forester/java/src/org/forester/test/Test.java

   1 // $Id:
   2 // FORESTER -- software libraries and applications
   3 // for evolutionary biology research and applications.
   4 //
   5 // Copyright (C) 2014 Christian M. Zmasek
   6 // Copyright (C) 2014 Sanford-Burnham Medical Research Institute
   7 // All rights reserved
   8 //
   9 // This library is free software; you can redistribute it and/or
  10 // modify it under the terms of the GNU Lesser General Public
  11 // License as published by the Free Software Foundation; either
  12 // version 2.1 of the License, or (at your option) any later version.
  13 //
  14 // This library is distributed in the hope that it will be useful,
  15 // but WITHOUT ANY WARRANTY; without even the implied warranty of
  16 // MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
  17 // Lesser General Public License for more details.
  18 //
  19 // You should have received a copy of the GNU Lesser General Public
  20 // License along with this library; if not, write to the Free Software
  21 // Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301, USA
  22 //
  23 // WWW: https://sites.google.com/site/cmzmasek/home/software/forester
  24
  25 package org.forester.test;
  26
  27 import java.io.ByteArrayInputStream;
  28 import java.io.File;
  29 import java.io.FileInputStream;
  30 import java.io.IOException;
  31 import java.io.StringWriter;
  32 import java.io.Writer;
  33 import java.net.URL;
  34 import java.util.ArrayList;
  35 import java.util.Date;
  36 import java.util.HashSet;
  37 import java.util.Iterator;
  38 import java.util.List;
  39 import java.util.Locale;
  40 import java.util.Set;
  41 import java.util.SortedSet;
  42
  43 import org.forester.application.support_transfer;
  44 import org.forester.archaeopteryx.AptxUtil;
  45 import org.forester.archaeopteryx.TreePanelUtil;
  46 import org.forester.archaeopteryx.webservices.WebserviceUtil;
  47 import org.forester.development.DevelopmentTools;
  48 import org.forester.evoinference.TestPhylogenyReconstruction;
  49 import org.forester.evoinference.matrix.character.CharacterStateMatrix;
  50 import org.forester.evoinference.matrix.character.CharacterStateMatrix.BinaryStates;
  51 import org.forester.go.TestGo;
  52 import org.forester.io.parsers.FastaParser;
  53 import org.forester.io.parsers.GeneralMsaParser;
  54 import org.forester.io.parsers.HmmscanPerDomainTableParser;
  55 import org.forester.io.parsers.HmmscanPerDomainTableParser.INDIVIDUAL_SCORE_CUTOFF;
  56 import org.forester.io.parsers.nexus.NexusBinaryStatesMatrixParser;
  57 import org.forester.io.parsers.nexus.NexusCharactersParser;
  58 import org.forester.io.parsers.nexus.NexusPhylogeniesParser;
  59 import org.forester.io.parsers.nhx.NHXParser;
  60 import org.forester.io.parsers.nhx.NHXParser.TAXONOMY_EXTRACTION;
  61 import org.forester.io.parsers.phyloxml.PhyloXmlParser;
  62 import org.forester.io.parsers.tol.TolParser;
  63 import org.forester.io.parsers.util.ParserUtils;
  64 import org.forester.io.writers.PhylogenyWriter;
  65 import org.forester.io.writers.SequenceWriter;
  66 import org.forester.msa.BasicMsa;
  67 import org.forester.msa.DeleteableMsa;
  68 import org.forester.msa.Mafft;
  69 import org.forester.msa.Msa;
  70 import org.forester.msa.Msa.MSA_FORMAT;
  71 import org.forester.msa.MsaInferrer;
  72 import org.forester.msa.MsaMethods;
  73 import org.forester.pccx.TestPccx;
  74 import org.forester.phylogeny.Phylogeny;
  75 import org.forester.phylogeny.PhylogenyBranch;
  76 import org.forester.phylogeny.PhylogenyMethods;
  77 import org.forester.phylogeny.PhylogenyNode;
  78 import org.forester.phylogeny.PhylogenyNode.NH_CONVERSION_SUPPORT_VALUE_STYLE;
  79 import org.forester.phylogeny.data.Accession;
  80 import org.forester.phylogeny.data.Accession.Source;
  81 import org.forester.phylogeny.data.BinaryCharacters;
  82 import org.forester.phylogeny.data.BranchWidth;
  83 import org.forester.phylogeny.data.Confidence;
  84 import org.forester.phylogeny.data.Distribution;
  85 import org.forester.phylogeny.data.DomainArchitecture;
  86 import org.forester.phylogeny.data.Event;
  87 import org.forester.phylogeny.data.Identifier;
  88 import org.forester.phylogeny.data.PhylogenyData;
  89 import org.forester.phylogeny.data.PhylogenyDataUtil;
  90 import org.forester.phylogeny.data.Polygon;
  91 import org.forester.phylogeny.data.PropertiesMap;
  92 import org.forester.phylogeny.data.Property;
  93 import org.forester.phylogeny.data.Property.AppliesTo;
  94 import org.forester.phylogeny.data.ProteinDomain;
  95 import org.forester.phylogeny.data.Taxonomy;
  96 import org.forester.phylogeny.factories.ParserBasedPhylogenyFactory;
  97 import org.forester.phylogeny.factories.PhylogenyFactory;
  98 import org.forester.phylogeny.iterators.PhylogenyNodeIterator;
  99 import org.forester.protein.BasicDomain;
 100 import org.forester.protein.BasicProtein;
 101 import org.forester.protein.Domain;
 102 import org.forester.protein.Protein;
 103 import org.forester.protein.ProteinId;
 104 import org.forester.rio.TestRIO;
 105 import org.forester.sdi.SDI;
 106 import org.forester.sdi.SDIR;
 107 import org.forester.sdi.TestGSDI;
 108 import org.forester.sequence.BasicSequence;
 109 import org.forester.sequence.MolecularSequence;
 110 import org.forester.species.BasicSpecies;
 111 import org.forester.species.Species;
 112 import org.forester.surfacing.TestSurfacing;
 113 import org.forester.tools.ConfidenceAssessor;
 114 import org.forester.tools.SupportCount;
 115 import org.forester.tools.TreeSplitMatrix;
 116 import org.forester.util.AsciiHistogram;
 117 import org.forester.util.BasicDescriptiveStatistics;
 118 import org.forester.util.BasicTable;
 119 import org.forester.util.BasicTableParser;
 120 import org.forester.util.DescriptiveStatistics;
 121 import org.forester.util.ForesterConstants;
 122 import org.forester.util.ForesterUtil;
 123 import org.forester.util.GeneralTable;
 124 import org.forester.util.SequenceAccessionTools;
 125 import org.forester.ws.seqdb.SequenceDatabaseEntry;
 126 import org.forester.ws.seqdb.SequenceDbWsTools;
 127 import org.forester.ws.seqdb.UniProtTaxonomy;
 128 import org.forester.ws.wabi.TxSearch;
 129 import org.forester.ws.wabi.TxSearch.RANKS;
 130 import org.forester.ws.wabi.TxSearch.TAX_NAME_CLASS;
 131 import org.forester.ws.wabi.TxSearch.TAX_RANK;
 132
 133 @SuppressWarnings( "unused")
 134 public final class Test {
 135
 136     private final static String  PATH_TO_RESOURCES         = System.getProperty( "user.dir" )
 137             + ForesterUtil.getFileSeparator() + "resources"
 138             + ForesterUtil.getFileSeparator();
 139     private final static String  PATH_TO_TEST_DATA         = System.getProperty( "user.dir" )
 140             + ForesterUtil.getFileSeparator() + "test_data"
 141             + ForesterUtil.getFileSeparator();
 142     private final static boolean PERFORM_DB_TESTS          = true;
 143     private static final boolean PERFORM_WEB_TREE_ACCESS   = true;
 144     private static final String  PHYLOXML_LOCAL_XSD        = PATH_TO_RESOURCES + "phyloxml_schema/"
 145             + ForesterConstants.PHYLO_XML_VERSION + "/"
 146             + ForesterConstants.PHYLO_XML_XSD;
 147     private static final String  PHYLOXML_REMOTE_XSD       = ForesterConstants.PHYLO_XML_LOCATION + "/"
 148             + ForesterConstants.PHYLO_XML_VERSION + "/"
 149             + ForesterConstants.PHYLO_XML_XSD;
 150     private final static boolean USE_LOCAL_PHYLOXML_SCHEMA = true;
 151     private final static double  ZERO_DIFF                 = 1.0E-9;
 152
 153     public static boolean isEqual( final double a, final double b ) {
 154         return ( ( Math.abs( a - b ) ) < Test.ZERO_DIFF );
 155     }
 156
 157     public static void main( final String[] args ) {
 158         System.out.println( "[Java version: " + ForesterUtil.JAVA_VERSION + " " + ForesterUtil.JAVA_VENDOR + "]" );
 159         System.out.println( "[OS: " + ForesterUtil.OS_NAME + " " + ForesterUtil.OS_ARCH + " " + ForesterUtil.OS_VERSION
 160                             + "]" );
 161         Locale.setDefault( Locale.US );
 162         System.out.println( "[Locale: " + Locale.getDefault() + "]" );
 163         int failed = 0;
 164         int succeeded = 0;
 165         System.out.print( "[Test if directory with files for testing exists/is readable: " );
 166         if ( Test.testDir( PATH_TO_TEST_DATA ) ) {
 167             System.out.println( "OK.]" );
 168         }
 169         else {
 170             System.out.println( "could not find/read from directory \"" + PATH_TO_TEST_DATA + "\".]" );
 171             System.out.println( "Testing aborted." );
 172             System.exit( -1 );
 173         }
 174         System.out.print( "[Test if resources directory exists/is readable: " );
 175         if ( testDir( PATH_TO_RESOURCES ) ) {
 176             System.out.println( "OK.]" );
 177         }
 178         else {
 179             System.out.println( "could not find/read from directory \"" + Test.PATH_TO_RESOURCES + "\".]" );
 180             System.out.println( "Testing aborted." );
 181             System.exit( -1 );
 182         }
 183         final long start_time = new Date().getTime();
 184         System.out.print( "MSA entropy: " );
 185         if ( Test.testMsaEntropy() ) {
 186             System.out.println( "OK." );
 187             succeeded++;
 188         }
 189         else {
 190             System.out.println( "failed." );
 191             failed++;
 192         }
 193         System.out.print( "Basic node methods: " );
 194         if ( Test.testBasicNodeMethods() ) {
 195             System.out.println( "OK." );
 196             succeeded++;
 197         }
 198         else {
 199             System.out.println( "failed." );
 200             failed++;
 201         }
 202         System.out.print( "Protein id: " );
 203         if ( !testProteinId() ) {
 204             System.out.println( "failed." );
 205             failed++;
 206         }
 207         else {
 208             succeeded++;
 209         }
 210         System.out.println( "OK." );
 211         System.out.print( "Species: " );
 212         if ( !testSpecies() ) {
 213             System.out.println( "failed." );
 214             failed++;
 215         }
 216         else {
 217             succeeded++;
 218         }
 219         System.out.println( "OK." );
 220         System.out.print( "Basic domain: " );
 221         if ( !testBasicDomain() ) {
 222             System.out.println( "failed." );
 223             failed++;
 224         }
 225         else {
 226             succeeded++;
 227         }
 228         System.out.println( "OK." );
 229         System.out.print( "Basic protein: " );
 230         if ( !testBasicProtein() ) {
 231             System.out.println( "failed." );
 232             failed++;
 233         }
 234         else {
 235             succeeded++;
 236         }
 237         System.out.println( "OK." );
 238         System.out.print( "Sequence writer: " );
 239         if ( testSequenceWriter() ) {
 240             System.out.println( "OK." );
 241             succeeded++;
 242         }
 243         else {
 244             System.out.println( "failed." );
 245             failed++;
 246         }
 247         System.out.print( "Sequence id parsing: " );
 248         if ( testSequenceIdParsing() ) {
 249             System.out.println( "OK." );
 250             succeeded++;
 251         }
 252         else {
 253             System.out.println( "failed." );
 254             failed++;
 255         }
 256         System.out.print( "UniProtKB id extraction: " );
 257         if ( Test.testExtractUniProtKbProteinSeqIdentifier() ) {
 258             System.out.println( "OK." );
 259             succeeded++;
 260         }
 261         else {
 262             System.out.println( "failed." );
 263             failed++;
 264         }
 265         System.out.print( "Sequence DB tools 1: " );
 266         if ( testSequenceDbWsTools1() ) {
 267             System.out.println( "OK." );
 268             succeeded++;
 269         }
 270         else {
 271             System.out.println( "failed." );
 272             failed++;
 273         }
 274         System.out.print( "Hmmscan output parser: " );
 275         if ( testHmmscanOutputParser() ) {
 276             System.out.println( "OK." );
 277             succeeded++;
 278         }
 279         else {
 280             System.out.println( "failed." );
 281             failed++;
 282         }
 283         System.out.print( "Overlap removal: " );
 284         if ( !org.forester.test.Test.testOverlapRemoval() ) {
 285             System.out.println( "failed." );
 286             failed++;
 287         }
 288         else {
 289             succeeded++;
 290         }
 291         System.out.println( "OK." );
 292         System.out.print( "Engulfing overlap removal: " );
 293         if ( !Test.testEngulfingOverlapRemoval() ) {
 294             System.out.println( "failed." );
 295             failed++;
 296         }
 297         else {
 298             succeeded++;
 299         }
 300         System.out.println( "OK." );
 301         System.out.print( "Taxonomy data extraction: " );
 302         if ( Test.testExtractTaxonomyDataFromNodeName() ) {
 303             System.out.println( "OK." );
 304             succeeded++;
 305         }
 306         else {
 307             System.out.println( "failed." );
 308             failed++;
 309         }
 310         System.out.print( "Taxonomy code extraction: " );
 311         if ( Test.testExtractTaxonomyCodeFromNodeName() ) {
 312             System.out.println( "OK." );
 313             succeeded++;
 314         }
 315         else {
 316             System.out.println( "failed." );
