done time execution for queries, query by counter of job, total in column in query...

[proteocache.git] / website / Sequence.jsp

diff --git a/website/Sequence.jsp b/website/Sequence.jsp
index 1cbcfed..9e28601 100644 (file)
--- a/website/Sequence.jsp
+++ b/website/Sequence.jsp
@@ -14,8 +14,10 @@
                <p><textarea rows="2" cols="100" name="prot">MPIDYSKWKDIEVSDDEDDTHPNIDTPSLFRWRHQARLERMAEKKMEQEKIDKEKGTTSKKMEELEKKLAAADVTDKSDIQKQIDEVKAQEEAWRKKEAELEEKERLEPWNVDTIGHEAFSTSRINKI</textarea></p>
                <input type="radio" name="protein" value="whole"  Checked>search by the whole sequence
                <input type="radio" name="protein" value="part">search by a part of sequence<br/>
-               <input type="submit" name="Search" value="Search"/><br/><br/>
-               <input type="checkbox" name="option" value="AllProtein">Sequence with more then 3 jobs<br>
+               <input type="submit" name="Search" value="Search sequence"/><br/><br/>
+               <h3>Enter minimum counter of job/protein</h3>
+               <input type="text" name="counterJob" value = 3><br/>
+               <input type="submit" name="Search" value="Search counter"/><br/><br/>
        </form>
 </body>
 </html>