs.size());
+ SequenceFeature sf = sfs.get(0);
// description parsed from Note attribute
assertEquals("Iron-sulfur (2Fe-2S),another note", sf.description);
assertEquals(39, sf.begin);
// verify feature on FER1_SOLLC1
sfs = al.getSequenceAt(2).getDatasetSequence().getSequenceFeatures();
- assertEquals(1, sfs.length);
- sf = sfs[0];
+ assertEquals(1, sfs.size());
+ sf = sfs.get(0);
// ID used for description if available
assertEquals("$23", sf.description);
assertEquals(55, sf.begin);
featuresFile.parse(al.getDataset(), colours, true));
// verify FER_CAPAA feature
- SequenceFeature[] sfs = al.getSequenceAt(0).getDatasetSequence()
+ List<SequenceFeature> sfs = al.getSequenceAt(0).getDatasetSequence()
.getSequenceFeatures();
- assertEquals(1, sfs.length);
- SequenceFeature sf = sfs[0];
+ assertEquals(1, sfs.size());
+ SequenceFeature sf = sfs.get(0);
assertEquals("Iron-sulfur (2Fe-2S)", sf.description);
assertEquals(39, sf.begin);
assertEquals(39, sf.end);
// verify FER1_SOLLC feature
sfs = al.getSequenceAt(2).getDatasetSequence().getSequenceFeatures();
- assertEquals(1, sfs.length);
- sf = sfs[0];
+ assertEquals(1, sfs.size());
+ sf = sfs.get(0);
assertEquals("Iron-phosphorus (2Fe-P)", sf.description);
assertEquals(86, sf.begin);
assertEquals(87, sf.end);
assertFalse("dummy replacement buggy for seq2",
placeholderseq.equals(seq2.getSequenceAsString()));
assertNotNull("No features added to seq1", seq1.getSequenceFeatures());
- assertEquals("Wrong number of features", 3,
- seq1.getSequenceFeatures().length);
- assertNull(seq2.getSequenceFeatures());
+ assertEquals("Wrong number of features", 3, seq1.getSequenceFeatures()
+ .size());
+ assertTrue(seq2.getSequenceFeatures().isEmpty());
assertEquals(
"Wrong number of features",
0,
seq2.getSequenceFeatures() == null ? 0 : seq2
- .getSequenceFeatures().length);
+ .getSequenceFeatures().size());
assertTrue(
"Expected at least one CDNA/Protein mapping for seq1",
dataset.getCodonFrame(seq1) != null
+ "GAMMA-TURN\tred|0,255,255|20.0|95.0|below|66.0\n"
+ "Pfam\tred\n"
+ "STARTGROUP\tuniprot\n"
+ + "Cath\tFER_CAPAA\t-1\t0\t0\tDomain\n" // non-positional feature
+ "Iron\tFER_CAPAA\t-1\t39\t39\tMETAL\n"
+ "Turn\tFER_CAPAA\t-1\t36\t38\tGAMMA-TURN\n"
+ "<html>Pfam domain<a href=\"http://pfam.xfam.org/family/PF00111\">Pfam_3_4</a></html>\tFER_CAPAA\t-1\t20\t20\tPfam\n"
featuresFile.parse(al.getDataset(), colours, false);
/*
- * first with no features displayed
+ * add positional and non-positional features with null and
+ * empty feature group to check handled correctly
+ */
+ SequenceI seq = al.getSequenceAt(1); // FER_CAPAN
+ seq.addSequenceFeature(new SequenceFeature("Pfam", "desc1", 0, 0, 1.3f,
+ null));
+ seq.addSequenceFeature(new SequenceFeature("Pfam", "desc2", 4, 9,
+ Float.NaN, null));
+ seq = al.getSequenceAt(2); // FER1_SOLLC
+ seq.addSequenceFeature(new SequenceFeature("Pfam", "desc3", 0, 0,
+ Float.NaN, ""));
+ seq.addSequenceFeature(new SequenceFeature("Pfam", "desc4", 5, 8,
+ -2.6f, ""));
+
+ /*
+ * first with no features displayed, exclude non-positional features
*/
FeatureRenderer fr = af.alignPanel.getFeatureRenderer();
Map<String, FeatureColourI> visible = fr.getDisplayedFeatureCols();
+ List<String> visibleGroups = new ArrayList<String>(
+ Arrays.asList(new String[] {}));
String exported = featuresFile.printJalviewFormat(
- al.getSequencesArray(), visible);
+ al.getSequencesArray(), visible, visibleGroups, false);
String expected = "No Features Visible";
assertEquals(expected, exported);
/*
+ * include non-positional features
+ */
+ visibleGroups.add("uniprot");
+ exported = featuresFile.printJalviewFormat(al.getSequencesArray(),
+ visible, visibleGroups, true);
+ expected = "Cath\tFER_CAPAA\t-1\t0\t0\tDomain\t0.0\n"
+ + "desc1\tFER_CAPAN\t-1\t0\t0\tPfam\t1.3\n"
+ + "desc3\tFER1_SOLLC\t-1\t0\t0\tPfam\n" // NaN is not output
+ + "\nSTARTGROUP\tuniprot\nENDGROUP\tuniprot\n";
+ assertEquals(expected, exported);
+
+ /*
* set METAL (in uniprot group) and GAMMA-TURN visible, but not Pfam
*/
fr.setVisible("METAL");
fr.setVisible("GAMMA-TURN");
visible = fr.getDisplayedFeatureCols();
exported = featuresFile.printJalviewFormat(al.getSequencesArray(),
- visible);
+ visible, visibleGroups, false);
expected = "METAL\tcc9900\n"
+ "GAMMA-TURN\tff0000|00ffff|20.0|95.0|below|66.0\n"
+ "\nSTARTGROUP\tuniprot\n"
- + "Iron\tFER_CAPAA\t-1\t39\t39\tMETAL\t0.0\n"
+ "Turn\tFER_CAPAA\t-1\t36\t38\tGAMMA-TURN\t0.0\n"
+ + "Iron\tFER_CAPAA\t-1\t39\t39\tMETAL\t0.0\n"
+ "ENDGROUP\tuniprot\n";
assertEquals(expected, exported);
fr.setVisible("Pfam");
visible = fr.getDisplayedFeatureCols();
exported = featuresFile.printJalviewFormat(al.getSequencesArray(),
- visible);
+ visible, visibleGroups, false);
/*
- * note the order of feature types is uncontrolled - derives from
- * FeaturesDisplayed.featuresDisplayed which is a HashSet
+ * features are output within group, ordered by sequence and by type
*/
expected = "METAL\tcc9900\n"
+ "Pfam\tff0000\n"
+ "GAMMA-TURN\tff0000|00ffff|20.0|95.0|below|66.0\n"
+ "\nSTARTGROUP\tuniprot\n"
- + "Iron\tFER_CAPAA\t-1\t39\t39\tMETAL\t0.0\n"
+ "Turn\tFER_CAPAA\t-1\t36\t38\tGAMMA-TURN\t0.0\n"
+ + "Iron\tFER_CAPAA\t-1\t39\t39\tMETAL\t0.0\n"
+ "<html>Pfam domain<a href=\"http://pfam.xfam.org/family/PF00111\">Pfam_3_4</a></html>\tFER_CAPAA\t-1\t20\t20\tPfam\t0.0\n"
- + "ENDGROUP\tuniprot\n";
+ + "ENDGROUP\tuniprot\n"
+ // null / empty group features output after features in named
+ // groups:
+ + "desc2\tFER_CAPAN\t-1\t4\t9\tPfam\n"
+ + "desc4\tFER1_SOLLC\t-1\t5\t8\tPfam\t-2.6\n";
+ assertEquals(expected, exported);
+ }
+
+ @Test(groups = { "Functional" })
+ public void testPrintGffFormat() throws Exception
+ {
+ File f = new File("examples/uniref50.fa");
+ AlignmentI al = readAlignmentFile(f);
+ AlignFrame af = new AlignFrame(al, 500, 500);
+
+ /*
+ * no features
+ */
+ FeaturesFile featuresFile = new FeaturesFile();
+ FeatureRenderer fr = af.alignPanel.getFeatureRenderer();
+ Map<String, FeatureColourI> visible = new HashMap<String, FeatureColourI>();
+ List<String> visibleGroups = new ArrayList<String>(
+ Arrays.asList(new String[] {}));
+ String exported = featuresFile.printGffFormat(al.getSequencesArray(),
+ visible, visibleGroups, false);
+ String gffHeader = "##gff-version 2\n";
+ assertEquals(gffHeader, exported);
+ exported = featuresFile.printGffFormat(al.getSequencesArray(), visible,
+ visibleGroups, true);
+ assertEquals(gffHeader, exported);
+
+ /*
+ * add some features
+ */
+ al.getSequenceAt(0).addSequenceFeature(
+ new SequenceFeature("Domain", "Cath", 0, 0, 0f, "Uniprot"));
+ al.getSequenceAt(0).addSequenceFeature(
+ new SequenceFeature("METAL", "Cath", 39, 39, 1.2f, null));
+ al.getSequenceAt(1)
+ .addSequenceFeature(
+ new SequenceFeature("GAMMA-TURN", "Turn", 36, 38, 2.1f,
+ "s3dm"));
+ SequenceFeature sf = new SequenceFeature("Pfam", "", 20, 20, 0f,
+ "Uniprot");
+ sf.setAttributes("x=y;black=white");
+ sf.setStrand("+");
+ sf.setPhase("2");
+ al.getSequenceAt(1).addSequenceFeature(sf);
+
+ /*
+ * with no features displayed, exclude non-positional features
+ */
+ exported = featuresFile.printGffFormat(al.getSequencesArray(), visible,
+ visibleGroups, false);
+ assertEquals(gffHeader, exported);
+
+ /*
+ * include non-positional features
+ */
+ visibleGroups.add("Uniprot");
+ exported = featuresFile.printGffFormat(al.getSequencesArray(), visible,
+ visibleGroups, true);
+ String expected = gffHeader
+ + "FER_CAPAA\tUniprot\tDomain\t0\t0\t0.0\t.\t.\n";
+ assertEquals(expected, exported);
+
+ /*
+ * set METAL (in uniprot group) and GAMMA-TURN visible, but not Pfam
+ * only Uniprot group visible here...