 317             failed++;
 318         }
 319         System.out.print( "SN extraction: " );
 320         if ( Test.testExtractSNFromNodeName() ) {
 321             System.out.println( "OK." );
 322             succeeded++;
 323         }
 324         else {
 325             System.out.println( "failed." );
 326             failed++;
 327         }
 328         System.out.print( "Taxonomy extraction (general): " );
 329         if ( Test.testTaxonomyExtraction() ) {
 330             System.out.println( "OK." );
 331             succeeded++;
 332         }
 333         else {
 334             System.out.println( "failed." );
 335             failed++;
 336         }
 337         System.out.print( "Uri for Aptx web sequence accession: " );
 338         if ( Test.testCreateUriForSeqWeb() ) {
 339             System.out.println( "OK." );
 340             succeeded++;
 341         }
 342         else {
 343             System.out.println( "failed." );
 344             failed++;
 345         }
 346         System.out.print( "Basic node construction and parsing of NHX (node level): " );
 347         if ( Test.testNHXNodeParsing() ) {
 348             System.out.println( "OK." );
 349             succeeded++;
 350         }
 351         else {
 352             System.out.println( "failed." );
 353             failed++;
 354         }
 355         System.out.print( "NHX parsing iterating: " );
 356         if ( Test.testNHParsingIter() ) {
 357             System.out.println( "OK." );
 358             succeeded++;
 359         }
 360         else {
 361             System.out.println( "failed." );
 362             failed++;
 363         }
 364         System.out.print( "NH parsing: " );
 365         if ( Test.testNHParsing() ) {
 366             System.out.println( "OK." );
 367             succeeded++;
 368         }
 369         else {
 370             System.out.println( "failed." );
 371             failed++;
 372         }
 373         System.out.print( "Conversion to NHX (node level): " );
 374         if ( Test.testNHXconversion() ) {
 375             System.out.println( "OK." );
 376             succeeded++;
 377         }
 378         else {
 379             System.out.println( "failed." );
 380             failed++;
 381         }
 382         System.out.print( "NHX parsing: " );
 383         if ( Test.testNHXParsing() ) {
 384             System.out.println( "OK." );
 385             succeeded++;
 386         }
 387         else {
 388             System.out.println( "failed." );
 389             failed++;
 390         }
 391         System.out.print( "NHX parsing with quotes: " );
 392         if ( Test.testNHXParsingQuotes() ) {
 393             System.out.println( "OK." );
 394             succeeded++;
 395         }
 396         else {
 397             System.out.println( "failed." );
 398             failed++;
 399         }
 400         System.out.print( "NHX parsing (MrBayes): " );
 401         if ( Test.testNHXParsingMB() ) {
 402             System.out.println( "OK." );
 403             succeeded++;
 404         }
 405         else {
 406             System.out.println( "failed." );
 407             failed++;
 408         }
 409         System.out.print( "Nexus characters parsing: " );
 410         if ( Test.testNexusCharactersParsing() ) {
 411             System.out.println( "OK." );
 412             succeeded++;
 413         }
 414         else {
 415             System.out.println( "failed." );
 416             failed++;
 417         }
 418         System.out.print( "Nexus tree parsing iterating: " );
 419         if ( Test.testNexusTreeParsingIterating() ) {
 420             System.out.println( "OK." );
 421             succeeded++;
 422         }
 423         else {
 424             System.out.println( "failed." );
 425             failed++;
 426         }
 427         System.out.print( "Nexus tree parsing: " );
 428         if ( Test.testNexusTreeParsing() ) {
 429             System.out.println( "OK." );
 430             succeeded++;
 431         }
 432         else {
 433             System.out.println( "failed." );
 434             failed++;
 435         }
 436         System.out.print( "Nexus tree parsing (translating): " );
 437         if ( Test.testNexusTreeParsingTranslating() ) {
 438             System.out.println( "OK." );
 439             succeeded++;
 440         }
 441         else {
 442             System.out.println( "failed." );
 443             failed++;
 444         }
 445         System.out.print( "Nexus matrix parsing: " );
 446         if ( Test.testNexusMatrixParsing() ) {
 447             System.out.println( "OK." );
 448             succeeded++;
 449         }
 450         else {
 451             System.out.println( "failed." );
 452             failed++;
 453         }
 454         System.out.print( "Basic phyloXML parsing: " );
 455         if ( Test.testBasicPhyloXMLparsing() ) {
 456             System.out.println( "OK." );
 457             succeeded++;
 458         }
 459         else {
 460             System.out.println( "failed." );
 461             failed++;
 462         }
 463         System.out.print( "Basic phyloXML parsing (validating against schema): " );
 464         if ( testBasicPhyloXMLparsingValidating() ) {
 465             System.out.println( "OK." );
 466             succeeded++;
 467         }
 468         else {
 469             System.out.println( "failed." );
 470             failed++;
 471         }
 472         System.out.print( "Roundtrip phyloXML parsing (validating against schema): " );
 473         if ( Test.testBasicPhyloXMLparsingRoundtrip() ) {
 474             System.out.println( "OK." );
 475             succeeded++;
 476         }
 477         else {
 478             System.out.println( "failed." );
 479             failed++;
 480         }
 481         System.out.print( "phyloXML Distribution Element: " );
 482         if ( Test.testPhyloXMLparsingOfDistributionElement() ) {
 483             System.out.println( "OK." );
 484             succeeded++;
 485         }
 486         else {
 487             System.out.println( "failed." );
 488             failed++;
 489         }
 490         System.out.print( "Tol XML parsing: " );
 491         if ( Test.testBasicTolXMLparsing() ) {
 492             System.out.println( "OK." );
 493             succeeded++;
 494         }
 495         else {
 496             System.out.println( "failed." );
 497             failed++;
 498         }
 499         System.out.print( "Copying of node data: " );
 500         if ( Test.testCopyOfNodeData() ) {
 501             System.out.println( "OK." );
 502             succeeded++;
 503         }
 504         else {
 505             System.out.println( "failed." );
 506             failed++;
 507         }
 508         System.out.print( "Tree copy: " );
 509         if ( Test.testTreeCopy() ) {
 510             System.out.println( "OK." );
 511             succeeded++;
 512         }
 513         else {
 514             System.out.println( "failed." );
 515             failed++;
 516         }
 517         System.out.print( "Basic tree methods: " );
 518         if ( Test.testBasicTreeMethods() ) {
 519             System.out.println( "OK." );
 520             succeeded++;
 521         }
 522         else {
 523             System.out.println( "failed." );
 524             failed++;
 525         }
 526         System.out.print( "Tree methods: " );
 527         if ( Test.testTreeMethods() ) {
 528             System.out.println( "OK." );
 529             succeeded++;
 530         }
 531         else {
 532             System.out.println( "failed." );
 533             failed++;
 534         }
 535         System.out.print( "Postorder Iterator: " );
 536         if ( Test.testPostOrderIterator() ) {
 537             System.out.println( "OK." );
 538             succeeded++;
 539         }
 540         else {
 541             System.out.println( "failed." );
 542             failed++;
 543         }
 544         System.out.print( "Preorder Iterator: " );
 545         if ( Test.testPreOrderIterator() ) {
 546             System.out.println( "OK." );
 547             succeeded++;
 548         }
 549         else {
 550             System.out.println( "failed." );
 551             failed++;
 552         }
 553         System.out.print( "Levelorder Iterator: " );
 554         if ( Test.testLevelOrderIterator() ) {
 555             System.out.println( "OK." );
 556             succeeded++;
 557         }
 558         else {
 559             System.out.println( "failed." );
 560             failed++;
 561         }
 562         System.out.print( "Re-id methods: " );
 563         if ( Test.testReIdMethods() ) {
 564             System.out.println( "OK." );
 565             succeeded++;
 566         }
 567         else {
 568             System.out.println( "failed." );
 569             failed++;
 570         }
 571         System.out.print( "Methods on last external nodes: " );
 572         if ( Test.testLastExternalNodeMethods() ) {
 573             System.out.println( "OK." );
 574             succeeded++;
 575         }
 576         else {
 577             System.out.println( "failed." );
 578             failed++;
 579         }
 580         System.out.print( "Methods on external nodes: " );
 581         if ( Test.testExternalNodeRelatedMethods() ) {
 582             System.out.println( "OK." );
 583             succeeded++;
 584         }
 585         else {
 586             System.out.println( "failed." );
 587             failed++;
 588         }
 589         System.out.print( "Deletion of external nodes: " );
 590         if ( Test.testDeletionOfExternalNodes() ) {
 591             System.out.println( "OK." );
 592             succeeded++;
 593         }
 594         else {
 595             System.out.println( "failed." );
 596             failed++;
 597         }
 598         System.out.print( "Subtree deletion: " );
 599         if ( Test.testSubtreeDeletion() ) {
 600             System.out.println( "OK." );
 601             succeeded++;
 602         }
 603         else {
 604             System.out.println( "failed." );
 605             failed++;
 606         }
 607         System.out.print( "Phylogeny branch: " );
 608         if ( Test.testPhylogenyBranch() ) {
 609             System.out.println( "OK." );
 610             succeeded++;
 611         }
 612         else {
 613             System.out.println( "failed." );
 614             failed++;
 615         }
 616         System.out.print( "Rerooting: " );
 617         if ( Test.testRerooting() ) {
 618             System.out.println( "OK." );
 619             succeeded++;
 620         }
 621         else {
 622             System.out.println( "failed." );
 623             failed++;
 624         }
 625         System.out.print( "Mipoint rooting: " );
 626         if ( Test.testMidpointrooting() ) {
 627             System.out.println( "OK." );
 628             succeeded++;
 629         }
 630         else {
 631             System.out.println( "failed." );
 632             failed++;
 633         }
 634         System.out.print( "Node removal: " );
 635         if ( Test.testNodeRemoval() ) {
 636             System.out.println( "OK." );
 637             succeeded++;
 638         }
 639         else {
 640             System.out.println( "failed." );
 641             failed++;
 642         }
 643         System.out.print( "Support count: " );
 644         if ( Test.testSupportCount() ) {
 645             System.out.println( "OK." );
 646             succeeded++;
 647         }
 648         else {
 649             System.out.println( "failed." );
 650             failed++;
 651         }
 652         System.out.print( "Support transfer: " );
 653         if ( Test.testSupportTransfer() ) {
 654             System.out.println( "OK." );
 655             succeeded++;
 656         }
 657         else {
 658             System.out.println( "failed." );
 659             failed++;
 660         }
 661         System.out.print( "Finding of LCA: " );
 662         if ( Test.testGetLCA() ) {
 663             System.out.println( "OK." );
 664             succeeded++;
 665         }
 666         else {
 667             System.out.println( "failed." );
 668             failed++;
 669         }
 670         System.out.print( "Finding of LCA 2: " );
 671         if ( Test.testGetLCA2() ) {
 672             System.out.println( "OK." );
 673             succeeded++;
 674         }
 675         else {
 676             System.out.println( "failed." );
 677             failed++;
 678         }
 679         System.out.print( "Calculation of distance between nodes: " );
 680         if ( Test.testGetDistance() ) {
 681             System.out.println( "OK." );
 682             succeeded++;
 683         }
 684         else {
 685             System.out.println( "failed." );
 686             failed++;
 687         }
 688         System.out.print( "Descriptive statistics: " );
 689         if ( Test.testDescriptiveStatistics() ) {
 690             System.out.println( "OK." );
 691             succeeded++;
 692         }
 693         else {
 694             System.out.println( "failed." );
 695             failed++;
 696         }
 697         System.out.print( "Data objects and methods: " );
 698         if ( Test.testDataObjects() ) {
 699             System.out.println( "OK." );
 700             succeeded++;
 701         }
 702         else {
 703             System.out.println( "failed." );
 704             failed++;
 705         }
 706         System.out.print( "Properties map: " );
 707         if ( Test.testPropertiesMap() ) {
 708             System.out.println( "OK." );
 709             succeeded++;
 710         }
 711         else {
 712             System.out.println( "failed." );
 713             failed++;
 714         }
 715         System.out.print( "SDIse: " );
 716         if ( Test.testSDIse() ) {
 717             System.out.println( "OK." );
 718             succeeded++;
 719         }
 720         else {
 721             System.out.println( "failed." );
 722             failed++;
 723         }
 724         System.out.print( "SDIunrooted: " );
 725         if ( Test.testSDIunrooted() ) {
 726             System.out.println( "OK." );
 727             succeeded++;
 728         }
 729         else {
 730             System.out.println( "failed." );
 731             failed++;
 732         }
 733         System.out.print( "GSDI: " );
 734         if ( TestGSDI.test() ) {
 735             System.out.println( "OK." );
 736             succeeded++;
 737         }
 738         else {
 739             System.out.println( "failed." );
 740             failed++;
 741         }
 742         System.out.print( "RIO: " );
 743         if ( TestRIO.test() ) {
 744             System.out.println( "OK." );
 745             succeeded++;
 746         }
 747         else {
 748             System.out.println( "failed." );
 749             failed++;
 750         }
 751         System.out.print( "Phylogeny reconstruction:" );
 752         System.out.println();
 753         if ( TestPhylogenyReconstruction.test( new File( PATH_TO_TEST_DATA ) ) ) {
 754             System.out.println( "OK." );
 755             succeeded++;
 756         }
 757         else {
 758             System.out.println( "failed." );
 759             failed++;
 760         }
 761         System.out.print( "Analysis of domain architectures: " );
 762         System.out.println();
 763         if ( TestSurfacing.test( new File( PATH_TO_TEST_DATA ) ) ) {
 764             System.out.println( "OK." );
 765             succeeded++;
 766         }
 767         else {
 768             System.out.println( "failed." );
 769             failed++;
 770         }
 771         System.out.print( "GO: " );
 772         System.out.println();
 773         if ( TestGo.test( new File( PATH_TO_TEST_DATA ) ) ) {
 774             System.out.println( "OK." );
 775             succeeded++;
 776         }
 777         else {
 778             System.out.println( "failed." );
 779             failed++;
 780         }
 781         System.out.print( "Modeling tools: " );
 782         if ( TestPccx.test() ) {
 783             System.out.println( "OK." );
 784             succeeded++;
 785         }
 786         else {
 787             System.out.println( "failed." );
 788             failed++;
 789         }
 790         System.out.print( "Split Matrix strict: " );
 791         if ( Test.testSplitStrict() ) {
 792             System.out.println( "OK." );
 793             succeeded++;
 794         }
 795         else {
 796             System.out.println( "failed." );
 797             failed++;
 798         }
 799         System.out.print( "Split Matrix: " );
 800         if ( Test.testSplit() ) {
 801             System.out.println( "OK." );
 802             succeeded++;
 803         }
 804         else {
 805             System.out.println( "failed." );
 806             failed++;
 807         }
 808         System.out.print( "Confidence Assessor: " );
 809         if ( Test.testConfidenceAssessor() ) {
 810             System.out.println( "OK." );
 811             succeeded++;
 812         }
 813         else {
 814             System.out.println( "failed." );
 815             failed++;
 816         }
 817         System.out.print( "Basic table: " );
 818         if ( Test.testBasicTable() ) {
 819             System.out.println( "OK." );
 820             succeeded++;
 821         }
 822         else {
 823             System.out.println( "failed." );
 824             failed++;
 825         }
 826         System.out.print( "General table: " );
 827         if ( Test.testGeneralTable() ) {
 828             System.out.println( "OK." );
 829             succeeded++;
 830         }
 831         else {
 832             System.out.println( "failed." );
 833             failed++;
 834         }
 835         System.out.print( "Amino acid sequence: " );
 836         if ( Test.testAminoAcidSequence() ) {
 837             System.out.println( "OK." );
 838             succeeded++;
 839         }
 840         else {
 841             System.out.println( "failed." );
 842             failed++;
 843         }
 844         System.out.print( "General MSA parser: " );
 845         if ( Test.testGeneralMsaParser() ) {
 846             System.out.println( "OK." );
 847             succeeded++;
 848         }
 849         else {
 850             System.out.println( "failed." );
 851             failed++;
 852         }
 853         System.out.print( "Fasta parser for msa: " );
 854         if ( Test.testFastaParser() ) {
 855             System.out.println( "OK." );
 856             succeeded++;
 857         }
 858         else {
 859             System.out.println( "failed." );
 860             failed++;
 861         }
 862         System.out.print( "Creation of balanced phylogeny: " );
 863         if ( Test.testCreateBalancedPhylogeny() ) {
 864             System.out.println( "OK." );
 865             succeeded++;
 866         }
 867         else {
 868             System.out.println( "failed." );
 869             failed++;
 870         }
 871         System.out.print( "Genbank accessor parsing: " );
 872         if ( Test.testGenbankAccessorParsing() ) {
 873             System.out.println( "OK." );
 874             succeeded++;
 875         }
 876         else {
 877             System.out.println( "failed." );
 878             failed++;
 879         }
 880         String path = "";
 881         final String os = ForesterUtil.OS_NAME.toLowerCase();
 882         if ( ( os.indexOf( "mac" ) >= 0 ) && ( os.indexOf( "os" ) > 0 ) ) {
 883             path = "/usr/local/bin/mafft";
 884         }
 885         else if ( os.indexOf( "win" ) >= 0 ) {
 886             path = "C:\\Program Files\\mafft-win\\mafft.bat";
 887         }
 888         else {
 889             path = "mafft";
 890             if ( !MsaInferrer.isInstalled( path ) ) {
 891                 path = "/usr/bin/mafft";
 892             }
 893             if ( !MsaInferrer.isInstalled( path ) ) {
 894                 path = "/usr/local/bin/mafft";
 895             }
 896         }
 897         if ( MsaInferrer.isInstalled( path ) ) {
 898             System.out.print( "MAFFT (external program): " );
 899             if ( Test.testMafft( path ) ) {
 900                 System.out.println( "OK." );
 901                 succeeded++;
 902             }
 903             else {
 904                 System.out.println( "failed [will not count towards failed tests]" );
 905             }
 906         }
 907         System.out.print( "Next nodes with collapsed: " );
 908         if ( Test.testNextNodeWithCollapsing() ) {
 909             System.out.println( "OK." );
 910             succeeded++;
 911         }
 912         else {
 913             System.out.println( "failed." );
 914             failed++;
 915         }
 916         System.out.print( "Simple MSA quality: " );
 917         if ( Test.testMsaQualityMethod() ) {
 918             System.out.println( "OK." );
 919             succeeded++;
 920         }
 921         else {
 922             System.out.println( "failed." );
 923             failed++;
 924         }
 925         System.out.print( "Deleteable MSA: " );
 926         if ( Test.testDeleteableMsa() ) {
 927             System.out.println( "OK." );
 928             succeeded++;
 929         }
 930         else {
 931             System.out.println( "failed." );
 932             failed++;
 933         }
 934         if ( PERFORM_DB_TESTS ) {
 935             System.out.print( "Uniprot Entry Retrieval: " );
 936             if ( Test.testUniprotEntryRetrieval() ) {
 937                 System.out.println( "OK." );
 938                 succeeded++;
 939             }
 940             else {
 941                 System.out.println( "failed." );
 942                 failed++;
 943             }
 944             System.out.print( "Ebi Entry Retrieval: " );
 945             if ( Test.testEbiEntryRetrieval() ) {
 946                 System.out.println( "OK." );
 947                 succeeded++;
 948             }
 949             else {
 950                 System.out.println( "failed." );
 951                 failed++;
 952             }
 953             System.out.print( "Sequence DB tools 2: " );
 954             if ( testSequenceDbWsTools2() ) {
 955                 System.out.println( "OK." );
 956                 succeeded++;
 957             }
 958             else {
 959                 System.out.println( "failed." );
 960                 failed++;
 961                 System.exit( -1 );
 962             }
 963             System.out.print( "Uniprot Taxonomy Search: " );
 964             if ( Test.testUniprotTaxonomySearch() ) {
 965                 System.out.println( "OK." );
 966                 succeeded++;
 967             }
 968             else {
 969                 System.out.println( "failed." );
 970                 failed++;
 971             }
 972         }
 973         if ( PERFORM_WEB_TREE_ACCESS ) {
 974             System.out.print( "NHX parsing from URL: " );
 975             if ( Test.testNHXparsingFromURL() ) {
 976                 System.out.println( "OK." );
 977                 succeeded++;
 978             }
 979             else {
 980                 System.out.println( "failed." );
 981                 failed++;
 982             }
 983             System.out.print( "NHX parsing from URL 2: " );
 984             if ( Test.testNHXparsingFromURL2() ) {
 985                 System.out.println( "OK." );
 986                 succeeded++;
 987             }
 988             else {
 989                 System.out.println( "failed." );
 990                 failed++;
 991             }
 992             System.out.print( "phyloXML parsing from URL: " );
 993             if ( Test.testPhyloXMLparsingFromURL() ) {
 994                 System.out.println( "OK." );
 995                 succeeded++;
 996             }
 997             else {
 998                 System.out.println( "failed." );
 999                 failed++;
1000             }
1001             System.out.print( "TreeBase acccess: " );
1002             if ( Test.testTreeBaseReading() ) {
1003                 System.out.println( "OK." );
1004                 succeeded++;
1005             }
1006             else {
1007                 System.out.println( "failed." );
1008                 failed++;
1009             }
1010             //
1011             System.out.print( "ToL access: " );
1012             if ( Test.testToLReading() ) {
1013                 System.out.println( "OK." );
1014                 succeeded++;
1015             }
1016             else {
1017                 System.out.println( "failed." );
1018                 failed++;
1019             }
1020             //
1021             System.out.print( "TreeFam access: " );
1022             if ( Test.testTreeFamReading() ) {
1023                 System.out.println( "OK." );
1024                 succeeded++;
1025             }
1026             else {
1027                 System.out.println( "failed." );
1028                 failed++;
1029             }
1030             //
1031             //
1032             System.out.print( "Pfam tree access: " );
1033             if ( Test.testPfamTreeReading() ) {
1034                 System.out.println( "OK." );
1035                 succeeded++;
1036             }
1037             else {
1038                 System.out.println( "failed." );
1039                 failed++;
1040             }
1041         }
1042         System.out.println();
1043         final Runtime rt = java.lang.Runtime.getRuntime();
1044         final long free_memory = rt.freeMemory() / 1000000;
1045         final long total_memory = rt.totalMemory() / 1000000;
1046         System.out.println( "Running time    : " + ( new Date().getTime() - start_time ) + "ms " + "(free memory: "
1047                 + free_memory + "MB, total memory: " + total_memory + "MB)" );
1048         System.out.println();
1049         System.out.println( "Successful tests: " + succeeded );
1050         System.out.println( "Failed     tests: " + failed );
1051         System.out.println();
1052         if ( failed < 1 ) {
1053             System.out.println( "OK." );
1054         }
1055         else {
1056             System.out.println( "Not OK." );
1057         }
1058     }
1059
1060     public static boolean testEngulfingOverlapRemoval() {
1061         try {
1062             final Domain d0 = new BasicDomain( "d0", 0, 8, ( short ) 1, ( short ) 1, 0.1, 1 );
1063             final Domain d1 = new BasicDomain( "d1", 0, 1, ( short ) 1, ( short ) 1, 0.1, 1 );
1064             final Domain d2 = new BasicDomain( "d2", 0, 2, ( short ) 1, ( short ) 1, 0.1, 1 );
1065             final Domain d3 = new BasicDomain( "d3", 7, 8, ( short ) 1, ( short ) 1, 0.1, 1 );
1066             final Domain d4 = new BasicDomain( "d4", 7, 9, ( short ) 1, ( short ) 1, 0.1, 1 );
1067             final Domain d5 = new BasicDomain( "d4", 0, 9, ( short ) 1, ( short ) 1, 0.1, 1 );
1068             final Domain d6 = new BasicDomain( "d4", 4, 5, ( short ) 1, ( short ) 1, 0.1, 1 );
1069             final List<Boolean> covered = new ArrayList<Boolean>();
1070             covered.add( true ); // 0
1071             covered.add( false ); // 1
1072             covered.add( true ); // 2
1073             covered.add( false ); // 3
1074             covered.add( true ); // 4
1075             covered.add( true ); // 5
1076             covered.add( false ); // 6