+ */
+ fr.setVisible("METAL");
+ fr.setVisible("GAMMA-TURN");
+ visible = fr.getDisplayedFeatureCols();
+ exported = featuresFile.printGffFormat(al.getSequencesArray(), visible,
+ visibleGroups, false);
+ // METAL feature has null group: description used for column 2
+ expected = gffHeader + "FER_CAPAA\tCath\tMETAL\t39\t39\t1.2\t.\t.\n";
+ assertEquals(expected, exported);
+
+ /*
+ * set s3dm group visible
+ */
+ visibleGroups.add("s3dm");
+ exported = featuresFile.printGffFormat(al.getSequencesArray(), visible,
+ visibleGroups, false);
+ // METAL feature has null group: description used for column 2
+ expected = gffHeader + "FER_CAPAA\tCath\tMETAL\t39\t39\t1.2\t.\t.\n"
+ + "FER_CAPAN\ts3dm\tGAMMA-TURN\t36\t38\t2.1\t.\t.\n";
+ assertEquals(expected, exported);
+
+ /*
+ * now set Pfam visible
+ */
+ fr.setVisible("Pfam");
+ visible = fr.getDisplayedFeatureCols();
+ exported = featuresFile.printGffFormat(al.getSequencesArray(), visible,
+ visibleGroups, false);
+ // Pfam feature columns include strand(+), phase(2), attributes
+ expected = gffHeader
+ + "FER_CAPAA\tCath\tMETAL\t39\t39\t1.2\t.\t.\n"
+ + "FER_CAPAN\ts3dm\tGAMMA-TURN\t36\t38\t2.1\t.\t.\n"
+ + "FER_CAPAN\tUniprot\tPfam\t20\t20\t0.0\t+\t2\tx=y;black=white\n";
assertEquals(expected, exported);
}
}
import jalview.datamodel.SequenceFeature;
import jalview.datamodel.SequenceGroup;
import jalview.datamodel.SequenceI;
+import jalview.datamodel.features.SequenceFeatures;
import jalview.gui.AlignFrame;
import jalview.gui.JvOptionPane;
import jalview.json.binding.biojson.v1.ColourSchemeMapper;
import java.util.ArrayList;
import java.util.HashMap;
import java.util.List;
+import java.util.Map;
import org.testng.Assert;
import org.testng.AssertJUnit;
@BeforeTest(alwaysRun = true)
public void setup() throws Exception
{
+ /*
+ * construct expected values
+ * nb this have to match the data in examples/example.json
+ */
// create and add sequences
Sequence[] seqs = new Sequence[5];
seqs[0] = new Sequence("FER_CAPAN",
// create and add sequence features
SequenceFeature seqFeature2 = new SequenceFeature("feature_x",
- "desciption", "status", 6, 15, "Jalview");
+ "theDesc", 6, 15, "Jalview");
SequenceFeature seqFeature3 = new SequenceFeature("feature_x",
- "desciption", "status", 9, 18, "Jalview");
+ "theDesc", 9, 18, "Jalview");
SequenceFeature seqFeature4 = new SequenceFeature("feature_x",
- "desciption", "status", 9, 18, "Jalview");
+ "theDesc", 9, 18, "Jalview");
+ // non-positional feature:
+ SequenceFeature seqFeature5 = new SequenceFeature("Domain",
+ "My description", 0, 0, "Pfam");
seqs[2].addSequenceFeature(seqFeature2);
seqs[3].addSequenceFeature(seqFeature3);
seqs[4].addSequenceFeature(seqFeature4);
+ seqs[2].addSequenceFeature(seqFeature5);
for (Sequence seq : seqs)
{
return true;
}
- public boolean isSeqMatched(SequenceI expectedSeq, SequenceI actualSeq)
+ boolean isSeqMatched(SequenceI expectedSeq, SequenceI actualSeq)
{
System.out.println("Testing >>> " + actualSeq.getName());
+ actualGrp.getStartRes());
System.out.println(expectedGrp.getEndRes() + " | "
+ actualGrp.getEndRes());
- System.out.println(expectedGrp.cs + " | " + actualGrp.cs);
+ System.out.println(expectedGrp.cs.getColourScheme() + " | "
+ + actualGrp.cs.getColourScheme());
+ boolean colourSchemeMatches = (expectedGrp.cs.getColourScheme() == null && actualGrp.cs
+ .getColourScheme() == null)
+ || expectedGrp.cs.getColourScheme().getClass()
+ .equals(actualGrp.cs.getColourScheme().getClass());
if (expectedGrp.getName().equals(actualGrp.getName())
&& expectedGrp.getColourText() == actualGrp.getColourText()
&& expectedGrp.getDisplayBoxes() == actualGrp.getDisplayBoxes()
&& expectedGrp.getIgnoreGapsConsensus() == actualGrp
.getIgnoreGapsConsensus()
- && (expectedGrp.cs.getClass().equals(actualGrp.cs.getClass()))
+ && colourSchemeMatches
&& expectedGrp.getSequences().size() == actualGrp
.getSequences().size()
&& expectedGrp.getStartRes() == actualGrp.getStartRes()
private boolean featuresMatched(SequenceI seq1, SequenceI seq2)
{
- boolean matched = false;
try
{
if (seq1 == null && seq2 == null)
return true;
}
- SequenceFeature[] inFeature = seq1.getSequenceFeatures();
- SequenceFeature[] outFeature = seq2.getSequenceFeatures();
+ List<SequenceFeature> inFeature = seq1.getFeatures().getAllFeatures();
+ List<SequenceFeature> outFeature = seq2.getFeatures()
+ .getAllFeatures();
- if (inFeature == null && outFeature == null)
- {
- return true;
- }
- else if ((inFeature == null && outFeature != null)
- || (inFeature != null && outFeature == null))
+ if (inFeature.size() != outFeature.size())
{
+ System.err.println("Feature count in: " + inFeature.size()
+ + ", out: " + outFeature.size());
return false;
}
- int testSize = inFeature.length;
- int matchedCount = 0;
+ SequenceFeatures.sortFeatures(inFeature, true);
+ SequenceFeatures.sortFeatures(outFeature, true);
+ int i = 0;
for (SequenceFeature in : inFeature)
{
- for (SequenceFeature out : outFeature)
+ SequenceFeature out = outFeature.get(i);
+ /*
+ System.out.println(out.getType() + " | " + in.getType());
+ System.out.println(out.getBegin() + " | " + in.getBegin());
+ System.out.println(out.getEnd() + " | " + in.getEnd());
+ */
+ if (!in.equals(out))
{
- System.out.println(out.getType() + " | " + in.getType());
- System.out.println(out.getBegin() + " | " + in.getBegin());
- System.out.println(out.getEnd() + " | " + in.getEnd());
-
- if (inFeature.length == outFeature.length
- && in.getBegin() == out.getBegin()
- && in.getEnd() == out.getEnd()
- && in.getScore() == out.getScore()
- && in.getFeatureGroup().equals(out.getFeatureGroup())
- && in.getType().equals(out.getType()))
- {
-
- ++matchedCount;
- }
+ System.err.println("Mismatch of " + in.toString() + " "
+ + out.toString());
+ return false;
}
- }
- System.out.println("matched count >>>>>> " + matchedCount);
- if (testSize == matchedCount)
- {
- matched = true;
+ /*
+ if (in.getBegin() == out.getBegin() && in.getEnd() == out.getEnd()
+ && in.getScore() == out.getScore()
+ && in.getFeatureGroup().equals(out.getFeatureGroup())
+ && in.getType().equals(out.getType())
+ && mapsMatch(in.otherDetails, out.otherDetails))
+ {
+ }
+ else
+ {
+ System.err.println("Feature[" + i + "] mismatch, in: "
+ + in.toString() + ", out: "
+ + outFeature.get(i).toString());
+ return false;
+ }
+ */
+ i++;
}
} catch (Exception e)
{
e.printStackTrace();
}
// System.out.println(">>>>>>>>>>>>>> features matched : " + matched);
- return matched;
+ return true;
+ }
+
+ boolean mapsMatch(Map<String, Object> m1, Map<String, Object> m2)
+ {
+ if (m1 == null || m2 == null)
+ {
+ if (m1 != null || m2 != null)
+ {
+ System.err
+ .println("only one SequenceFeature.otherDetails is not null");
+ return false;
+ }
+ else
+ {
+ return true;
+ }
+ }
+ if (m1.size() != m2.size())
+ {
+ System.err.println("otherDetails map different sizes");
+ return false;
+ }
+ for (String key : m1.keySet())
+ {
+ if (!m2.containsKey(key))
+ {
+ System.err.println(key + " in only one otherDetails");
+ return false;
+ }
+ if (m1.get(key) == null && m2.get(key) != null || m1.get(key) != null
+ && m2.get(key) == null || !m1.get(key).equals(m2.get(key)))
+ {
+ System.err.println(key + " values in otherDetails don't match");
+ return false;
+ }
+ }
+ return true;
}
/**
Assert.assertNotNull(newAlignment.getGroups());
for (SequenceGroup seqGrp : newAlignment.getGroups())
{
- SequenceGroup expectedGrp = expectedGrps.get(seqGrp.getName());
+ SequenceGroup expectedGrp = copySg;
AssertJUnit.assertTrue(
"Failed SequenceGroup Test for >>> " + seqGrp.getName(),
isGroupMatched(expectedGrp, seqGrp));
package jalview.io;
import static org.testng.AssertJUnit.assertEquals;
+import static org.testng.AssertJUnit.assertTrue;
+import jalview.datamodel.DBRefEntry;
+import jalview.datamodel.Sequence;
import jalview.datamodel.SequenceFeature;
+import jalview.datamodel.SequenceI;
import jalview.gui.JvOptionPane;
+import jalview.io.gff.GffConstants;
+import java.util.HashMap;
import java.util.Hashtable;
import java.util.Map;
+import junit.extensions.PA;
+
import org.testng.annotations.BeforeClass;
import org.testng.annotations.Test;
// if no <html> tag, html-encodes > and < (only):
assertEquals("METAL 1 3; <br>&kHD>6", sb.toString());
}
+
+ @Test(groups = "Functional")
+ public void testCreateSequenceAnnotationReport()
+ {
+ SequenceAnnotationReport sar = new SequenceAnnotationReport(null);
+ StringBuilder sb = new StringBuilder();
+
+ SequenceI seq = new Sequence("s1", "MAKLKRFQSSTLL");
+ seq.setDescription("SeqDesc");
+
+ sar.createSequenceAnnotationReport(sb, seq, true, true, null);
+
+ /*
+ * positional features are ignored
+ */
+ seq.addSequenceFeature(new SequenceFeature("Domain", "Ferredoxin", 5,
+ 10, 1f, null));
+ assertEquals("<i><br>SeqDesc</i>", sb.toString());
+
+ /*
+ * non-positional feature
+ */
+ seq.addSequenceFeature(new SequenceFeature("Type1", "Nonpos", 0, 0, 1f,
+ null));
+ sb.setLength(0);
+ sar.createSequenceAnnotationReport(sb, seq, true, true, null);
+ String expected = "<i><br>SeqDesc<br>Type1 ; Nonpos</i>";
+ assertEquals(expected, sb.toString());
+
+ /*
+ * non-positional features not wanted
+ */
+ sb.setLength(0);
+ sar.createSequenceAnnotationReport(sb, seq, true, false, null);
+ assertEquals("<i><br>SeqDesc</i>", sb.toString());
+
+ /*
+ * add non-pos feature with score inside min-max range for feature type
+ * minmax holds { [positionalMin, positionalMax], [nonPosMin, nonPosMax] }
+ * score is only appended for positional features so ignored here!