1077             covered.add( true ); // 7
1078             covered.add( true ); // 8
1079             if ( ForesterUtil.isEngulfed( d0, covered ) ) {
1080                 return false;
1081             }
1082             if ( ForesterUtil.isEngulfed( d1, covered ) ) {
1083                 return false;
1084             }
1085             if ( ForesterUtil.isEngulfed( d2, covered ) ) {
1086                 return false;
1087             }
1088             if ( !ForesterUtil.isEngulfed( d3, covered ) ) {
1089                 return false;
1090             }
1091             if ( ForesterUtil.isEngulfed( d4, covered ) ) {
1092                 return false;
1093             }
1094             if ( ForesterUtil.isEngulfed( d5, covered ) ) {
1095                 return false;
1096             }
1097             if ( !ForesterUtil.isEngulfed( d6, covered ) ) {
1098                 return false;
1099             }
1100             final Domain a = new BasicDomain( "a", 0, 10, ( short ) 1, ( short ) 1, 0.1, 1 );
1101             final Domain b = new BasicDomain( "b", 8, 20, ( short ) 1, ( short ) 1, 0.2, 1 );
1102             final Domain c = new BasicDomain( "c", 15, 16, ( short ) 1, ( short ) 1, 0.3, 1 );
1103             final Protein abc = new BasicProtein( "abc", "nemve", 0 );
1104             abc.addProteinDomain( a );
1105             abc.addProteinDomain( b );
1106             abc.addProteinDomain( c );
1107             final Protein abc_r1 = ForesterUtil.removeOverlappingDomains( 3, false, abc );
1108             final Protein abc_r2 = ForesterUtil.removeOverlappingDomains( 3, true, abc );
1109             if ( abc.getNumberOfProteinDomains() != 3 ) {
1110                 return false;
1111             }
1112             if ( abc_r1.getNumberOfProteinDomains() != 3 ) {
1113                 return false;
1114             }
1115             if ( abc_r2.getNumberOfProteinDomains() != 2 ) {
1116                 return false;
1117             }
1118             if ( !abc_r2.getProteinDomain( 0 ).getDomainId().equals( "a" ) ) {
1119                 return false;
1120             }
1121             if ( !abc_r2.getProteinDomain( 1 ).getDomainId().equals( "b" ) ) {
1122                 return false;
1123             }
1124             final Domain d = new BasicDomain( "d", 0, 10, ( short ) 1, ( short ) 1, 0.1, 1 );
1125             final Domain e = new BasicDomain( "e", 8, 20, ( short ) 1, ( short ) 1, 0.3, 1 );
1126             final Domain f = new BasicDomain( "f", 15, 16, ( short ) 1, ( short ) 1, 0.2, 1 );
1127             final Protein def = new BasicProtein( "def", "nemve", 0 );
1128             def.addProteinDomain( d );
1129             def.addProteinDomain( e );
1130             def.addProteinDomain( f );
1131             final Protein def_r1 = ForesterUtil.removeOverlappingDomains( 5, false, def );
1132             final Protein def_r2 = ForesterUtil.removeOverlappingDomains( 5, true, def );
1133             if ( def.getNumberOfProteinDomains() != 3 ) {
1134                 return false;
1135             }
1136             if ( def_r1.getNumberOfProteinDomains() != 3 ) {
1137                 return false;
1138             }
1139             if ( def_r2.getNumberOfProteinDomains() != 3 ) {
1140                 return false;
1141             }
1142             if ( !def_r2.getProteinDomain( 0 ).getDomainId().equals( "d" ) ) {
1143                 return false;
1144             }
1145             if ( !def_r2.getProteinDomain( 1 ).getDomainId().equals( "f" ) ) {
1146                 return false;
1147             }
1148             if ( !def_r2.getProteinDomain( 2 ).getDomainId().equals( "e" ) ) {
1149                 return false;
1150             }
1151         }
1152         catch ( final Exception e ) {
1153             e.printStackTrace( System.out );
1154             return false;
1155         }
1156         return true;
1157     }
1158
1159     public static final boolean testNHXparsingFromURL2() {
1160         try {
1161             final String s = "https://sites.google.com/site/cmzmasek/home/software/archaeopteryx/examples/simple/simple_1.nh";
1162             final Phylogeny phys[] = AptxUtil.readPhylogeniesFromUrl( new URL( s ),
1163                                                                       false,
1164                                                                       false,
1165                                                                       false,
1166                                                                       TAXONOMY_EXTRACTION.NO,
1167                                                                       false );
1168             if ( ( phys == null ) || ( phys.length != 5 ) ) {
1169                 return false;
1170             }
1171             if ( !phys[ 0 ].toNewHampshire().equals( "((((A,B),C),D),(E,F));" ) ) {
1172                 System.out.println( phys[ 0 ].toNewHampshire() );
1173                 return false;
1174             }
1175             if ( !phys[ 1 ].toNewHampshire().equals( "((1,2,3),(4,5,6),(7,8,9));" ) ) {
1176                 System.out.println( phys[ 1 ].toNewHampshire() );
1177                 return false;
1178             }
1179             final Phylogeny phys2[] = AptxUtil.readPhylogeniesFromUrl( new URL( s ),
1180                                                                        false,
1181                                                                        false,
1182                                                                        false,
1183                                                                        TAXONOMY_EXTRACTION.NO,
1184                                                                        false );
1185             if ( ( phys2 == null ) || ( phys2.length != 5 ) ) {
1186                 return false;
1187             }
1188             if ( !phys2[ 0 ].toNewHampshire().equals( "((((A,B),C),D),(E,F));" ) ) {
1189                 System.out.println( phys2[ 0 ].toNewHampshire() );
1190                 return false;
1191             }
1192             if ( !phys2[ 1 ].toNewHampshire().equals( "((1,2,3),(4,5,6),(7,8,9));" ) ) {
1193                 System.out.println( phys2[ 1 ].toNewHampshire() );
1194                 return false;
1195             }
1196             final Phylogeny phys3[] = AptxUtil.readPhylogeniesFromUrl( new URL( "http://swisstree.vital-it.ch:80/"
1197                     + "SwissTree/ST001/consensus_tree.nhx" ), false, false, false, TAXONOMY_EXTRACTION.NO, false );
1198             if ( ( phys3 == null ) || ( phys3.length != 1 ) ) {
1199                 return false;
1200             }
1201             if ( !phys3[ 0 ]
1202                     .toNewHampshire()
1203                     .equals( "((((POP23a_CIOIN_ENSCING00000016202,POP23b_CIOIN_ENSCING00000016169),POP23_CIOSA_ENSCSAVG00000000248),((POP23a_BRAFL_C3ZMF1,POP23b_BRAFL_121417),(((POP3_ORYLA_ENSORLG00000019669,POP3_GASAC_ENSGACG00000014023,POP3_DANRE_Q6JWW1),(POP3_XENTR_B1H1F6,(POP3_CHICK_Q9DG25,(POP3_ORNAN_ENSOANG00000004179,POP3_MONDO_ENSMODG00000018033,((POP3_MOUSE_Q9ES81,POP3_RAT_Q3BCU3),POP3_RABIT_ENSOCUG00000025973,POP3_MACMU_ENSMMUG00000014473,POP3_HUMAN_Q9HBV1))))),(((POP2_GASAC_ENSGACG00000001420,POP2_ORYLA_ENSORLG00000008627,POP2_TAKRU_ENSTRUG00000015933),POP2_DANRE_ENSDARG00000069922),POP2_XENTR_ENSXETG00000018064,(((POP2_TAEGU_ENSTGUG00000013383,POP2_CHICK_Q6T9Z5),POP2_ANOCA_ENSACAG00000003557),((POP2_MACEU_ENSMEUG00000015825,POP2_MONDO_ENSMODG00000018205),((POP2_RABIT_ENSOCUG00000009515,(POP2_RAT_Q6P722,POP2_MOUSE_Q9ES82)),(POP2_MACMU_ENSMMUG00000000905,POP2_HUMAN_Q9HBU9)))))))),((POP1_CIOSA_ENSCSAVG00000000247,POP1_CIOIN_ENSCING00000000496),((POP1_DANRE_Q5PQZ7,(POP1_ORYLA_ENSORLG00000019663,POP1_GASAC_ENSGACG00000014015,POP1_TAKRU_ENSORLG00000019663)),(POP1_XENTR_B1H1G2,(POP1_ANOCA_ENSACAG00000003910,(POP1_TAEGU_ENSTGUG00000012218,POP1_CHICK_Q9DG23)),POP1_ORNAN_ENSOANG00000004180,POP1_MONDO_ENSMODG00000018034,(POP1_RABIT_ENSOCUG00000016944,(POP1_RAT_Q3BCU4,POP1_MOUSE_Q9ES83),(POP1_HUMAN_Q8NE79,POP1_MACMU_ENSMMUG00000014471))))));" ) ) {
1204                 System.out.println( phys3[ 0 ].toNewHampshire() );
1205                 return false;
1206             }
1207             final Phylogeny phys4[] = AptxUtil.readPhylogeniesFromUrl( new URL( "http://swisstree.vital-it.ch:80/"
1208                     + "SwissTree/ST001/consensus_tree.nhx" ), false, false, false, TAXONOMY_EXTRACTION.NO, false );
1209             if ( ( phys4 == null ) || ( phys4.length != 1 ) ) {
1210                 return false;
1211             }
1212             if ( !phys4[ 0 ]
1213                     .toNewHampshire()
1214                     .equals( "((((POP23a_CIOIN_ENSCING00000016202,POP23b_CIOIN_ENSCING00000016169),POP23_CIOSA_ENSCSAVG00000000248),((POP23a_BRAFL_C3ZMF1,POP23b_BRAFL_121417),(((POP3_ORYLA_ENSORLG00000019669,POP3_GASAC_ENSGACG00000014023,POP3_DANRE_Q6JWW1),(POP3_XENTR_B1H1F6,(POP3_CHICK_Q9DG25,(POP3_ORNAN_ENSOANG00000004179,POP3_MONDO_ENSMODG00000018033,((POP3_MOUSE_Q9ES81,POP3_RAT_Q3BCU3),POP3_RABIT_ENSOCUG00000025973,POP3_MACMU_ENSMMUG00000014473,POP3_HUMAN_Q9HBV1))))),(((POP2_GASAC_ENSGACG00000001420,POP2_ORYLA_ENSORLG00000008627,POP2_TAKRU_ENSTRUG00000015933),POP2_DANRE_ENSDARG00000069922),POP2_XENTR_ENSXETG00000018064,(((POP2_TAEGU_ENSTGUG00000013383,POP2_CHICK_Q6T9Z5),POP2_ANOCA_ENSACAG00000003557),((POP2_MACEU_ENSMEUG00000015825,POP2_MONDO_ENSMODG00000018205),((POP2_RABIT_ENSOCUG00000009515,(POP2_RAT_Q6P722,POP2_MOUSE_Q9ES82)),(POP2_MACMU_ENSMMUG00000000905,POP2_HUMAN_Q9HBU9)))))))),((POP1_CIOSA_ENSCSAVG00000000247,POP1_CIOIN_ENSCING00000000496),((POP1_DANRE_Q5PQZ7,(POP1_ORYLA_ENSORLG00000019663,POP1_GASAC_ENSGACG00000014015,POP1_TAKRU_ENSORLG00000019663)),(POP1_XENTR_B1H1G2,(POP1_ANOCA_ENSACAG00000003910,(POP1_TAEGU_ENSTGUG00000012218,POP1_CHICK_Q9DG23)),POP1_ORNAN_ENSOANG00000004180,POP1_MONDO_ENSMODG00000018034,(POP1_RABIT_ENSOCUG00000016944,(POP1_RAT_Q3BCU4,POP1_MOUSE_Q9ES83),(POP1_HUMAN_Q8NE79,POP1_MACMU_ENSMMUG00000014471))))));" ) ) {
1215                 System.out.println( phys4[ 0 ].toNewHampshire() );
1216                 return false;
1217             }
1218         }
1219         catch ( final Exception e ) {
1220             e.printStackTrace();
1221             return false;
1222         }
1223         return true;
1224     }
1225
1226     public static final boolean testNHXparsingFromURL() {
1227         try {
1228             final String s = "https://sites.google.com/site/cmzmasek/home/software/archaeopteryx/examples/simple/simple_1.nh";
1229             final URL u = new URL( s );
1230             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
1231             final Phylogeny[] phys = factory.create( u, new NHXParser() );
1232             if ( ( phys == null ) || ( phys.length != 5 ) ) {
1233                 return false;
1234             }
1235             if ( !phys[ 0 ].toNewHampshire().equals( "((((A,B),C),D),(E,F));" ) ) {
1236                 System.out.println( phys[ 0 ].toNewHampshire() );
1237                 return false;
1238             }
1239             if ( !phys[ 1 ].toNewHampshire().equals( "((1,2,3),(4,5,6),(7,8,9));" ) ) {
1240                 System.out.println( phys[ 1 ].toNewHampshire() );
1241                 return false;
1242             }
1243             final URL u2 = new URL( s );
1244             final Phylogeny[] phys2 = factory.create( u2.openStream(), new NHXParser() );
1245             if ( ( phys2 == null ) || ( phys2.length != 5 ) ) {
1246                 return false;
1247             }
1248             if ( !phys2[ 0 ].toNewHampshire().equals( "((((A,B),C),D),(E,F));" ) ) {
1249                 System.out.println( phys2[ 0 ].toNewHampshire() );
1250                 return false;
1251             }
1252             final PhylogenyFactory factory2 = ParserBasedPhylogenyFactory.getInstance();
1253             final NHXParser p = new NHXParser();
1254             final URL u3 = new URL( s );
1255             p.setSource( u3 );
1256             if ( !p.hasNext() ) {
1257                 return false;
1258             }
1259             if ( !p.next().toNewHampshire().equals( "((((A,B),C),D),(E,F));" ) ) {
1260                 return false;
1261             }
1262             if ( !p.hasNext() ) {
1263                 return false;
1264             }
1265             p.reset();
1266             if ( !p.hasNext() ) {
1267                 return false;
1268             }
1269             if ( !p.next().toNewHampshire().equals( "((((A,B),C),D),(E,F));" ) ) {
1270                 return false;
1271             }
1272             if ( !p.next().toNewHampshire().equals( "((1,2,3),(4,5,6),(7,8,9));" ) ) {
1273                 return false;
1274             }
1275             p.reset();
1276             if ( !p.hasNext() ) {
1277                 return false;
1278             }
1279             if ( !p.next().toNewHampshire().equals( "((((A,B),C),D),(E,F));" ) ) {
1280                 return false;
1281             }
1282             if ( !p.next().toNewHampshire().equals( "((1,2,3),(4,5,6),(7,8,9));" ) ) {
1283                 return false;
1284             }
1285         }
1286         catch ( final Exception e ) {
1287             System.out.println( e.toString() );
1288             e.printStackTrace();
1289             return false;
1290         }
1291         return true;
1292     }
1293
1294     public static boolean testOverlapRemoval() {
1295         try {
1296             final Domain d0 = new BasicDomain( "d0", ( short ) 2, ( short ) 5, ( short ) 1, ( short ) 1, 0.1, 1 );
1297             final Domain d1 = new BasicDomain( "d1", ( short ) 7, ( short ) 10, ( short ) 1, ( short ) 1, 0.1, 1 );
1298             final Domain d2 = new BasicDomain( "d2", ( short ) 0, ( short ) 20, ( short ) 1, ( short ) 1, 0.1, 1 );
1299             final Domain d3 = new BasicDomain( "d3", ( short ) 9, ( short ) 10, ( short ) 1, ( short ) 1, 0.1, 1 );
1300             final Domain d4 = new BasicDomain( "d4", ( short ) 7, ( short ) 8, ( short ) 1, ( short ) 1, 0.1, 1 );
1301             final List<Boolean> covered = new ArrayList<Boolean>();
1302             covered.add( true ); // 0
1303             covered.add( false ); // 1
1304             covered.add( true ); // 2
1305             covered.add( false ); // 3
1306             covered.add( true ); // 4
1307             covered.add( true ); // 5
1308             covered.add( false ); // 6
1309             covered.add( true ); // 7
1310             covered.add( true ); // 8
1311             if ( ForesterUtil.calculateOverlap( d0, covered ) != 3 ) {
1312                 return false;
1313             }
1314             if ( ForesterUtil.calculateOverlap( d1, covered ) != 2 ) {
1315                 return false;
1316             }
1317             if ( ForesterUtil.calculateOverlap( d2, covered ) != 6 ) {
1318                 return false;
1319             }
1320             if ( ForesterUtil.calculateOverlap( d3, covered ) != 0 ) {
1321                 return false;
1322             }
1323             if ( ForesterUtil.calculateOverlap( d4, covered ) != 2 ) {
1324                 return false;
1325             }
1326             final Domain a = new BasicDomain( "a", ( short ) 2, ( short ) 5, ( short ) 1, ( short ) 1, 1, -1 );
1327             final Domain b = new BasicDomain( "b", ( short ) 2, ( short ) 10, ( short ) 1, ( short ) 1, 0.1, -1 );
1328             final Protein ab = new BasicProtein( "ab", "varanus", 0 );
1329             ab.addProteinDomain( a );
1330             ab.addProteinDomain( b );
1331             final Protein ab_s0 = ForesterUtil.removeOverlappingDomains( 3, false, ab );
1332             if ( ab.getNumberOfProteinDomains() != 2 ) {
1333                 return false;
1334             }
1335             if ( ab_s0.getNumberOfProteinDomains() != 1 ) {
1336                 return false;
1337             }
1338             if ( !ab_s0.getProteinDomain( 0 ).getDomainId().equals( "b" ) ) {
1339                 return false;
1340             }
1341             final Protein ab_s1 = ForesterUtil.removeOverlappingDomains( 4, false, ab );
1342             if ( ab.getNumberOfProteinDomains() != 2 ) {
1343                 return false;
1344             }
1345             if ( ab_s1.getNumberOfProteinDomains() != 2 ) {
1346                 return false;
1347             }
1348             final Domain c = new BasicDomain( "c", ( short ) 20000, ( short ) 20500, ( short ) 1, ( short ) 1, 10, 1 );
1349             final Domain d = new BasicDomain( "d",
1350                                               ( short ) 10000,
1351                                               ( short ) 10500,
1352                                               ( short ) 1,
1353                                               ( short ) 1,
1354                                               0.0000001,
1355                                               1 );
1356             final Domain e = new BasicDomain( "e", ( short ) 5000, ( short ) 5500, ( short ) 1, ( short ) 1, 0.0001, 1 );
1357             final Protein cde = new BasicProtein( "cde", "varanus", 0 );
1358             cde.addProteinDomain( c );
1359             cde.addProteinDomain( d );
1360             cde.addProteinDomain( e );
1361             final Protein cde_s0 = ForesterUtil.removeOverlappingDomains( 0, false, cde );
1362             if ( cde.getNumberOfProteinDomains() != 3 ) {
1363                 return false;
1364             }
1365             if ( cde_s0.getNumberOfProteinDomains() != 3 ) {
1366                 return false;
1367             }
1368             final Domain f = new BasicDomain( "f", ( short ) 10, ( short ) 20, ( short ) 1, ( short ) 1, 10, 1 );
1369             final Domain g = new BasicDomain( "g", ( short ) 10, ( short ) 20, ( short ) 1, ( short ) 1, 0.01, 1 );
1370             final Domain h = new BasicDomain( "h", ( short ) 10, ( short ) 20, ( short ) 1, ( short ) 1, 0.0001, 1 );
1371             final Domain i = new BasicDomain( "i", ( short ) 10, ( short ) 20, ( short ) 1, ( short ) 1, 0.5, 1 );
1372             final Domain i2 = new BasicDomain( "i", ( short ) 5, ( short ) 30, ( short ) 1, ( short ) 1, 0.5, 10 );
1373             final Protein fghi = new BasicProtein( "fghi", "varanus", 0 );
1374             fghi.addProteinDomain( f );
1375             fghi.addProteinDomain( g );
1376             fghi.addProteinDomain( h );
1377             fghi.addProteinDomain( i );
1378             fghi.addProteinDomain( i );
1379             fghi.addProteinDomain( i );
1380             fghi.addProteinDomain( i2 );
1381             final Protein fghi_s0 = ForesterUtil.removeOverlappingDomains( 10, false, fghi );
1382             if ( fghi.getNumberOfProteinDomains() != 7 ) {
1383                 return false;
1384             }
1385             if ( fghi_s0.getNumberOfProteinDomains() != 1 ) {
1386                 return false;
1387             }
1388             if ( !fghi_s0.getProteinDomain( 0 ).getDomainId().equals( "h" ) ) {
1389                 return false;
1390             }
1391             final Protein fghi_s1 = ForesterUtil.removeOverlappingDomains( 11, false, fghi );
1392             if ( fghi.getNumberOfProteinDomains() != 7 ) {
1393                 return false;
1394             }
1395             if ( fghi_s1.getNumberOfProteinDomains() != 7 ) {
1396                 return false;
1397             }
1398             final Domain j = new BasicDomain( "j", ( short ) 10, ( short ) 20, ( short ) 1, ( short ) 1, 10, 1 );
1399             final Domain k = new BasicDomain( "k", ( short ) 10, ( short ) 20, ( short ) 1, ( short ) 1, 0.01, 1 );
1400             final Domain l = new BasicDomain( "l", ( short ) 10, ( short ) 20, ( short ) 1, ( short ) 1, 0.0001, 1 );
1401             final Domain m = new BasicDomain( "m", ( short ) 10, ( short ) 20, ( short ) 1, ( short ) 4, 0.5, 1 );
1402             final Domain m0 = new BasicDomain( "m", ( short ) 10, ( short ) 20, ( short ) 2, ( short ) 4, 0.5, 1 );
1403             final Domain m1 = new BasicDomain( "m", ( short ) 10, ( short ) 20, ( short ) 3, ( short ) 4, 0.5, 1 );
1404             final Domain m2 = new BasicDomain( "m", ( short ) 5, ( short ) 30, ( short ) 4, ( short ) 4, 0.5, 10 );
1405             final Protein jklm = new BasicProtein( "jklm", "varanus", 0 );
1406             jklm.addProteinDomain( j );
1407             jklm.addProteinDomain( k );
1408             jklm.addProteinDomain( l );
1409             jklm.addProteinDomain( m );
1410             jklm.addProteinDomain( m0 );
1411             jklm.addProteinDomain( m1 );
1412             jklm.addProteinDomain( m2 );
1413             final Protein jklm_s0 = ForesterUtil.removeOverlappingDomains( 10, false, jklm );
1414             if ( jklm.getNumberOfProteinDomains() != 7 ) {
1415                 return false;
1416             }
1417             if ( jklm_s0.getNumberOfProteinDomains() != 1 ) {
1418                 return false;
1419             }
1420             if ( !jklm_s0.getProteinDomain( 0 ).getDomainId().equals( "l" ) ) {
1421                 return false;
1422             }
1423             final Protein jklm_s1 = ForesterUtil.removeOverlappingDomains( 11, false, jklm );
1424             if ( jklm.getNumberOfProteinDomains() != 7 ) {
1425                 return false;
1426             }
1427             if ( jklm_s1.getNumberOfProteinDomains() != 7 ) {
1428                 return false;
1429             }
1430             final Domain only = new BasicDomain( "only", ( short ) 5, ( short ) 30, ( short ) 4, ( short ) 4, 0.5, 10 );
1431             final Protein od = new BasicProtein( "od", "varanus", 0 );
1432             od.addProteinDomain( only );
1433             final Protein od_s0 = ForesterUtil.removeOverlappingDomains( 0, false, od );
1434             if ( od.getNumberOfProteinDomains() != 1 ) {
1435                 return false;
1436             }
1437             if ( od_s0.getNumberOfProteinDomains() != 1 ) {
1438                 return false;
1439             }
1440         }
1441         catch ( final Exception e ) {
1442             e.printStackTrace( System.out );
1443             return false;
1444         }
1445         return true;
1446     }
1447
1448     public static final boolean testPfamTreeReading() {
1449         try {
1450             final URL u = new URL( WebserviceUtil.PFAM_SERVER + "/family/PF" + "01849" + "/tree/download" );
1451             final NHXParser parser = new NHXParser();
1452             parser.setTaxonomyExtraction( NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
1453             parser.setReplaceUnderscores( false );
1454             parser.setGuessRootedness( true );
1455             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
1456             final Phylogeny[] phys = factory.create( u.openStream(), parser );
1457             if ( ( phys == null ) || ( phys.length != 1 ) ) {
1458                 return false;
1459             }
1460             if ( phys[ 0 ].getNumberOfExternalNodes() < 10 ) {
1461                 return false;
1462             }
1463         }
1464         catch ( final Exception e ) {
1465             e.printStackTrace();
1466         }
1467         return true;
1468     }
1469
1470     public static final boolean testPhyloXMLparsingFromURL() {
1471         try {
1472             final String s = "https://sites.google.com/site/cmzmasek/home/software/archaeopteryx/examples/archaeopteryx_a/apaf_bcl2.xml";
1473             final URL u = new URL( s );
1474             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
1475             final Phylogeny[] phys = factory.create( u.openStream(), PhyloXmlParser.createPhyloXmlParser() );
1476             if ( ( phys == null ) || ( phys.length != 2 ) ) {
1477                 return false;
1478             }
1479         }
1480         catch ( final Exception e ) {
1481             e.printStackTrace();
1482         }
1483         return true;
1484     }
1485
1486     public static final boolean testToLReading() {
1487         try {
1488             final URL u = new URL( WebserviceUtil.TOL_URL_BASE + "15079" );
1489             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
1490             final Phylogeny[] phys = factory.create( u.openStream(), new TolParser() );
1491             if ( ( phys == null ) || ( phys.length != 1 ) ) {
1492                 return false;
1493             }
1494             if ( !phys[ 0 ].getRoot().getNodeData().getTaxonomy().getIdentifier().getValue().equals( "15079" ) ) {
1495                 return false;
1496             }
1497             if ( !phys[ 0 ].getRoot().getNodeData().getTaxonomy().getScientificName().equals( "Protacanthopterygii" ) ) {
1498                 return false;
1499             }
1500             if ( phys[ 0 ].getNumberOfExternalNodes() < 5 ) {
1501                 return false;
1502             }
1503         }
1504         catch ( final Exception e ) {
1505             e.printStackTrace();
1506         }
1507         return true;
1508     }
1509
1510     public static final boolean testTreeBaseReading() {
1511         try {
1512             final URL u = new URL( WebserviceUtil.TREEBASE_PHYLOWS_TREE_URL_BASE + "825?format=nexus" );
1513             final NexusPhylogeniesParser parser = new NexusPhylogeniesParser();
1514             parser.setReplaceUnderscores( true );
1515             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
1516             final Phylogeny[] phys = factory.create( u.openStream(), parser );
1517             if ( ( phys == null ) || ( phys.length != 1 ) ) {
1518                 return false;
1519             }
1520             final URL u2 = new URL( WebserviceUtil.TREEBASE_PHYLOWS_STUDY_URL_BASE + "15613?format=nexus" );
1521             final NexusPhylogeniesParser parser2 = new NexusPhylogeniesParser();
1522             parser2.setReplaceUnderscores( true );
1523             final PhylogenyFactory factory2 = ParserBasedPhylogenyFactory.getInstance();
1524             final Phylogeny[] phys2 = factory2.create( u2.openStream(), parser2 );
1525             if ( ( phys2 == null ) || ( phys2.length != 9 ) ) {
1526                 return false;
1527             }
1528         }
1529         catch ( final Exception e ) {
1530             e.printStackTrace();
1531         }
1532         return true;
1533     }
1534
1535     public static final boolean testTreeFamReading() {
1536         try {
1537             final URL u = new URL( WebserviceUtil.TREE_FAM_URL_BASE + "101004" + "/tree/newick" );
1538             final NHXParser parser = new NHXParser();
1539             parser.setTaxonomyExtraction( NHXParser.TAXONOMY_EXTRACTION.NO );
1540             parser.setReplaceUnderscores( false );
1541             parser.setGuessRootedness( true );
1542             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
1543             final Phylogeny[] phys = factory.create( u.openStream(), parser );
1544             if ( ( phys == null ) || ( phys.length != 1 ) ) {
1545                 return false;
1546             }
1547             if ( phys[ 0 ].getNumberOfExternalNodes() < 10 ) {
1548                 return false;
1549             }
1550         }
1551         catch ( final Exception e ) {
1552             e.printStackTrace();
1553         }
1554         return true;
1555     }
1556
1557     private final static Phylogeny createPhylogeny( final String nhx ) throws IOException {
1558         final Phylogeny p = ParserBasedPhylogenyFactory.getInstance().create( nhx, new NHXParser() )[ 0 ];
1559         return p;
1560     }
1561