+ * minMax are not recorded for non-positional features
+ */
+ seq.addSequenceFeature(new SequenceFeature("Metal", "Desc", 0, 0, 5f,
+ null));
+ Map<String, float[][]> minmax = new HashMap<String, float[][]>();
+ minmax.put("Metal", new float[][] { null, new float[] { 2f, 5f } });
+ sb.setLength(0);
+ sar.createSequenceAnnotationReport(sb, seq, true, true, minmax);
+ expected = "<i><br>SeqDesc<br>Metal ; Desc<br>Type1 ; Nonpos</i>";
+ assertEquals(expected, sb.toString());
+
+ /*
+ * 'linkonly' features are ignored; this is obsolete, as linkonly
+ * is only set by DasSequenceFetcher, and DAS is history
+ */
+ SequenceFeature sf = new SequenceFeature("Metal", "Desc", 0, 0, 5f,
+ null);
+ sf.setValue("linkonly", Boolean.TRUE);
+ seq.addSequenceFeature(sf);
+ sb.setLength(0);
+ sar.createSequenceAnnotationReport(sb, seq, true, true, minmax);
+ assertEquals(expected, sb.toString()); // unchanged!
+
+ /*
+ * 'clinical_significance' currently being specially included
+ */
+ SequenceFeature sf2 = new SequenceFeature("Variant", "Havana", 0, 0,
+ 5f, null);
+ sf2.setValue(GffConstants.CLINICAL_SIGNIFICANCE, "benign");
+ seq.addSequenceFeature(sf2);
+ sb.setLength(0);
+ sar.createSequenceAnnotationReport(sb, seq, true, true, minmax);
+ expected = "<i><br>SeqDesc<br>Metal ; Desc<br>Type1 ; Nonpos<br>Variant ; Havana; benign</i>";
+ assertEquals(expected, sb.toString());
+
+ /*
+ * add dbrefs
+ */
+ seq.addDBRef(new DBRefEntry("PDB", "0", "3iu1"));
+ seq.addDBRef(new DBRefEntry("Uniprot", "1", "P30419"));
+ // with showDbRefs = false
+ sb.setLength(0);
+ sar.createSequenceAnnotationReport(sb, seq, false, true, minmax);
+ assertEquals(expected, sb.toString()); // unchanged
+ // with showDbRefs = true
+ sb.setLength(0);
+ sar.createSequenceAnnotationReport(sb, seq, true, true, minmax);
+ expected = "<i><br>SeqDesc<br>UNIPROT P30419<br>PDB 3iu1<br>Metal ; Desc<br>Type1 ; Nonpos<br>Variant ; Havana; benign</i>";
+ assertEquals(expected, sb.toString());
+ // with showNonPositionalFeatures = false
+ sb.setLength(0);
+ sar.createSequenceAnnotationReport(sb, seq, true, false, minmax);
+ expected = "<i><br>SeqDesc<br>UNIPROT P30419<br>PDB 3iu1</i>";
+ assertEquals(expected, sb.toString());
+
+ // see other tests for treatment of status and html
+ }
+
+ /**
+ * Test that exercises an abbreviated sequence details report, with ellipsis
+ * where there are more than 40 different sources, or more than 4 dbrefs for a
+ * single source
+ */
+ @Test(groups = "Functional")
+ public void testCreateSequenceAnnotationReport_withEllipsis()
+ {
+ SequenceAnnotationReport sar = new SequenceAnnotationReport(null);
+ StringBuilder sb = new StringBuilder();
+
+ SequenceI seq = new Sequence("s1", "ABC");
+
+ int maxSources = (int) PA.getValue(sar, "MAX_SOURCES");
+ for (int i = 0; i <= maxSources; i++)
+ {
+ seq.addDBRef(new DBRefEntry("PDB" + i, "0", "3iu1"));
+ }
+
+ int maxRefs = (int) PA.getValue(sar, "MAX_REFS_PER_SOURCE");
+ for (int i = 0; i <= maxRefs; i++)
+ {
+ seq.addDBRef(new DBRefEntry("Uniprot", "0", "P3041" + i));
+ }
+
+ sar.createSequenceAnnotationReport(sb, seq, true, true, null, true);
+ String report = sb.toString();
+ assertTrue(report
+ .startsWith("<i><br>UNIPROT P30410, P30411, P30412, P30413,...<br>PDB0 3iu1"));
+ assertTrue(report
+ .endsWith("<br>PDB7 3iu1<br>PDB8,...<br>(Output Sequence Details to list all database references)</i>"));
+ }
}
seq_original = al.getSequencesArray();
SequenceI[] seq_new = new SequenceI[al_input.getSequencesArray().length];
seq_new = al_input.getSequencesArray();
- SequenceFeature[] sequenceFeatures_original, sequenceFeatures_new;
+ List<SequenceFeature> sequenceFeatures_original;
+ List<SequenceFeature> sequenceFeatures_new;
AlignmentAnnotation annot_original, annot_new;
//
for (int i = 0; i < al.getSequencesArray().length; i++)
&& seq_new[in].getSequenceFeatures() != null)
{
System.out.println("There are feature!!!");
- sequenceFeatures_original = new SequenceFeature[seq_original[i]
- .getSequenceFeatures().length];
sequenceFeatures_original = seq_original[i]
.getSequenceFeatures();
- sequenceFeatures_new = new SequenceFeature[seq_new[in]
- .getSequenceFeatures().length];
sequenceFeatures_new = seq_new[in].getSequenceFeatures();
- assertEquals("different number of features",
- seq_original[i].getSequenceFeatures().length,
- seq_new[in].getSequenceFeatures().length);
+ assertEquals("different number of features", seq_original[i]
+ .getSequenceFeatures().size(), seq_new[in]
+ .getSequenceFeatures().size());
- for (int feat = 0; feat < seq_original[i].getSequenceFeatures().length; feat++)
+ for (int feat = 0; feat < seq_original[i].getSequenceFeatures()
+ .size(); feat++)
{
assertEquals("Different features",
- sequenceFeatures_original[feat],
- sequenceFeatures_new[feat]);
+ sequenceFeatures_original.get(feat),
+ sequenceFeatures_new.get(feat));
}
}
// compare alignment annotation
import java.io.IOException;
import java.util.ArrayList;
+import java.util.HashMap;
import java.util.List;
+import java.util.Map;
import org.testng.annotations.BeforeClass;
import org.testng.annotations.Test;
.getToRanges().get(0));
}
+ @Test(groups = "Functional")
+ public void testGetDescription()
+ {
+ Gff3Helper testee = new Gff3Helper();
+ SequenceFeature sf = new SequenceFeature("type", "desc", 10, 20, 3f,
+ "group");
+ Map<String, List<String>> attributes = new HashMap<String, List<String>>();
+ assertNull(testee.getDescription(sf, attributes));
+
+ // ID if any is a fall-back for description
+ sf.setValue("ID", "Patrick");
+ assertEquals("Patrick", testee.getDescription(sf, attributes));
+
+ // Target is set by Exonerate
+ sf.setValue("Target", "Destination Moon");
+ assertEquals("Destination", testee.getDescription(sf, attributes));
+
+ // Ensembl variant feature - extract "alleles" value
+ // may be sequence_variant or a sub-type in the sequence ontology
+ sf = new SequenceFeature("feature_variant", "desc", 10, 20, 3f, "group");
+ List<String> atts = new ArrayList<String>();
+ atts.add("A");
+ atts.add("C");
+ atts.add("T");
+ attributes.put("alleles", atts);
+ assertEquals("A,C,T", testee.getDescription(sf, attributes));
+
+ // Ensembl transcript or exon feature - extract Name
+ List<String> atts2 = new ArrayList<String>();
+ atts2.add("ENSE00001871077");
+ attributes.put("Name", atts2);
+ sf = new SequenceFeature("transcript", "desc", 10, 20, 3f, "group");
+ assertEquals("ENSE00001871077", testee.getDescription(sf, attributes));
+ // transcript sub-type in SO
+ sf = new SequenceFeature("mRNA", "desc", 10, 20, 3f, "group");
+ assertEquals("ENSE00001871077", testee.getDescription(sf, attributes));
+ // special usage of feature by Ensembl
+ sf = new SequenceFeature("NMD_transcript_variant", "desc", 10, 20, 3f,
+ "group");
+ assertEquals("ENSE00001871077", testee.getDescription(sf, attributes));
+ // exon feature
+ sf = new SequenceFeature("exon", "desc", 10, 20, 3f, "group");
+ assertEquals("ENSE00001871077", testee.getDescription(sf, attributes));
+ }
}
package jalview.io.gff;
import static org.testng.AssertJUnit.assertEquals;
+import static org.testng.AssertJUnit.assertNotNull;
import static org.testng.AssertJUnit.assertSame;
import static org.testng.AssertJUnit.assertTrue;
import static org.testng.internal.junit.ArrayAsserts.assertArrayEquals;
import jalview.datamodel.AlignmentI;
import jalview.datamodel.Sequence;
import jalview.datamodel.SequenceDummy;
+import jalview.datamodel.SequenceFeature;
import jalview.datamodel.SequenceI;
import jalview.gui.JvOptionPane;
assertEquals(1, newseqs.size());
assertTrue(newseqs.get(0) instanceof SequenceDummy);
assertEquals("match$17_5_30", newseqs.get(0).getName());
+
+ assertNotNull(newseqs.get(0).getSequenceFeatures());
+ assertEquals(1, newseqs.get(0).getSequenceFeatures().size());
+ SequenceFeature sf = newseqs.get(0).getSequenceFeatures().get(0);
+ assertEquals(1, sf.getBegin());
+ assertEquals(26, sf.getEnd());
+ assertEquals("Pfam", sf.getType());
+ assertEquals("4Fe-4S dicluster domain", sf.getDescription());
+ assertEquals("InterProScan", sf.getFeatureGroup());
+
assertEquals(1, align.getCodonFrames().size());
AlignedCodonFrame mapping = align.getCodonFrames().iterator().next();
AlignViewport av = af.getViewport();
/*
- * scale has minor ticks at 5 and 15, major at 10 and 20
+ * scale has minor ticks at 5, 15, 25, major at 10 and 20
* (these are base 1, ScaleMark holds base 0 values)
*/
List<ScaleMark> marks = new ScaleRenderer().calculateMarks(av, 0, 25);
- assertEquals(marks.size(), 4);
+ assertEquals(marks.size(), 5);
assertFalse(marks.get(0).major);
assertEquals(marks.get(0).column, 4);
assertEquals(marks.get(3).column, 19);
assertEquals(marks.get(3).text, "20");
+ assertFalse(marks.get(4).major);
+ assertEquals(marks.get(4).column, 24);
+ assertNull(marks.get(4).text);
+
/*
* now hide columns 9-11 and 18-20 (base 1)
* scale marks are now in the same columns as before, but
av.hideColumns(8, 10);
av.hideColumns(17, 19);
marks = new ScaleRenderer().calculateMarks(av, 0, 25);
- assertEquals(marks.size(), 4);
+ assertEquals(marks.size(), 5);