1562     private final static Event getEvent( final Phylogeny p, final String n1, final String n2 ) {
1563         return PhylogenyMethods.calculateLCA( p.getNode( n1 ), p.getNode( n2 ) ).getNodeData().getEvent();
1564     }
1565
1566     private static boolean testAminoAcidSequence() {
1567         try {
1568             final MolecularSequence aa1 = BasicSequence.createAaSequence( "aa1", "aAklm-?xX*z$#" );
1569             if ( aa1.getLength() != 13 ) {
1570                 return false;
1571             }
1572             if ( aa1.getResidueAt( 0 ) != 'A' ) {
1573                 return false;
1574             }
1575             if ( aa1.getResidueAt( 2 ) != 'K' ) {
1576                 return false;
1577             }
1578             if ( !new String( aa1.getMolecularSequence() ).equals( "AAKLM-XXX*ZXX" ) ) {
1579                 return false;
1580             }
1581             final MolecularSequence aa2 = BasicSequence.createAaSequence( "aa3", "ARNDCQEGHILKMFPSTWYVX*-BZOJU" );
1582             if ( !new String( aa2.getMolecularSequence() ).equals( "ARNDCQEGHILKMFPSTWYVX*-BZOXU" ) ) {
1583                 return false;
1584             }
1585             final MolecularSequence dna1 = BasicSequence.createDnaSequence( "dna1", "ACGTUX*-?RYMKWSN" );
1586             if ( !new String( dna1.getMolecularSequence() ).equals( "ACGTNN*-NRYMKWSN" ) ) {
1587                 return false;
1588             }
1589             final MolecularSequence rna1 = BasicSequence.createRnaSequence( "rna1", "..ACGUTX*-?RYMKWSN" );
1590             if ( !new String( rna1.getMolecularSequence() ).equals( "--ACGUNN*-NRYMKWSN" ) ) {
1591                 return false;
1592             }
1593         }
1594         catch ( final Exception e ) {
1595             e.printStackTrace();
1596             return false;
1597         }
1598         return true;
1599     }
1600
1601     private static boolean testBasicDomain() {
1602         try {
1603             final Domain pd = new BasicDomain( "id", 23, 25, ( short ) 1, ( short ) 4, 0.1, -12 );
1604             if ( !pd.getDomainId().equals( "id" ) ) {
1605                 return false;
1606             }
1607             if ( pd.getNumber() != 1 ) {
1608                 return false;
1609             }
1610             if ( pd.getTotalCount() != 4 ) {
1611                 return false;
1612             }
1613             if ( !pd.equals( new BasicDomain( "id", 22, 111, ( short ) 1, ( short ) 4, 0.2, -12 ) ) ) {
1614                 return false;
1615             }
1616             final Domain a1 = new BasicDomain( "a", 1, 10, ( short ) 1, ( short ) 4, 0.1, -12 );
1617             final BasicDomain a1_copy = new BasicDomain( "a", 1, 10, ( short ) 1, ( short ) 4, 0.1, -12 );
1618             final BasicDomain a1_equal = new BasicDomain( "a", 524, 743994, ( short ) 1, ( short ) 300, 3.0005, 230 );
1619             final BasicDomain a2 = new BasicDomain( "a", 1, 10, ( short ) 2, ( short ) 4, 0.1, -12 );
1620             final BasicDomain a3 = new BasicDomain( "A", 1, 10, ( short ) 1, ( short ) 4, 0.1, -12 );
1621             if ( !a1.equals( a1 ) ) {
1622                 return false;
1623             }
1624             if ( !a1.equals( a1_copy ) ) {
1625                 return false;
1626             }
1627             if ( !a1.equals( a1_equal ) ) {
1628                 return false;
1629             }
1630             if ( !a1.equals( a2 ) ) {
1631                 return false;
1632             }
1633             if ( a1.equals( a3 ) ) {
1634                 return false;
1635             }
1636             if ( a1.compareTo( a1 ) != 0 ) {
1637                 return false;
1638             }
1639             if ( a1.compareTo( a1_copy ) != 0 ) {
1640                 return false;
1641             }
1642             if ( a1.compareTo( a1_equal ) != 0 ) {
1643                 return false;
1644             }
1645             if ( a1.compareTo( a2 ) != 0 ) {
1646                 return false;
1647             }
1648             if ( a1.compareTo( a3 ) == 0 ) {
1649                 return false;
1650             }
1651         }
1652         catch ( final Exception e ) {
1653             e.printStackTrace( System.out );
1654             return false;
1655         }
1656         return true;
1657     }
1658
1659     private static boolean testBasicNodeMethods() {
1660         try {
1661             if ( PhylogenyNode.getNodeCount() != 0 ) {
1662                 return false;
1663             }
1664             final PhylogenyNode n1 = new PhylogenyNode();
1665             final PhylogenyNode n2 = PhylogenyNode
1666                     .createInstanceFromNhxString( "", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
1667             final PhylogenyNode n3 = PhylogenyNode
1668                     .createInstanceFromNhxString( "n3", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
1669             final PhylogenyNode n4 = PhylogenyNode
1670                     .createInstanceFromNhxString( "n4:0.01", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
1671             if ( n1.isHasAssignedEvent() ) {
1672                 return false;
1673             }
1674             if ( PhylogenyNode.getNodeCount() != 4 ) {
1675                 return false;
1676             }
1677             if ( n3.getIndicator() != 0 ) {
1678                 return false;
1679             }
1680             if ( n3.getNumberOfExternalNodes() != 1 ) {
1681                 return false;
1682             }
1683             if ( !n3.isExternal() ) {
1684                 return false;
1685             }
1686             if ( !n3.isRoot() ) {
1687                 return false;
1688             }
1689             if ( !n4.getName().equals( "n4" ) ) {
1690                 return false;
1691             }
1692         }
1693         catch ( final Exception e ) {
1694             e.printStackTrace( System.out );
1695             return false;
1696         }
1697         return true;
1698     }
1699
1700     private static boolean testBasicPhyloXMLparsing() {
1701         try {
1702             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
1703             final PhyloXmlParser xml_parser = PhyloXmlParser.createPhyloXmlParser();
1704             final Phylogeny[] phylogenies_0 = factory.create( Test.PATH_TO_TEST_DATA + "phyloxml_test_t1.xml",
1705                                                               xml_parser );
1706             if ( xml_parser.getErrorCount() > 0 ) {
1707                 System.out.println( xml_parser.getErrorMessages().toString() );
1708                 return false;
1709             }
1710             if ( phylogenies_0.length != 4 ) {
1711                 return false;
1712             }
1713             final Phylogeny t1 = phylogenies_0[ 0 ];
1714             final Phylogeny t2 = phylogenies_0[ 1 ];
1715             final Phylogeny t3 = phylogenies_0[ 2 ];
1716             final Phylogeny t4 = phylogenies_0[ 3 ];
1717             if ( t1.getNumberOfExternalNodes() != 1 ) {
1718                 return false;
1719             }
1720             if ( !t1.isRooted() ) {
1721                 return false;
1722             }
1723             if ( t1.isRerootable() ) {
1724                 return false;
1725             }
1726             if ( !t1.getType().equals( "gene_tree" ) ) {
1727                 return false;
1728             }
1729             if ( t2.getNumberOfExternalNodes() != 2 ) {
1730                 return false;
1731             }
1732             if ( !isEqual( t2.getNode( "node a" ).getDistanceToParent(), 1.0 ) ) {
1733                 return false;
1734             }
1735             if ( !isEqual( t2.getNode( "node b" ).getDistanceToParent(), 2.0 ) ) {
1736                 return false;
1737             }
1738             if ( t2.getNode( "node a" ).getNodeData().getTaxonomies().size() != 2 ) {
1739                 return false;
1740             }
1741             if ( !t2.getNode( "node a" ).getNodeData().getTaxonomy( 0 ).getCommonName().equals( "some parasite" ) ) {
1742                 return false;
1743             }
1744             if ( !t2.getNode( "node a" ).getNodeData().getTaxonomy( 1 ).getCommonName().equals( "the host" ) ) {
1745                 return false;
1746             }
1747             if ( t2.getNode( "node a" ).getNodeData().getSequences().size() != 2 ) {
1748                 return false;
1749             }
1750             if ( !t2.getNode( "node a" ).getNodeData().getSequence( 0 ).getMolecularSequence()
1751                     .startsWith( "actgtgggggt" ) ) {
1752                 return false;
1753             }
1754             if ( !t2.getNode( "node a" ).getNodeData().getSequence( 1 ).getMolecularSequence()
1755                     .startsWith( "ctgtgatgcat" ) ) {
1756                 return false;
1757             }
1758             if ( t3.getNumberOfExternalNodes() != 4 ) {
1759                 return false;
1760             }
1761             if ( !t1.getName().equals( "t1" ) ) {
1762                 return false;
1763             }
1764             if ( !t2.getName().equals( "t2" ) ) {
1765                 return false;
1766             }
1767             if ( !t3.getName().equals( "t3" ) ) {
1768                 return false;
1769             }
1770             if ( !t4.getName().equals( "t4" ) ) {
1771                 return false;
1772             }
1773             if ( !t3.getIdentifier().getValue().equals( "1-1" ) ) {
1774                 return false;
1775             }
1776             if ( !t3.getIdentifier().getProvider().equals( "treebank" ) ) {
1777                 return false;
1778             }
1779             if ( !t3.getNode( "root node" ).getNodeData().getSequence().getType().equals( "protein" ) ) {
1780                 return false;
1781             }
1782             if ( !t3.getNode( "root node" ).getNodeData().getSequence().getName()
1783                     .equals( "Apoptosis facilitator Bcl-2-like 14 protein" ) ) {
1784                 return false;
1785             }
1786             if ( !t3.getNode( "root node" ).getNodeData().getSequence().getSymbol().equals( "BCL2L14" ) ) {
1787                 return false;
1788             }
1789             if ( !t3.getNode( "root node" ).getNodeData().getSequence().getAccession().getValue().equals( "Q9BZR8" ) ) {
1790                 return false;
1791             }
1792             if ( !t3.getNode( "root node" ).getNodeData().getSequence().getAccession().getSource().equals( "UniProtKB" ) ) {
1793                 return false;
1794             }
1795             if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getDesc()
1796                     .equals( "apoptosis" ) ) {
1797                 return false;
1798             }
1799             if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getRef()
1800                     .equals( "GO:0006915" ) ) {
1801                 return false;
1802             }
1803             if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getSource()
1804                     .equals( "UniProtKB" ) ) {
1805                 return false;
1806             }
1807             if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getEvidence()
1808                     .equals( "experimental" ) ) {
1809                 return false;
1810             }
1811             if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getType()
1812                     .equals( "function" ) ) {
1813                 return false;
1814             }
1815             if ( ( t3.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getConfidence()
1816                     .getValue() != 1 ) {
1817                 return false;
1818             }
1819             if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getConfidence()
1820                     .getType().equals( "ml" ) ) {
1821                 return false;
1822             }
1823             if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getDesc()
1824                     .equals( "apoptosis" ) ) {
1825                 return false;
1826             }
1827             if ( ( t3.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getProperties()
1828                     .getProperty( "AFFY:expression" ).getAppliesTo() != AppliesTo.ANNOTATION ) {
1829                 return false;
1830             }
1831             if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getProperties()
1832                     .getProperty( "AFFY:expression" ).getDataType().equals( "xsd:double" ) ) {
1833                 return false;
1834             }
1835             if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getProperties()
1836                     .getProperty( "AFFY:expression" ).getRef().equals( "AFFY:expression" ) ) {
1837                 return false;
1838             }
1839             if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getProperties()
1840                     .getProperty( "AFFY:expression" ).getUnit().equals( "AFFY:x" ) ) {
1841                 return false;
1842             }
1843             if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getProperties()
1844                     .getProperty( "AFFY:expression" ).getValue().equals( "0.2" ) ) {
1845                 return false;
1846             }
1847             if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getProperties()
1848                     .getProperty( "MED:disease" ).getValue().equals( "lymphoma" ) ) {
1849                 return false;
1850             }
1851             if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 1 ) ).getRef()
1852                     .equals( "GO:0005829" ) ) {
1853                 return false;
1854             }
1855             if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 0 ) ).getDesc()
1856                     .equals( "intracellular organelle" ) ) {