assertFalse(marks.get(0).major);
assertEquals(marks.get(0).column, 4);
assertNull(marks.get(0).text);
assertTrue(marks.get(3).major);
assertEquals(marks.get(3).column, 19);
assertEquals(marks.get(3).text, "26"); // +6 hidden columns
+ assertFalse(marks.get(4).major);
+ assertEquals(marks.get(4).column, 24);
+ assertNull(marks.get(4).text);
}
}
import static org.testng.Assert.assertEquals;
import static org.testng.Assert.assertFalse;
+import static org.testng.Assert.assertNotEquals;
import static org.testng.Assert.assertNull;
import static org.testng.Assert.assertTrue;
import jalview.schemes.FeatureColour;
import java.awt.Color;
+import java.util.List;
import org.testng.annotations.BeforeMethod;
import org.testng.annotations.BeforeTest;
@BeforeMethod(alwaysRun = true)
public void setUpBeforeTest()
{
- SequenceFeature[] sfs = seq.getSequenceFeatures();
- if (sfs != null)
+ List<SequenceFeature> sfs = seq.getSequenceFeatures();
+ for (SequenceFeature sf : sfs)
{
- for (SequenceFeature sf : sfs)
- {
- seq.deleteFeature(sf);
- }
+ seq.deleteFeature(sf);
}
fr.findAllFeatures(true);
}
@Test(groups = "Functional")
+ public void testFindFeatureAtEnd()
+ {
+ /*
+ * terminal residue feature
+ */
+ seq.addSequenceFeature(new SequenceFeature("PDBRESNUM", "pdb res 1",
+ seq.getEnd(), seq.getEnd(), Float.NaN, "1seq.pdb"));
+ fr.setColour("PDBRESNUM", new FeatureColour(Color.red));
+ fr.featuresAdded();
+ av.setShowSequenceFeatures(true);
+
+ /*
+ * final column should have PDBRESNUM feature, the others not
+ */
+ Color c = finder.findFeatureColour(Color.blue, seq,
+ seq.getLength() - 2);
+ assertNotEquals(c, Color.red);
+ c = finder.findFeatureColour(Color.blue, seq, seq.getLength() - 1);
+ assertEquals(c, Color.red);
+ }
+
+ @Test(groups = "Functional")
public void testFindFeatureColour_graduatedFeatureColour()
{
seq.addSequenceFeature(new SequenceFeature("kd", "hydrophobicity", 2,
@Test(groups = "Functional")
public void testFindFeatureColour_graduatedWithThreshold()
{
- seq.addSequenceFeature(new SequenceFeature("kd", "hydrophobicity", 2,
+ String kdFeature = "kd";
+ String metalFeature = "Metal";
+ seq.addSequenceFeature(new SequenceFeature(kdFeature, "hydrophobicity", 2,
2, 0f, "KdGroup"));
- seq.addSequenceFeature(new SequenceFeature("kd", "hydrophobicity", 4,
+ seq.addSequenceFeature(new SequenceFeature(kdFeature, "hydrophobicity", 4,
4, 5f, "KdGroup"));
- seq.addSequenceFeature(new SequenceFeature("kd", "hydrophobicity", 7,
+ seq.addSequenceFeature(new SequenceFeature(metalFeature, "Fe", 4, 4,
+ 5f, "MetalGroup"));
+ seq.addSequenceFeature(new SequenceFeature(kdFeature, "hydrophobicity", 7,
7, 10f, "KdGroup"));
/*
- * graduated colour from 0 to 10
+ * kd feature has graduated colour from 0 to 10
* above threshold value of 5
*/
Color min = new Color(100, 50, 150);
FeatureColourI fc = new FeatureColour(min, max, 0, 10);
fc.setAboveThreshold(true);
fc.setThreshold(5f);
- fr.setColour("kd", fc);
+ fr.setColour(kdFeature, fc);
+ FeatureColour green = new FeatureColour(Color.green);
+ fr.setColour(metalFeature, green);
fr.featuresAdded();
+
+ /*
+ * render order is kd above Metal
+ */
+ Object[][] data = new Object[2][];
+ data[0] = new Object[] { kdFeature, fc, true };
+ data[1] = new Object[] { metalFeature, green, true };
+ fr.setFeaturePriority(data);
+
av.setShowSequenceFeatures(true);
/*
assertEquals(c, Color.blue);
/*
- * position 4, column 3, score 5 - at threshold - default colour
+ * position 4, column 3, score 5 - at threshold
+ * should return Green (colour of Metal feature)
*/
c = finder.findFeatureColour(Color.blue, seq, 3);
- assertEquals(c, Color.blue);
+ assertEquals(c, Color.green);
/*
* position 7, column 9, score 10 - maximum colour in range
assertEquals(c, min);
/*
- * position 4, column 3, score 5 - at threshold - default colour
+ * position 4, column 3, score 5 - at threshold
+ * should return Green (colour of Metal feature)
*/
c = finder.findFeatureColour(Color.blue, seq, 3);
- assertEquals(c, Color.blue);
+ assertEquals(c, Color.green);
/*
* position 7, column 9, score 10 - above threshold - default colour
--- /dev/null
+package jalview.renderer.seqfeatures;
+
+import static org.testng.Assert.assertEquals;
+import static org.testng.Assert.assertFalse;
+import static org.testng.Assert.assertTrue;
+
+import jalview.api.AlignViewportI;
+import jalview.api.FeatureColourI;
+import jalview.datamodel.SequenceFeature;
+import jalview.datamodel.SequenceI;
+import jalview.gui.AlignFrame;
+import jalview.io.DataSourceType;
+import jalview.io.FileLoader;
+import jalview.schemes.FeatureColour;
+
+import java.awt.Color;
+import java.util.ArrayList;
+import java.util.Arrays;
+import java.util.List;
+import java.util.Map;
+
+import org.testng.annotations.Test;
+
+public class FeatureRendererTest
+{
+
+ @Test(groups = "Functional")
+ public void testFindAllFeatures()
+ {
+ String seqData = ">s1\nabcdef\n>s2\nabcdef\n>s3\nabcdef\n>s4\nabcdef\n";
+ AlignFrame af = new FileLoader().LoadFileWaitTillLoaded(seqData,
+ DataSourceType.PASTE);
+ AlignViewportI av = af.getViewport();
+ FeatureRenderer fr = new FeatureRenderer(av);
+
+ /*
+ * with no features
+ */
+ fr.findAllFeatures(true);
+ assertTrue(fr.getRenderOrder().isEmpty());
+ assertTrue(fr.getFeatureGroups().isEmpty());
+
+ List<SequenceI> seqs = av.getAlignment().getSequences();
+
+ // add a non-positional feature - should be ignored by FeatureRenderer
+ SequenceFeature sf1 = new SequenceFeature("Type", "Desc", 0, 0, 1f,
+ "Group");
+ seqs.get(0).addSequenceFeature(sf1);
+ fr.findAllFeatures(true);
+ // ? bug - types and groups added for non-positional features
+ List<String> types = fr.getRenderOrder();
+ List<String> groups = fr.getFeatureGroups();
+ assertEquals(types.size(), 0);
+ assertFalse(types.contains("Type"));
+ assertEquals(groups.size(), 0);
+ assertFalse(groups.contains("Group"));
+
+ // add some positional features
+ seqs.get(1).addSequenceFeature(
+ new SequenceFeature("Pfam", "Desc", 5, 9, 1f, "PfamGroup"));
+ seqs.get(2).addSequenceFeature(
+ new SequenceFeature("Pfam", "Desc", 14, 22, 2f, "RfamGroup"));
+ // bug in findAllFeatures - group not checked for a known feature type
+ seqs.get(2).addSequenceFeature(
+ new SequenceFeature("Rfam", "Desc", 5, 9, Float.NaN,
+ "RfamGroup"));
+ // existing feature type with null group
+ seqs.get(3).addSequenceFeature(
+ new SequenceFeature("Rfam", "Desc", 5, 9, Float.NaN, null));
+ // new feature type with null group
+ seqs.get(3).addSequenceFeature(
+ new SequenceFeature("Scop", "Desc", 5, 9, Float.NaN, null));
+ // null value for type produces NullPointerException
+ fr.findAllFeatures(true);
+ types = fr.getRenderOrder();
+ groups = fr.getFeatureGroups();
+ assertEquals(types.size(), 3);
+ assertFalse(types.contains("Type"));
+ assertTrue(types.contains("Pfam"));
+ assertTrue(types.contains("Rfam"));
+ assertTrue(types.contains("Scop"));
+ assertEquals(groups.size(), 2);
+ assertFalse(groups.contains("Group"));
+ assertTrue(groups.contains("PfamGroup"));
+ assertTrue(groups.contains("RfamGroup"));
+ assertFalse(groups.contains(null)); // null group is ignored
+
+ /*
+ * check min-max values
+ */
+ Map<String, float[][]> minMax = fr.getMinMax();
+ assertEquals(minMax.size(), 1); // non-positional and NaN not stored
+ assertEquals(minMax.get("Pfam")[0][0], 1f); // positional min
+ assertEquals(minMax.get("Pfam")[0][1], 2f); // positional max
+
+ // increase max for Pfam, add scores for Rfam
+ seqs.get(0).addSequenceFeature(
+ new SequenceFeature("Pfam", "Desc", 14, 22, 8f, "RfamGroup"));
+ seqs.get(1).addSequenceFeature(
+ new SequenceFeature("Rfam", "Desc", 5, 9, 6f, "RfamGroup"));
+ fr.findAllFeatures(true);
+ // note minMax is not a defensive copy, shouldn't expose this
+ assertEquals(minMax.size(), 2);
+ assertEquals(minMax.get("Pfam")[0][0], 1f);
+ assertEquals(minMax.get("Pfam")[0][1], 8f);
+ assertEquals(minMax.get("Rfam")[0][0], 6f);
+ assertEquals(minMax.get("Rfam")[0][1], 6f);
+
+ /*
+ * check render order (last is on top)
+ */
+ List<String> renderOrder = fr.getRenderOrder();
+ assertEquals(renderOrder, Arrays.asList("Scop", "Rfam", "Pfam"));
+
+ /*
+ * change render order (todo: an easier way)
+ * nb here last comes first in the data array
+ */
+ Object[][] data = new Object[3][];
+ FeatureColourI colour = new FeatureColour(Color.RED);
+ data[0] = new Object[] { "Rfam", colour, true };
+ data[1] = new Object[] { "Pfam", colour, false };
+ data[2] = new Object[] { "Scop", colour, false };
+ fr.setFeaturePriority(data);
+ assertEquals(fr.getRenderOrder(), Arrays.asList("Scop", "Pfam", "Rfam"));
+ assertEquals(fr.getDisplayedFeatureTypes(), Arrays.asList("Rfam"));
+
+ /*
+ * add a new feature type: should go on top of render order as visible,
+ * other feature ordering and visibility should be unchanged
+ */
+ seqs.get(2).addSequenceFeature(
+ new SequenceFeature("Metal", "Desc", 14, 22, 8f, "MetalGroup"));
+ fr.findAllFeatures(true);
+ assertEquals(fr.getRenderOrder(),
+ Arrays.asList("Scop", "Pfam", "Rfam", "Metal"));
+ assertEquals(fr.getDisplayedFeatureTypes(),