1857                 return false;
1858             }
1859             if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getUri( 0 ).getType().equals( "source" ) ) ) {
1860                 return false;
1861             }
1862             if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getUri( 0 ).getDescription()
1863                     .equals( "UniProt link" ) ) ) {
1864                 return false;
1865             }
1866             if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getLocation().equals( "12p13-p12" ) ) ) {
1867                 return false;
1868             }
1869             final SortedSet<Accession> x = t3.getNode( "root node" ).getNodeData().getSequence().getCrossReferences();
1870             if ( x.size() != 4 ) {
1871                 return false;
1872             }
1873             int c = 0;
1874             for( final Accession acc : x ) {
1875                 if ( c == 0 ) {
1876                     if ( !acc.getSource().equals( "KEGG" ) ) {
1877                         return false;
1878                     }
1879                     if ( !acc.getValue().equals( "hsa:596" ) ) {
1880                         return false;
1881                     }
1882                 }
1883                 c++;
1884             }
1885         }
1886         catch ( final Exception e ) {
1887             e.printStackTrace( System.out );
1888             return false;
1889         }
1890         return true;
1891     }
1892
1893     private static boolean testBasicPhyloXMLparsingRoundtrip() {
1894         try {
1895             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
1896             final PhyloXmlParser xml_parser = PhyloXmlParser.createPhyloXmlParser();
1897             if ( USE_LOCAL_PHYLOXML_SCHEMA ) {
1898                 xml_parser.setValidateAgainstSchema( PHYLOXML_LOCAL_XSD );
1899             }
1900             else {
1901                 xml_parser.setValidateAgainstSchema( PHYLOXML_REMOTE_XSD );
1902             }
1903             final Phylogeny[] phylogenies_0 = factory.create( Test.PATH_TO_TEST_DATA + "phyloxml_test_t1.xml",
1904                                                               xml_parser );
1905             if ( xml_parser.getErrorCount() > 0 ) {
1906                 System.out.println( xml_parser.getErrorMessages().toString() );
1907                 return false;
1908             }
1909             if ( phylogenies_0.length != 4 ) {
1910                 return false;
1911             }
1912             final StringBuffer t1_sb = new StringBuffer( phylogenies_0[ 0 ].toPhyloXML( 0 ) );
1913             final Phylogeny[] phylogenies_t1 = factory.create( t1_sb, xml_parser );
1914             if ( phylogenies_t1.length != 1 ) {
1915                 return false;
1916             }
1917             final Phylogeny t1_rt = phylogenies_t1[ 0 ];
1918             if ( !t1_rt.getDistanceUnit().equals( "cc" ) ) {
1919                 return false;
1920             }
1921             if ( !t1_rt.isRooted() ) {
1922                 return false;
1923             }
1924             if ( t1_rt.isRerootable() ) {
1925                 return false;
1926             }
1927             if ( !t1_rt.getType().equals( "gene_tree" ) ) {
1928                 return false;
1929             }
1930             final StringBuffer t2_sb = new StringBuffer( phylogenies_0[ 1 ].toPhyloXML( 0 ) );
1931             final Phylogeny[] phylogenies_t2 = factory.create( t2_sb, xml_parser );
1932             final Phylogeny t2_rt = phylogenies_t2[ 0 ];
1933             if ( t2_rt.getNode( "node a" ).getNodeData().getTaxonomies().size() != 2 ) {
1934                 return false;
1935             }
1936             if ( !t2_rt.getNode( "node a" ).getNodeData().getTaxonomy( 0 ).getCommonName().equals( "some parasite" ) ) {
1937                 return false;
1938             }
1939             if ( !t2_rt.getNode( "node a" ).getNodeData().getTaxonomy( 1 ).getCommonName().equals( "the host" ) ) {
1940                 return false;
1941             }
1942             if ( t2_rt.getNode( "node a" ).getNodeData().getSequences().size() != 2 ) {
1943                 return false;
1944             }
1945             if ( !t2_rt.getNode( "node a" ).getNodeData().getSequence( 0 ).getMolecularSequence()
1946                     .startsWith( "actgtgggggt" ) ) {
1947                 return false;
1948             }
1949             if ( !t2_rt.getNode( "node a" ).getNodeData().getSequence( 1 ).getMolecularSequence()
1950                     .startsWith( "ctgtgatgcat" ) ) {
1951                 return false;
1952             }
1953             final StringBuffer t3_sb_0 = new StringBuffer( phylogenies_0[ 2 ].toPhyloXML( 0 ) );
1954             final Phylogeny[] phylogenies_1_0 = factory.create( t3_sb_0, xml_parser );
1955             final StringBuffer t3_sb = new StringBuffer( phylogenies_1_0[ 0 ].toPhyloXML( 0 ) );
1956             final Phylogeny[] phylogenies_1 = factory.create( t3_sb, xml_parser );
1957             if ( phylogenies_1.length != 1 ) {
1958                 return false;
1959             }
1960             final Phylogeny t3_rt = phylogenies_1[ 0 ];
1961             if ( !t3_rt.getName().equals( "t3" ) ) {
1962                 return false;
1963             }
1964             if ( t3_rt.getNumberOfExternalNodes() != 4 ) {
1965                 return false;
1966             }
1967             if ( !t3_rt.getIdentifier().getValue().equals( "1-1" ) ) {
1968                 return false;
1969             }
1970             if ( !t3_rt.getIdentifier().getProvider().equals( "treebank" ) ) {
1971                 return false;
1972             }
1973             if ( !t3_rt.getNode( "root node" ).getNodeData().getSequence().getType().equals( "protein" ) ) {
1974                 return false;
1975             }
1976             if ( !t3_rt.getNode( "root node" ).getNodeData().getSequence().getName()
1977                     .equals( "Apoptosis facilitator Bcl-2-like 14 protein" ) ) {
1978                 return false;
1979             }
1980             if ( !t3_rt.getNode( "root node" ).getNodeData().getSequence().getSymbol().equals( "BCL2L14" ) ) {
1981                 return false;
1982             }
1983             if ( !t3_rt.getNode( "root node" ).getNodeData().getSequence().getAccession().getValue().equals( "Q9BZR8" ) ) {
1984                 return false;
1985             }
1986             if ( !t3_rt.getNode( "root node" ).getNodeData().getSequence().getAccession().getSource()
1987                     .equals( "UniProtKB" ) ) {
1988                 return false;
1989             }
1990             if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getDesc()
1991                     .equals( "apoptosis" ) ) {
1992                 return false;
1993             }
1994             if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getRef()
1995                     .equals( "GO:0006915" ) ) {
1996                 return false;
1997             }
1998             if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getSource()
1999                     .equals( "UniProtKB" ) ) {
2000                 return false;
2001             }
2002             if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getEvidence()
2003                     .equals( "experimental" ) ) {
2004                 return false;
2005             }
2006             if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getType()
2007                     .equals( "function" ) ) {
2008                 return false;
2009             }
2010             if ( ( t3_rt.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getConfidence()
2011                     .getValue() != 1 ) {
2012                 return false;
2013             }
2014             if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getConfidence()
2015                     .getType().equals( "ml" ) ) {
2016                 return false;
2017             }
2018             if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getDesc()
2019                     .equals( "apoptosis" ) ) {
2020                 return false;
2021             }
2022             if ( ( t3_rt.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getProperties()
2023                     .getProperty( "AFFY:expression" ).getAppliesTo() != AppliesTo.ANNOTATION ) {
2024                 return false;
2025             }
2026             if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getProperties()
2027                     .getProperty( "AFFY:expression" ).getDataType().equals( "xsd:double" ) ) {
2028                 return false;
2029             }
2030             if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getProperties()
2031                     .getProperty( "AFFY:expression" ).getRef().equals( "AFFY:expression" ) ) {
2032                 return false;
2033             }
2034             if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getProperties()
2035                     .getProperty( "AFFY:expression" ).getUnit().equals( "AFFY:x" ) ) {
2036                 return false;
2037             }
2038             if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getProperties()
2039                     .getProperty( "AFFY:expression" ).getValue().equals( "0.2" ) ) {
2040                 return false;
2041             }
2042             if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getProperties()
2043                     .getProperty( "MED:disease" ).getValue().equals( "lymphoma" ) ) {
2044                 return false;
2045             }
2046             if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 1 ) ).getRef()
2047                     .equals( "GO:0005829" ) ) {
2048                 return false;
2049             }
2050             if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 0 ) ).getDesc()
2051                     .equals( "intracellular organelle" ) ) {
2052                 return false;
2053             }
2054             if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getUri( 0 ).getType().equals( "source" ) ) ) {
2055                 return false;
2056             }
2057             if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getUri( 0 ).getDescription()
2058                     .equals( "UniProt link" ) ) ) {
2059                 return false;
2060             }
2061             if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getLocation().equals( "12p13-p12" ) ) ) {
2062                 return false;
2063             }
2064             if ( !( t3_rt.getNode( "root node" ).getNodeData().getReference().getDoi().equals( "10.1038/387489a0" ) ) ) {
2065                 return false;
2066             }
2067             if ( !( t3_rt.getNode( "root node" ).getNodeData().getReference().getDescription()
2068                     .equals( "Aguinaldo, A. M. A.; J. M. Turbeville, L. S. Linford, M. C. Rivera, J. R. Garey, R. A. Raff, & J. A. Lake (1997). \"Evidence for a clade of nematodes, arthropods and other moulting animals\". Nature 387 (6632): 489–493." ) ) ) {
2069                 return false;
2070             }
2071             if ( !t3_rt.getNode( "root node" ).getNodeData().getTaxonomy().getTaxonomyCode().equals( "ECDYS" ) ) {
2072                 return false;
2073             }
2074             if ( !t3_rt.getNode( "root node" ).getNodeData().getTaxonomy().getScientificName().equals( "ecdysozoa" ) ) {
2075                 return false;
2076             }
2077             if ( !t3_rt.getNode( "root node" ).getNodeData().getTaxonomy().getCommonName().equals( "molting animals" ) ) {
2078                 return false;
2079             }
2080             if ( !t3_rt.getNode( "root node" ).getNodeData().getTaxonomy().getIdentifier().getValue().equals( "1" ) ) {
2081                 return false;
2082             }
2083             if ( !t3_rt.getNode( "root node" ).getNodeData().getTaxonomy().getIdentifier().getProvider()
2084                     .equals( "ncbi" ) ) {
2085                 return false;
2086             }
2087             if ( t3_rt.getNode( "node bc" ).getNodeData().getSequence().getDomainArchitecture().getTotalLength() != 124 ) {
2088                 return false;
2089             }
2090             if ( !t3_rt.getNode( "node bc" ).getNodeData().getSequence().getDomainArchitecture().getDomain( 0 )
2091                     .getName().equals( "B" ) ) {
2092                 return false;
2093             }
2094             if ( t3_rt.getNode( "node bc" ).getNodeData().getSequence().getDomainArchitecture().getDomain( 0 )
2095                     .getFrom() != 21 ) {
2096                 return false;
2097             }
2098             if ( t3_rt.getNode( "node bc" ).getNodeData().getSequence().getDomainArchitecture().getDomain( 0 ).getTo() != 44 ) {
2099                 return false;
2100             }
2101             if ( t3_rt.getNode( "node bc" ).getNodeData().getSequence().getDomainArchitecture().getDomain( 0 )
2102                     .getLength() != 24 ) {
2103                 return false;
2104             }
2105             if ( t3_rt.getNode( "node bc" ).getNodeData().getSequence().getDomainArchitecture().getDomain( 0 )
2106                     .getConfidence() != 2144 ) {
2107                 return false;
2108             }
2109             if ( !t3_rt.getNode( "node bc" ).getNodeData().getSequence().getDomainArchitecture().getDomain( 0 ).getId()
2110                     .equals( "pfam" ) ) {
2111                 return false;
2112             }
2113             if ( t3_rt.getNode( "node bb" ).getNodeData().getBinaryCharacters().getGainedCharacters().size() != 3 ) {
2114                 return false;
2115             }