+ Arrays.asList("Rfam", "Metal"));
+ }
+
+ @Test(groups = "Functional")
+ public void testFindFeaturesAtColumn()
+ {
+ String seqData = ">s1/4-29\n-ab--cdefghijklmnopqrstuvwxyz\n";
+ AlignFrame af = new FileLoader().LoadFileWaitTillLoaded(seqData,
+ DataSourceType.PASTE);
+ AlignViewportI av = af.getViewport();
+ FeatureRenderer fr = new FeatureRenderer(av);
+ SequenceI seq = av.getAlignment().getSequenceAt(0);
+
+ /*
+ * with no features
+ */
+ List<SequenceFeature> features = fr.findFeaturesAtColumn(seq, 3);
+ assertTrue(features.isEmpty());
+
+ /*
+ * add features
+ */
+ SequenceFeature sf1 = new SequenceFeature("Type1", "Desc", 0, 0, 1f,
+ "Group"); // non-positional
+ seq.addSequenceFeature(sf1);
+ SequenceFeature sf2 = new SequenceFeature("Type2", "Desc", 8, 18, 1f,
+ "Group1");
+ seq.addSequenceFeature(sf2);
+ SequenceFeature sf3 = new SequenceFeature("Type3", "Desc", 8, 18, 1f,
+ "Group2");
+ seq.addSequenceFeature(sf3);
+ SequenceFeature sf4 = new SequenceFeature("Type3", "Desc", 8, 18, 1f,
+ null); // null group is always treated as visible
+ seq.addSequenceFeature(sf4);
+
+ /*
+ * add contact features
+ */
+ SequenceFeature sf5 = new SequenceFeature("Disulphide Bond", "Desc", 7,
+ 15, 1f, "Group1");
+ seq.addSequenceFeature(sf5);
+ SequenceFeature sf6 = new SequenceFeature("Disulphide Bond", "Desc", 7,
+ 15, 1f, "Group2");
+ seq.addSequenceFeature(sf6);
+ SequenceFeature sf7 = new SequenceFeature("Disulphide Bond", "Desc", 7,
+ 15, 1f, null);
+ seq.addSequenceFeature(sf7);
+
+ // feature spanning B--C
+ SequenceFeature sf8 = new SequenceFeature("Type1", "Desc", 5, 6, 1f,
+ "Group");
+ seq.addSequenceFeature(sf8);
+ // contact feature B/C
+ SequenceFeature sf9 = new SequenceFeature("Disulphide Bond", "Desc", 5,
+ 6, 1f, "Group");
+ seq.addSequenceFeature(sf9);
+
+ /*
+ * let feature renderer discover features (and make visible)
+ */
+ fr.findAllFeatures(true);
+ features = fr.findFeaturesAtColumn(seq, 15); // all positional
+ assertEquals(features.size(), 6);
+ assertTrue(features.contains(sf2));
+ assertTrue(features.contains(sf3));
+ assertTrue(features.contains(sf4));
+ assertTrue(features.contains(sf5));
+ assertTrue(features.contains(sf6));
+ assertTrue(features.contains(sf7));
+
+ /*
+ * at a non-contact position
+ */
+ features = fr.findFeaturesAtColumn(seq, 14);
+ assertEquals(features.size(), 3);
+ assertTrue(features.contains(sf2));
+ assertTrue(features.contains(sf3));
+ assertTrue(features.contains(sf4));
+
+ /*
+ * make "Type2" not displayed
+ */
+ Object[][] data = new Object[4][];
+ FeatureColourI colour = new FeatureColour(Color.RED);
+ data[0] = new Object[] { "Type1", colour, true };
+ data[1] = new Object[] { "Type2", colour, false };
+ data[2] = new Object[] { "Type3", colour, true };
+ data[3] = new Object[] { "Disulphide Bond", colour, true };
+ fr.setFeaturePriority(data);
+
+ features = fr.findFeaturesAtColumn(seq, 15);
+ assertEquals(features.size(), 5); // no sf2
+ assertTrue(features.contains(sf3));
+ assertTrue(features.contains(sf4));
+ assertTrue(features.contains(sf5));
+ assertTrue(features.contains(sf6));
+ assertTrue(features.contains(sf7));
+
+ /*
+ * make "Group2" not displayed
+ */
+ fr.setGroupVisibility("Group2", false);
+
+ features = fr.findFeaturesAtColumn(seq, 15);
+ assertEquals(features.size(), 3); // no sf2, sf3, sf6
+ assertTrue(features.contains(sf4));
+ assertTrue(features.contains(sf5));
+ assertTrue(features.contains(sf7));
+
+ // features 'at' a gap between b and c
+ // - returns enclosing feature BC but not contact feature B/C
+ features = fr.findFeaturesAtColumn(seq, 4);
+ assertEquals(features.size(), 1);
+ assertTrue(features.contains(sf8));
+ features = fr.findFeaturesAtColumn(seq, 5);
+ assertEquals(features.size(), 1);
+ assertTrue(features.contains(sf8));
+ }
+
+ @Test(groups = "Functional")
+ public void testFilterFeaturesForDisplay()
+ {
+ String seqData = ">s1\nabcdef\n";
+ AlignFrame af = new FileLoader().LoadFileWaitTillLoaded(seqData,
+ DataSourceType.PASTE);
+ AlignViewportI av = af.getViewport();
+ FeatureRenderer fr = new FeatureRenderer(av);
+
+ List<SequenceFeature> features = new ArrayList<>();
+ fr.filterFeaturesForDisplay(features, null); // empty list, does nothing
+
+ SequenceI seq = av.getAlignment().getSequenceAt(0);
+ SequenceFeature sf1 = new SequenceFeature("Cath", "", 6, 8, Float.NaN,
+ "group1");
+ seq.addSequenceFeature(sf1);
+ SequenceFeature sf2 = new SequenceFeature("Cath", "", 5, 11, 2f,
+ "group2");
+ seq.addSequenceFeature(sf2);
+ SequenceFeature sf3 = new SequenceFeature("Cath", "", 5, 11, 3f,
+ "group3");
+ seq.addSequenceFeature(sf3);
+ SequenceFeature sf4 = new SequenceFeature("Cath", "", 6, 8, 4f,
+ "group4");
+ seq.addSequenceFeature(sf4);
+ SequenceFeature sf5 = new SequenceFeature("Cath", "", 6, 9, 5f,
+ "group4");
+ seq.addSequenceFeature(sf5);
+
+ fr.findAllFeatures(true);
+
+ features = seq.getSequenceFeatures();
+ assertEquals(features.size(), 5);
+ assertTrue(features.contains(sf1));
+ assertTrue(features.contains(sf2));
+ assertTrue(features.contains(sf3));
+ assertTrue(features.contains(sf4));
+ assertTrue(features.contains(sf5));
+
+ /*
+ * filter out duplicate (co-located) features
+ * note: which gets removed is not guaranteed
+ */
+ fr.filterFeaturesForDisplay(features, new FeatureColour(Color.blue));
+ assertEquals(features.size(), 3);
+ assertTrue(features.contains(sf1) || features.contains(sf4));
+ assertFalse(features.contains(sf1) && features.contains(sf4));
+ assertTrue(features.contains(sf2) || features.contains(sf3));
+ assertFalse(features.contains(sf2) && features.contains(sf3));
+ assertTrue(features.contains(sf5));
+
+ /*
+ * hide group 3 - sf3 is removed, sf2 is retained
+ */
+ fr.setGroupVisibility("group3", false);
+ features = seq.getSequenceFeatures();
+ fr.filterFeaturesForDisplay(features, new FeatureColour(Color.blue));
+ assertEquals(features.size(), 3);
+ assertTrue(features.contains(sf1) || features.contains(sf4));
+ assertFalse(features.contains(sf1) && features.contains(sf4));
+ assertTrue(features.contains(sf2));
+ assertFalse(features.contains(sf3));
+ assertTrue(features.contains(sf5));
+
+ /*
+ * hide group 2, show group 3 - sf2 is removed, sf3 is retained
+ */
+ fr.setGroupVisibility("group2", false);
+ fr.setGroupVisibility("group3", true);
+ features = seq.getSequenceFeatures();
+ fr.filterFeaturesForDisplay(features, null);
+ assertEquals(features.size(), 3);
+ assertTrue(features.contains(sf1) || features.contains(sf4));
+ assertFalse(features.contains(sf1) && features.contains(sf4));
+ assertFalse(features.contains(sf2));
+ assertTrue(features.contains(sf3));
+ assertTrue(features.contains(sf5));
+
+ /*
+ * no filtering of co-located features with graduated colour scheme
+ * filterFeaturesForDisplay does _not_ check colour threshold
+ * sf2 is removed as its group is hidden
+ */
+ features = seq.getSequenceFeatures();
+ fr.filterFeaturesForDisplay(features, new FeatureColour(Color.black,
+ Color.white, 0f, 1f));
+ assertEquals(features.size(), 4);
+ assertTrue(features.contains(sf1));
+ assertTrue(features.contains(sf3));
+ assertTrue(features.contains(sf4));
+ assertTrue(features.contains(sf5));
+
+ /*
+ * co-located features with colour by label
+ * should not get filtered
+ */
+ features = seq.getSequenceFeatures();
+ FeatureColour fc = new FeatureColour(Color.black);
+ fc.setColourByLabel(true);
+ fr.filterFeaturesForDisplay(features, fc);
+ assertEquals(features.size(), 4);
+ assertTrue(features.contains(sf1));
+ assertTrue(features.contains(sf3));
+ assertTrue(features.contains(sf4));
+ assertTrue(features.contains(sf5));
+ }
+}
anns[col] = new Annotation("a", "a", 'a', col, colour);
}
- seq = new Sequence("", "");
+ seq = new Sequence("Seq", "");
al = new Alignment(new SequenceI[]{ seq});
/*
import static org.testng.AssertJUnit.assertEquals;
import static org.testng.AssertJUnit.assertFalse;
+import static org.testng.AssertJUnit.assertNull;
import static org.testng.AssertJUnit.assertTrue;
import static org.testng.AssertJUnit.fail;
}
@Test(groups = { "Functional" })
- public void testIsColored_simpleColour()
- {
- FeatureColour fc = new FeatureColour(Color.RED);
- assertTrue(fc.isColored(new SequenceFeature()));
- }
-
- @Test(groups = { "Functional" })
- public void testIsColored_colourByLabel()
- {
- FeatureColour fc = new FeatureColour();
- fc.setColourByLabel(true);
- assertTrue(fc.isColored(new SequenceFeature()));
- }
-
- @Test(groups = { "Functional" })
- public void testIsColored_aboveThreshold()
- {
- // graduated colour range from score 20 to 100
- FeatureColour fc = new FeatureColour(Color.WHITE, Color.BLACK, 20f,
- 100f);
-
- // score 0 is adjusted to bottom of range
- SequenceFeature sf = new SequenceFeature("type", "desc", 0, 20, 0f,
- null);
- assertTrue(fc.isColored(sf));
- assertEquals(Color.WHITE, fc.getColor(sf));
-
- // score 120 is adjusted to top of range
- sf.setScore(120f);
- assertEquals(Color.BLACK, fc.getColor(sf));
-
- // value below threshold is still rendered
- // setting threshold has no effect yet...
- fc.setThreshold(60f);
- sf.setScore(36f);
- assertTrue(fc.isColored(sf));
- assertEquals(new Color(204, 204, 204), fc.getColor(sf));
-
- // now apply threshold:
- fc.setAboveThreshold(true);
- assertFalse(fc.isColored(sf));
- // colour is still returned though ?!?
- assertEquals(new Color(204, 204, 204), fc.getColor(sf));
-
- sf.setScore(84); // above threshold now
- assertTrue(fc.isColored(sf));
- assertEquals(new Color(51, 51, 51), fc.getColor(sf));
- }
-
- @Test(groups = { "Functional" })
public void testGetColor_simpleColour()
{
FeatureColour fc = new FeatureColour(Color.RED);
- assertEquals(Color.RED, fc.getColor(new SequenceFeature()));
+ assertEquals(Color.RED,
+ fc.getColor(new SequenceFeature("Cath", "", 1, 2, 0f, null)));
}
@Test(groups = { "Functional" })
}
@Test(groups = { "Functional" })
- public void testGetColor_belowThreshold()
+ public void testGetColor_aboveBelowThreshold()
{
// gradient from [50, 150] from WHITE(255, 255, 255) to BLACK(0, 0, 0)
FeatureColour fc = new FeatureColour(Color.WHITE, Color.BLACK, 50f,
150f);
SequenceFeature sf = new SequenceFeature("type", "desc", 0, 20, 70f,
null);
+
+ /*
+ * feature with score of Float.NaN is always assigned minimum colour
+ */
+ SequenceFeature sf2 = new SequenceFeature("type", "desc", 0, 20,
+ Float.NaN, null);
+
fc.setThreshold(100f); // ignore for now
- assertTrue(fc.isColored(sf));
assertEquals(new Color(204, 204, 204), fc.getColor(sf));
+ assertEquals(Color.white, fc.getColor(sf2));
fc.setAboveThreshold(true); // feature lies below threshold
- assertFalse(fc.isColored(sf));
- assertEquals(new Color(204, 204, 204), fc.getColor(sf));
+ assertNull(fc.getColor(sf));
+ assertEquals(Color.white, fc.getColor(sf2));
+
+ fc.setBelowThreshold(true);
+ fc.setThreshold(70f);
+ assertNull(fc.getColor(sf)); // feature score == threshold - hidden
+ assertEquals(Color.white, fc.getColor(sf2));
+ fc.setThreshold(69f);
+ assertNull(fc.getColor(sf)); // feature score > threshold - hidden
+ assertEquals(Color.white, fc.getColor(sf2));
}
/**
/*
* Verify a RESNUM sequence feature in the PDBfile sequence
*/
- SequenceFeature sf = pmap.getSeqs().get(0).getSequenceFeatures()[0];
+ SequenceFeature sf = pmap.getSeqs().get(0).getSequenceFeatures().get(0);
assertEquals("RESNUM", sf.getType());
assertEquals("1gaq", sf.getFeatureGroup());
assertEquals("GLU: 19 1gaqA", sf.getDescription());
* sequence
*/
StructureMapping map = sm.getMapping("examples/1gaq.txt")[0];
- sf = map.sequence.getSequenceFeatures()[0];
+ sf = map.sequence.getSequenceFeatures().get(0);
assertEquals("RESNUM", sf.getType());
assertEquals("1gaq", sf.getFeatureGroup());
assertEquals("ALA: 1 1gaqB", sf.getDescription());
StructureSelectionManager ssm = new StructureSelectionManager();
ssm.setMapping(new SequenceI[] { seq1a, seq1b }, null, PDB_1,
- DataSourceType.PASTE);
+ DataSourceType.PASTE, null);
ssm.setMapping(new SequenceI[] { seq2 }, null, PDB_2,
- DataSourceType.PASTE);
+ DataSourceType.PASTE, null);
ssm.setMapping(new SequenceI[] { seq3 }, null, PDB_3,
- DataSourceType.PASTE);
+ DataSourceType.PASTE, null);
testee = new AAStructureBindingModel(ssm, pdbFiles, seqs, null)
{
assertEquals("[12, 11, 8, 4]", Arrays.toString(ranges));
}
+ @Test(groups = "Functional")
+ public void testRemoveEndPositions()
+ {
+ List<int[]> ranges = new ArrayList<>();
+
+ /*
+ * case 1: truncate last range
+ */
+ ranges.add(new int[] { 1, 10 });
+ ranges.add(new int[] { 20, 30 });
+ MappingUtils.removeEndPositions(5, ranges);
+ assertEquals(2, ranges.size());
+ assertEquals(25, ranges.get(1)[1]);
+
+ /*
+ * case 2: remove last range
+ */
+ ranges.clear();
+ ranges.add(new int[] { 1, 10 });
+ ranges.add(new int[] { 20, 22 });
+ MappingUtils.removeEndPositions(3, ranges);
+ assertEquals(1, ranges.size());
+ assertEquals(10, ranges.get(0)[1]);
+
+ /*
+ * case 3: truncate penultimate range
+ */
+ ranges.clear();
+ ranges.add(new int[] { 1, 10 });
+ ranges.add(new int[] { 20, 21 });
+ MappingUtils.removeEndPositions(3, ranges);
+ assertEquals(1, ranges.size());
+ assertEquals(9, ranges.get(0)[1]);
+
+ /*
+ * case 4: remove last two ranges
+ */
+ ranges.clear();
+ ranges.add(new int[] { 1, 10 });
+ ranges.add(new int[] { 20, 20 });
+ ranges.add(new int[] { 30, 30 });
+ MappingUtils.removeEndPositions(3, ranges);
+ assertEquals(1, ranges.size());
+ assertEquals(9, ranges.get(0)[1]);
+ }
}
package jalview.viewmodel;
import static org.testng.Assert.assertEquals;
+import static org.testng.Assert.assertFalse;
import static org.testng.Assert.assertTrue;
import jalview.analysis.AlignmentGenerator;
import java.beans.PropertyChangeEvent;
import java.util.ArrayList;
import java.util.Arrays;
+import java.util.Collections;
import java.util.List;
import org.testng.annotations.BeforeClass;
vr.setEndSeq(al.getHeight());
assertEquals(vr.getEndSeq(), al.getHeight() - 1);
- // vr.setEndRes(al.getHeight() - 1);
vr.setEndSeq(al.getHeight() - 1);
assertEquals(vr.getEndSeq(), al.getHeight() - 1);
}
}
@Test(groups = { "Functional" })
+ public void testSetStartResAndSeq()
+ {
+ ViewportRanges vr = new ViewportRanges(al);
+ vr.setViewportHeight(10);
+ vr.setStartResAndSeq(3, 6);
+ assertEquals(vr.getStartRes(), 3);
+ assertEquals(vr.getStartSeq(), 6);
+ assertEquals(vr.getEndRes(), 3 + vr.getViewportWidth() - 1);
+ assertEquals(vr.getEndSeq(), 6 + vr.getViewportHeight() - 1);
+
+ vr.setStartResAndSeq(10, 25);
+ assertEquals(vr.getStartRes(), 10);
+ assertEquals(vr.getStartSeq(), 19);
+ assertEquals(vr.getEndRes(), 10 + vr.getViewportWidth() - 1);
+ assertEquals(vr.getEndSeq(), 19 + vr.getViewportHeight() - 1);
+ }
+
+ @Test(groups = { "Functional" })
public void testSetViewportHeight()
{
ViewportRanges vr = new ViewportRanges(al);
@Test(groups = { "Functional" })
public void testScrollToWrappedVisible()
{
- ViewportRanges vr = new ViewportRanges(al);
+ AlignmentI al2 = gen.generate(60, 30, 1, 5, 5);
+
+ ViewportRanges vr = new ViewportRanges(al2);
+
+ // start with viewport on 5-14
vr.setViewportStartAndWidth(5, 10);
+ assertEquals(vr.getStartRes(), 5);
+ assertEquals(vr.getEndRes(), 14);
+
+ // scroll to 12 - no change
+ assertFalse(vr.scrollToWrappedVisible(12));
+ assertEquals(vr.getStartRes(), 5);
- vr.scrollToWrappedVisible(0);
+ // scroll to 2 - back to 0-9
+ assertTrue(vr.scrollToWrappedVisible(2));
assertEquals(vr.getStartRes(), 0);
+ assertEquals(vr.getEndRes(), 9);
- vr.scrollToWrappedVisible(10);
- assertEquals(vr.getStartRes(), 10);
+ // scroll to 9 - no change
+ assertFalse(vr.scrollToWrappedVisible(9));
+ assertEquals(vr.getStartRes(), 0);
- vr.scrollToWrappedVisible(15);
+ // scroll to 12 - moves to 10-19
+ assertTrue(vr.scrollToWrappedVisible(12));
assertEquals(vr.getStartRes(), 10);
+ assertEquals(vr.getEndRes(), 19);
+
+ vr.setStartRes(13);
+ assertEquals(vr.getStartRes(), 13);
+ assertEquals(vr.getEndRes(), 22);
+
+ // scroll to 45 - jumps to 43-52
+ assertTrue(vr.scrollToWrappedVisible(45));
+ assertEquals(vr.getStartRes(), 43);
+ assertEquals(vr.getEndRes(), 52);
}
- // leave until JAL-2388 is merged and we can do without viewport
- /*@Test(groups = { "Functional" })
+ @Test(groups = { "Functional" })
public void testScrollToVisible()
{
ViewportRanges vr = new ViewportRanges(al);
vr.setViewportStartAndWidth(12,5);
vr.setViewportStartAndHeight(10,6);
- vr.scrollToVisible(13,14)
+ vr.scrollToVisible(13, 14);
// no change
assertEquals(vr.getStartRes(), 12);
assertEquals(vr.getStartSeq(), 6);
// test for hidden columns too
- }*/
+ al.getHiddenColumns().hideColumns(1, 3);
+ vr.scrollToVisible(13, 3);
+ assertEquals(vr.getStartRes(), 6);
+ assertEquals(vr.getStartSeq(), 3);
+
+ vr.scrollToVisible(2, 9);
+ assertEquals(vr.getStartRes(), 0);
+ assertEquals(vr.getStartSeq(), 4);
+ }
@Test(groups = { "Functional" })
public void testEventFiring()
// one event fired when startRes is called with new value
vr.setStartRes(4);
- assertTrue(l.verify(1, Arrays.asList("startres")));
+ assertTrue(l.verify(1, Arrays.asList(ViewportRanges.STARTRES)));
l.reset();
// no event fired for same value
l.reset();
vr.setStartSeq(4);
- assertTrue(l.verify(1, Arrays.asList("startseq")));
+ assertTrue(l.verify(1, Arrays.asList(ViewportRanges.STARTSEQ)));
l.reset();
vr.setStartSeq(4);
l.reset();
vr.setEndSeq(10);
- assertTrue(l.verify(1, Arrays.asList("startseq")));
+ assertTrue(l.verify(1, Arrays.asList(ViewportRanges.STARTSEQ)));
l.reset();
vr.setEndSeq(10);
l.reset();
vr.setStartEndRes(2, 15);
- assertTrue(l.verify(1, Arrays.asList("startres")));
+ assertTrue(l.verify(1, Arrays.asList(ViewportRanges.STARTRES)));
l.reset();
vr.setStartEndRes(2, 15);
// check new value fired by event is corrected startres
vr.setStartEndRes(-1, 5);
- assertTrue(l.verify(1, Arrays.asList("startres"), Arrays.asList(0)));
+ assertTrue(l.verify(1, Arrays.asList(ViewportRanges.STARTRES),
+ Arrays.asList(0)));
l.reset();
// check new value fired by event is corrected endres
vr.setStartEndRes(0, -1);
- assertTrue(l.verify(1, Arrays.asList("endres"), Arrays.asList(0)));
+ assertTrue(l.verify(1, Arrays.asList(ViewportRanges.ENDRES),
+ Arrays.asList(0)));
l.reset();
vr.setStartEndSeq(2, 15);
- assertTrue(l.verify(1, Arrays.asList("startseq")));
+ assertTrue(l.verify(1, Arrays.asList(ViewportRanges.STARTSEQ)));
l.reset();
vr.setStartEndSeq(2, 15);
// check new value fired by event is corrected startseq
vr.setStartEndSeq(-1, 5);
- assertTrue(l.verify(1, Arrays.asList("startseq"), Arrays.asList(0)));
+ assertTrue(l.verify(1, Arrays.asList(ViewportRanges.STARTSEQ),
+ Arrays.asList(0)));
l.reset();
// check new value fired by event is corrected endseq
vr.setStartEndSeq(0, -1);
- assertTrue(l.verify(1, Arrays.asList("endseq"), Arrays.asList(0)));
+ assertTrue(l.verify(1, Arrays.asList(ViewportRanges.ENDSEQ),
+ Arrays.asList(0)));
l.reset();
// reset for later tests
// test viewport height and width setting triggers event
vr.setViewportHeight(10);
- assertTrue(l.verify(1, Arrays.asList("endseq")));
+ assertTrue(l.verify(1, Arrays.asList(ViewportRanges.ENDSEQ)));
l.reset();
vr.setViewportWidth(18);
- assertTrue(l.verify(1, Arrays.asList("endres")));
+ assertTrue(l.verify(1, Arrays.asList(ViewportRanges.ENDRES)));
l.reset();
// already has seq start set to 2, so triggers endseq
vr.setViewportStartAndHeight(2, 16);
- assertTrue(l.verify(1, Arrays.asList("endseq")));
+ assertTrue(l.verify(1, Arrays.asList(ViewportRanges.ENDSEQ)));
l.reset();
vr.setViewportStartAndWidth(1, 14);
- assertTrue(l.verify(1, Arrays.asList("startres")));
+ assertTrue(l.verify(1, Arrays.asList(ViewportRanges.STARTRES)));
l.reset();
// test page up/down triggers event
vr.pageUp();
- assertTrue(l.verify(1, Arrays.asList("startseq")));
+ assertTrue(l.verify(1, Arrays.asList(ViewportRanges.STARTSEQ)));
l.reset();
vr.pageDown();
- assertTrue(l.verify(1, Arrays.asList("startseq")));
+ assertTrue(l.verify(1, Arrays.asList(ViewportRanges.STARTSEQ)));
l.reset();
// test scrolling triggers event
vr.scrollUp(true);
- assertTrue(l.verify(1, Arrays.asList("startseq")));
+ assertTrue(l.verify(1, Arrays.asList(ViewportRanges.STARTSEQ)));
l.reset();
vr.scrollUp(false);
- assertTrue(l.verify(1, Arrays.asList("startseq")));
+ assertTrue(l.verify(1, Arrays.asList(ViewportRanges.STARTSEQ)));
l.reset();
vr.scrollRight(true);
- assertTrue(l.verify(1, Arrays.asList("startres")));
+ assertTrue(l.verify(1, Arrays.asList(ViewportRanges.STARTRES)));
l.reset();
vr.scrollRight(false);
- assertTrue(l.verify(1, Arrays.asList("startres")));
+ assertTrue(l.verify(1, Arrays.asList(ViewportRanges.STARTRES)));
l.reset();
vr.scrollToVisible(10, 10);
assertTrue(l.verify(4,
- Arrays.asList("startseq", "startseq", "startseq", "startseq")));
+ Arrays.asList(ViewportRanges.STARTSEQ, ViewportRanges.STARTSEQ,
+ ViewportRanges.STARTSEQ, ViewportRanges.STARTSEQ)));
+ l.reset();
+
+ /*
+ * scrollToWrappedVisible does nothing if the target position is
+ * within the current startRes-endRes range
+ */
+ assertFalse(vr.scrollToWrappedVisible(5));
+ assertTrue(l.verify(0, Collections.<String> emptyList()));
l.reset();
- vr.scrollToWrappedVisible(5);
- assertTrue(l.verify(1, Arrays.asList("startres")));
+ vr.scrollToWrappedVisible(25);
+ assertTrue(l.verify(1, Arrays.asList(ViewportRanges.STARTRES)));
+ l.reset();
+
+ // test setStartResAndSeq triggers one event
+ vr.setStartResAndSeq(5, 7);
+ assertTrue(l.verify(1, Arrays.asList(ViewportRanges.STARTRESANDSEQ),
+ Arrays.asList(5, 7)));
+
l.reset();
}
}
}
}
+
+ @Test(groups = { "Functional" })
+ public void testScrollUp_wrapped()
+ {
+ /*
+ * alignment 30 tall and 45 wide
+ */
+ AlignmentI al2 = gen.generate(45, 30, 1, 0, 5);
+
+ /*
+ * wrapped view, 5 sequences high, start at sequence offset 1
+ */
+ ViewportRanges vr = new ViewportRanges(al2);
+ vr.setWrappedMode(true);
+ vr.setViewportStartAndHeight(1, 5);
+
+ /*
+ * offset wrapped view to column 3
+ */
+ vr.setStartEndRes(3, 22);
+
+ int startRes = vr.getStartRes();
+ int width = vr.getViewportWidth();
+ assertEquals(startRes, 3);
+ assertEquals(width, 20);
+
+ // in wrapped mode, we change startRes but not startSeq
+ // scroll down:
+ vr.scrollUp(false);
+ assertEquals(vr.getStartSeq(), 1);
+ assertEquals(vr.getStartRes(), 23);
+
+ // scroll up returns to original position
+ vr.scrollUp(true);
+ assertEquals(vr.getStartSeq(), 1);
+ assertEquals(vr.getStartRes(), 3);
+
+ // scroll up again returns to 'origin'
+ vr.scrollUp(true);
+ assertEquals(vr.getStartSeq(), 1);
+ assertEquals(vr.getStartRes(), 0);
+
+ /*
+ * offset 3 columns once more and do some scroll downs
+ */
+ vr.setStartEndRes(3, 22);
+ vr.scrollUp(false);
+ assertEquals(vr.getStartSeq(), 1);
+ assertEquals(vr.getStartRes(), 23);
+ vr.scrollUp(false);
+ assertEquals(vr.getStartSeq(), 1);
+ assertEquals(vr.getStartRes(), 43);
+
+ /*
+ * scroll down beyond end of alignment does nothing
+ */
+ vr.scrollUp(false);
+ assertEquals(vr.getStartSeq(), 1);
+ assertEquals(vr.getStartRes(), 43);
+ }
+
+ @Test(groups = { "Functional" })
+ public void testSetViewportLocation()
+ {
+ AlignmentI al2 = gen.generate(60, 80, 1, 0, 0);
+
+ ViewportRanges vr = new ViewportRanges(al2);
+
+ // start with viewport on 5-14
+ vr.setViewportStartAndWidth(5, 10);
+ assertEquals(vr.getStartRes(), 5);
+ assertEquals(vr.getEndRes(), 14);
+
+ vr.setViewportStartAndHeight(3, 13);
+ assertEquals(vr.getStartSeq(), 3);
+ assertEquals(vr.getEndSeq(), 15);
+
+ // set location to (8,5) - no change
+ vr.setViewportLocation(8, 5);
+ assertEquals(vr.getStartRes(), 5);
+ assertEquals(vr.getEndRes(), 14);
+ assertEquals(vr.getStartSeq(), 3);
+ assertEquals(vr.getEndSeq(), 15);
+
+ // set location to (40,50) - change to top left (40,50)
+ vr.setViewportLocation(40, 50);
+ assertEquals(vr.getStartRes(), 40);
+ assertEquals(vr.getEndRes(), 49);
+ assertEquals(vr.getStartSeq(), 50);
+ assertEquals(vr.getEndSeq(), 62);
+
+ // set location past end of alignment - resets to leftmost pos
+ vr.setViewportLocation(63, 85);
+ assertEquals(vr.getStartRes(), 50);
+ assertEquals(vr.getEndRes(), 59);
+ assertEquals(vr.getStartSeq(), 67);
+ assertEquals(vr.getEndSeq(), 79);
+
+ // hide some columns
+ al2.getHiddenColumns().hideColumns(20, 50);
+ vr.setViewportLocation(55, 4);
+ assertEquals(vr.getStartRes(), 19);
+ assertEquals(vr.getEndRes(), 28);
+ assertEquals(vr.getStartSeq(), 4);
+ assertEquals(vr.getEndSeq(), 16);
+
+ // hide some sequences
+ al2.getHiddenSequences().hideSequence(al2.getSequenceAt(3));
+ al2.getHiddenSequences().hideSequence(al2.getSequenceAt(4));
+ vr.setViewportLocation(17, 5);
+ assertEquals(vr.getStartRes(), 17);
+ assertEquals(vr.getEndRes(), 26);
+ assertEquals(vr.getStartSeq(), 3);
+ assertEquals(vr.getEndSeq(), 15);
+
+ // set wrapped mode
+ vr.setWrappedMode(true);
+ vr.setViewportLocation(1, 8);
+ assertEquals(vr.getStartRes(), 0);
+ assertEquals(vr.getEndRes(), 9);
+ assertEquals(vr.getStartSeq(), 3);
+ assertEquals(vr.getEndSeq(), 15);
+
+ // try further down the alignment
+ vr.setViewportLocation(57, 5);
+ assertEquals(vr.getStartRes(), 20);
+ assertEquals(vr.getEndRes(), 29);
+ assertEquals(vr.getStartSeq(), 3);
+ assertEquals(vr.getEndSeq(), 15);
+ }
}
// mock listener for property change events
{
firecount++;
events.add(evt.getPropertyName());
- newvalues.add((Integer) evt.getNewValue());
+ if (evt.getPropertyName().equals(ViewportRanges.STARTRESANDSEQ))
+ {
+ newvalues.add(((int[]) evt.getNewValue())[0]);
+ newvalues.add(((int[]) evt.getNewValue())[1]);
+ }
+ else
+ {
+ newvalues.add((Integer) evt.getNewValue());
+ }
}
public boolean verify(int count, List<String> eventslist,
import static org.testng.AssertJUnit.assertNull;
import jalview.datamodel.PDBEntry;
-import jalview.datamodel.SequenceFeature;
import jalview.datamodel.SequenceI;
-import jalview.datamodel.UniprotEntry;
+import jalview.datamodel.xdb.uniprot.UniprotEntry;
+import jalview.datamodel.xdb.uniprot.UniprotFeature;
import jalview.gui.JvOptionPane;
import java.io.Reader;
/*
* Check sequence features
*/
- Vector<SequenceFeature> features = entry.getFeature();
+ Vector<UniprotFeature> features = entry.getFeature();
assertEquals(3, features.size());
- SequenceFeature sf = features.get(0);
+ UniprotFeature sf = features.get(0);
assertEquals("signal peptide", sf.getType());
assertNull(sf.getDescription());
assertNull(sf.getStatus());
- assertEquals(1, sf.getPosition());
assertEquals(1, sf.getBegin());
assertEquals(18, sf.getEnd());
sf = features.get(1);
xref = xrefs.get(2);
assertEquals("AE007869", xref.getId());
assertEquals("EMBL", xref.getType());
- assertEquals("AAK85932.1",
- xref.getProperty("protein sequence ID"));
- assertEquals("Genomic_DNA",
- xref.getProperty("molecule type"));
+ assertEquals("AAK85932.1", xref.getProperty("protein sequence ID"));
+ assertEquals("Genomic_DNA", xref.getProperty("molecule type"));
}
@Test(groups = { "Functional" })
new StringReader(UNIPROT_XML)).get(0);
/*
- * name formatted as source | accession ids | names
- * source database converted to Jalview canonical name
+ * name formatted with Uniprot Entry name
*/
- String expectedName = "UNIPROT|A9CKP4|A9CKP5|A9CKP4_AGRT5|A9CKP4_AGRT6";
- assertEquals(expectedName, Uniprot.getUniprotEntryId(entry));
+ String expectedName = "A9CKP4_AGRT5|A9CKP4_AGRT6";
+ assertEquals(expectedName,
+ Uniprot.getUniprotEntryId(entry));
}
/**
package jalview.ws.seqfetcher;
import static org.testng.AssertJUnit.assertEquals;
+import static org.testng.AssertJUnit.assertFalse;
import static org.testng.AssertJUnit.assertNotNull;
import static org.testng.AssertJUnit.assertTrue;
SequenceI seq = alsq.getSequenceAt(0);
assertEquals("Wrong sequence name", embl.getDbSource() + "|"
+ retrievalId, seq.getName());
- SequenceFeature[] sfs = seq.getSequenceFeatures();
- assertNotNull("Sequence features missing", sfs);
+ List<SequenceFeature> sfs = seq.getSequenceFeatures();
+ assertFalse("Sequence features missing", sfs.isEmpty());
assertTrue(
"Feature not CDS",
FeatureProperties.isCodingFeature(embl.getDbSource(),
- sfs[0].getType()));
- assertEquals(embl.getDbSource(), sfs[0].getFeatureGroup());
+ sfs.get(0).getType()));
+ assertEquals(embl.getDbSource(), sfs.get(0).getFeatureGroup());
DBRefEntry[] dr = DBRefUtils.selectRefs(seq.getDBRefs(),
new String[] { DBRefSource.UNIPROT });
assertNotNull(dr);
<!--
Suppress check of externally sourced code
-->
- <suppress checks="[a-zA-Z0-9]*" files="com[\\/]*"/>
- <suppress checks="[a-zA-Z0-9]*" files="ext[\\/]*"/>
- <suppress checks="[a-zA-Z0-9]*" files="org[\\/]*"/>
- <suppress checks="[a-zA-Z0-9]*" files="uk[\\/]*"/>
+ <suppress checks="[a-zA-Z0-9]*" files="[\\/]com[\\/]github*"/>
+ <suppress checks="[a-zA-Z0-9]*" files="[\\/]com[\\/]stevesoft*"/>
+ <suppress checks="[a-zA-Z0-9]*" files="[\\/]ext[\\/]edu*"/>
+ <suppress checks="[a-zA-Z0-9]*" files="[\\/]ext[\\/]vamsas*"/>
+ <suppress checks="[a-zA-Z0-9]*" files="[\\/]org[\\/]jibble*"/>
+ <suppress checks="[a-zA-Z0-9]*" files="[\\/]uk[\\/]ac*"/>
<!--
ImportControl can only handle one top level package
<subpackage name="datamodel">
<disallow pkg="jalview.gui"/>
<allow pkg="fr.orsay.lri.varna"/>
- <subpackage name="xdb">
- <subpackage name="embl">
- <allow pkg="org.exolab.castor"/>
- </subpackage>
+ <subpackage name="xdb.embl">
+ <allow pkg="org.exolab.castor"/>
</subpackage>
</subpackage>
+ <subpackage name="ext">
+ <subpackage name="ensembl">
+ <allow pkg="javax.ws"/>
+ <allow pkg="org.json"/>
+ </subpackage>
+ <subpackage name="htsjdk">
+ <allow pkg="htsjdk"/>
+ </subpackage>
+ <subpackage name="jmol">
+ <allow pkg="MCview"/>
+ <allow pkg="org.jmol"/>
+ </subpackage>
+ <subpackage name="paradise">
+ <allow pkg="org.apache"/>
+ <allow pkg="org.json"/>
+ </subpackage>
+ <subpackage name="rbvi">
+ <allow pkg="ext.edu.ucsf"/>
+ <allow pkg="javax.servlet"/>
+ </subpackage>
+ <subpackage name="so">
+ <allow pkg="org.biojava"/>
+ </subpackage>
+ <subpackage name="varna">
+ <allow pkg="fr.orsay"/>
+ </subpackage>
+ </subpackage>
+
<subpackage name="fts">
<allow pkg="javax.swing"/>
<allow pkg="javax.ws"/>
<allow pkg="javax.servlet"/>
</subpackage>
+ <subpackage name="schemes">
+ <allow pkg="org.exolab.castor" class="jalview.schemes.ColourSchemeLoader"/>
+ </subpackage>
+
<subpackage name="structure">
<allow pkg="MCview"/>
</subpackage>
+
+ <subpackage name="urls">
+ <allow pkg="javax.swing" class="jalview.urls.UrlLinkTableModel"/>
+ <allow pkg="org.json"/>
+ </subpackage>
<subpackage name="util">
<allow pkg="javax.swing"/>
git://source.jalview.org / jalview.git / commitdiff