2116             if ( t3_rt.getNode( "node bb" ).getNodeData().getBinaryCharacters().getPresentCharacters().size() != 2 ) {
2117                 return false;
2118             }
2119             if ( t3_rt.getNode( "node bb" ).getNodeData().getBinaryCharacters().getLostCharacters().size() != 1 ) {
2120                 return false;
2121             }
2122             if ( !t3_rt.getNode( "node bb" ).getNodeData().getBinaryCharacters().getType().equals( "domains" ) ) {
2123                 return false;
2124             }
2125             final Taxonomy taxbb = t3_rt.getNode( "node bb" ).getNodeData().getTaxonomy();
2126             if ( !taxbb.getAuthority().equals( "Stephenson, 1935" ) ) {
2127                 return false;
2128             }
2129             if ( !taxbb.getCommonName().equals( "starlet sea anemone" ) ) {
2130                 return false;
2131             }
2132             if ( !taxbb.getIdentifier().getProvider().equals( "EOL" ) ) {
2133                 return false;
2134             }
2135             if ( !taxbb.getIdentifier().getValue().equals( "704294" ) ) {
2136                 return false;
2137             }
2138             if ( !taxbb.getTaxonomyCode().equals( "NEMVE" ) ) {
2139                 return false;
2140             }
2141             if ( !taxbb.getScientificName().equals( "Nematostella vectensis" ) ) {
2142                 return false;
2143             }
2144             if ( taxbb.getSynonyms().size() != 2 ) {
2145                 return false;
2146             }
2147             if ( !taxbb.getSynonyms().contains( "Nematostella vectensis Stephenson1935" ) ) {
2148                 return false;
2149             }
2150             if ( !taxbb.getSynonyms().contains( "See Anemone" ) ) {
2151                 return false;
2152             }
2153             if ( !taxbb.getUri( 0 ).getDescription().equals( "EOL" ) ) {
2154                 return false;
2155             }
2156             if ( !taxbb.getUri( 0 ).getType().equals( "linkout" ) ) {
2157                 return false;
2158             }
2159             if ( !taxbb.getUri( 0 ).getValue().toString().equals( "http://www.eol.org/pages/704294" ) ) {
2160                 return false;
2161             }
2162             if ( ( ( BinaryCharacters ) t3_rt.getNode( "node bb" ).getNodeData().getBinaryCharacters().copy() )
2163                     .getLostCount() != BinaryCharacters.COUNT_DEFAULT ) {
2164                 return false;
2165             }
2166             if ( t3_rt.getNode( "node b" ).getNodeData().getBinaryCharacters().getGainedCount() != 1 ) {
2167                 return false;
2168             }
2169             if ( t3_rt.getNode( "node b" ).getNodeData().getBinaryCharacters().getGainedCharacters().size() != 1 ) {
2170                 return false;
2171             }
2172             if ( t3_rt.getNode( "node b" ).getNodeData().getBinaryCharacters().getLostCount() != 3 ) {
2173                 return false;
2174             }
2175             if ( t3_rt.getNode( "node b" ).getNodeData().getBinaryCharacters().getLostCharacters().size() != 3 ) {
2176                 return false;
2177             }
2178             if ( t3_rt.getNode( "node b" ).getNodeData().getBinaryCharacters().getPresentCount() != 2 ) {
2179                 return false;
2180             }
2181             if ( t3_rt.getNode( "node b" ).getNodeData().getBinaryCharacters().getPresentCharacters().size() != 2 ) {
2182                 return false;
2183             }
2184             if ( !t3_rt.getNode( "node b" ).getNodeData().getBinaryCharacters().getType().equals( "characters" ) ) {
2185                 return false;
2186             }
2187             if ( !t3_rt.getNode( "node ba" ).getNodeData().getDate().getDesc().equals( "Silurian" ) ) {
2188                 return false;
2189             }
2190             if ( !t3_rt.getNode( "node ba" ).getNodeData().getDate().getValue().toPlainString()
2191                     .equalsIgnoreCase( "435" ) ) {
2192                 return false;
2193             }
2194             if ( !t3_rt.getNode( "node ba" ).getNodeData().getDate().getMin().toPlainString().equalsIgnoreCase( "416" ) ) {
2195                 return false;
2196             }
2197             if ( !t3_rt.getNode( "node ba" ).getNodeData().getDate().getMax().toPlainString()
2198                     .equalsIgnoreCase( "443.7" ) ) {
2199                 return false;
2200             }
2201             if ( !t3_rt.getNode( "node ba" ).getNodeData().getDate().getUnit().equals( "mya" ) ) {
2202                 return false;
2203             }
2204             if ( !t3_rt.getNode( "node bb" ).getNodeData().getDate().getDesc().equals( "Triassic" ) ) {
2205                 return false;
2206             }
2207             if ( !t3_rt.getNode( "node bc" ).getNodeData().getDate().getValue().toPlainString()
2208                     .equalsIgnoreCase( "433" ) ) {
2209                 return false;
2210             }
2211             final SortedSet<Accession> x = t3_rt.getNode( "root node" ).getNodeData().getSequence()
2212                     .getCrossReferences();
2213             if ( x.size() != 4 ) {
2214                 return false;
2215             }
2216             int c = 0;
2217             for( final Accession acc : x ) {
2218                 if ( c == 0 ) {
2219                     if ( !acc.getSource().equals( "KEGG" ) ) {
2220                         return false;
2221                     }
2222                     if ( !acc.getValue().equals( "hsa:596" ) ) {
2223                         return false;
2224                     }
2225                 }
2226                 c++;
2227             }
2228         }
2229         catch ( final Exception e ) {
2230             e.printStackTrace( System.out );
2231             return false;
2232         }
2233         return true;
2234     }
2235
2236     private static boolean testBasicPhyloXMLparsingValidating() {
2237         try {
2238             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
2239             PhyloXmlParser xml_parser = null;
2240             try {
2241                 xml_parser = PhyloXmlParser.createPhyloXmlParserXsdValidating();
2242             }
2243             catch ( final Exception e ) {
2244                 // Do nothing -- means were not running from jar.
2245             }
2246             if ( xml_parser == null ) {
2247                 xml_parser = PhyloXmlParser.createPhyloXmlParser();
2248                 if ( USE_LOCAL_PHYLOXML_SCHEMA ) {
2249                     xml_parser.setValidateAgainstSchema( PHYLOXML_LOCAL_XSD );
2250                 }
2251                 else {
2252                     xml_parser.setValidateAgainstSchema( PHYLOXML_REMOTE_XSD );
2253                 }
2254             }
2255             final Phylogeny[] phylogenies_0 = factory.create( Test.PATH_TO_TEST_DATA + "phyloxml_test_t1.xml",
2256                                                               xml_parser );
2257             if ( xml_parser.getErrorCount() > 0 ) {
2258                 System.out.println( xml_parser.getErrorMessages().toString() );
2259                 return false;
2260             }
2261             if ( phylogenies_0.length != 4 ) {
2262                 return false;
2263             }
2264             final Phylogeny t1 = phylogenies_0[ 0 ];
2265             final Phylogeny t2 = phylogenies_0[ 1 ];
2266             final Phylogeny t3 = phylogenies_0[ 2 ];
2267             final Phylogeny t4 = phylogenies_0[ 3 ];
2268             if ( !t1.getName().equals( "t1" ) ) {
2269                 return false;
2270             }
2271             if ( !t2.getName().equals( "t2" ) ) {
2272                 return false;
2273             }
2274             if ( !t3.getName().equals( "t3" ) ) {
2275                 return false;
2276             }
2277             if ( !t4.getName().equals( "t4" ) ) {
2278                 return false;
2279             }
2280             if ( t1.getNumberOfExternalNodes() != 1 ) {
2281                 return false;
2282             }
2283             if ( t2.getNumberOfExternalNodes() != 2 ) {
2284                 return false;
2285             }
2286             if ( t3.getNumberOfExternalNodes() != 4 ) {
2287                 return false;
2288             }
2289             final String x2 = Test.PATH_TO_TEST_DATA + "phyloxml_test_t1.xml";
2290             final Phylogeny[] phylogenies_1 = factory.create( x2, xml_parser );
2291             if ( xml_parser.getErrorCount() > 0 ) {
2292                 System.out.println( "errors:" );
2293                 System.out.println( xml_parser.getErrorMessages().toString() );
2294                 return false;
2295             }
2296             if ( phylogenies_1.length != 4 ) {
2297                 return false;
2298             }
2299             final Phylogeny[] phylogenies_2 = factory.create( Test.PATH_TO_TEST_DATA + "phyloxml_test_t3.xml",
2300                                                               xml_parser );
2301             if ( xml_parser.getErrorCount() > 0 ) {
2302                 System.out.println( "errors:" );
2303                 System.out.println( xml_parser.getErrorMessages().toString() );
2304                 return false;
2305             }
2306             if ( phylogenies_2.length != 1 ) {
2307                 return false;
2308             }
2309             if ( phylogenies_2[ 0 ].getNumberOfExternalNodes() != 2 ) {
2310                 return false;
2311             }
2312             final Phylogeny[] phylogenies_3 = factory.create( Test.PATH_TO_TEST_DATA + "phyloxml_test_t4.xml",
2313                                                               xml_parser );
2314             if ( xml_parser.getErrorCount() > 0 ) {
2315                 System.out.println( xml_parser.getErrorMessages().toString() );
2316                 return false;
2317             }
2318             if ( phylogenies_3.length != 2 ) {
2319                 return false;
2320             }
2321             final Phylogeny a = phylogenies_3[ 0 ];
2322             if ( !a.getName().equals( "tree 4" ) ) {
2323                 return false;
2324             }
2325             if ( a.getNumberOfExternalNodes() != 3 ) {
2326                 return false;
2327             }
2328             if ( !a.getNode( "node b1" ).getNodeData().getSequence().getName().equals( "b1 gene" ) ) {
2329                 return false;
2330             }
2331             if ( !a.getNode( "node b1" ).getNodeData().getTaxonomy().getCommonName().equals( "b1 species" ) ) {
2332                 return false;
2333             }
2334             final Phylogeny[] phylogenies_4 = factory.create( Test.PATH_TO_TEST_DATA + "special_characters.xml",
2335                                                               xml_parser );
2336             if ( xml_parser.getErrorCount() > 0 ) {
2337                 System.out.println( xml_parser.getErrorMessages().toString() );
2338                 return false;
2339             }
2340             if ( phylogenies_4.length != 1 ) {
2341                 return false;
2342             }
2343             final Phylogeny s = phylogenies_4[ 0 ];
2344             if ( s.getNumberOfExternalNodes() != 6 ) {
2345                 return false;
2346             }
2347             s.getNode( "first" );
2348             s.getNode( "<>" );
2349             s.getNode( "\"<a'b&c'd\">\"" );
2350             s.getNode( "'''\"" );
2351             s.getNode( "\"\"\"" );
2352             s.getNode( "dick & doof" );
2353         }
2354         catch ( final Exception e ) {
2355             e.printStackTrace( System.out );
2356             return false;
2357         }
2358         return true;
2359     }
2360
2361     private static boolean testBasicProtein() {
2362         try {
2363             final BasicProtein p0 = new BasicProtein( "p0", "owl", 0 );
2364             final Domain a = new BasicDomain( "a", 1, 10, ( short ) 1, ( short ) 5, 0.1, -12 );
2365             final Domain b = new BasicDomain( "b", 11, 20, ( short ) 1, ( short ) 5, 0.1, -12 );
2366             final Domain c = new BasicDomain( "c", 9, 23, ( short ) 1, ( short ) 5, 0.1, -12 );
2367             final Domain d = new BasicDomain( "d", 15, 30, ( short ) 1, ( short ) 5, 0.1, -12 );
2368             final Domain e = new BasicDomain( "e", 60, 70, ( short ) 1, ( short ) 5, 0.1, -12 );
2369             final Domain x = new BasicDomain( "x", 100, 110, ( short ) 1, ( short ) 5, 0.1, -12 );
2370             final Domain y = new BasicDomain( "y", 100, 110, ( short ) 1, ( short ) 5, 0.1, -12 );
2371             p0.addProteinDomain( y );
2372             p0.addProteinDomain( e );
2373             p0.addProteinDomain( b );
2374             p0.addProteinDomain( c );
2375             p0.addProteinDomain( d );
2376             p0.addProteinDomain( a );
2377             p0.addProteinDomain( x );
2378             if ( !p0.toDomainArchitectureString( "~" ).equals( "a~b~c~d~e~x~y" ) ) {
2379                 return false;
2380             }
2381             if ( !p0.toDomainArchitectureString( "~", 3, "=" ).equals( "a~b~c~d~e~x~y" ) ) {
2382                 return false;
2383             }
2384             //
2385             final BasicProtein aa0 = new BasicProtein( "aa", "owl", 0 );
2386             final Domain a1 = new BasicDomain( "a", 1, 10, ( short ) 1, ( short ) 5, 0.1, -12 );
2387             aa0.addProteinDomain( a1 );
2388             if ( !aa0.toDomainArchitectureString( "~" ).equals( "a" ) ) {
2389                 return false;
2390             }
2391             if ( !aa0.toDomainArchitectureString( "~", 3, "" ).equals( "a" ) ) {
2392                 return false;
2393             }
2394             //
2395             final BasicProtein aa1 = new BasicProtein( "aa", "owl", 0 );
2396             final Domain a11 = new BasicDomain( "a", 1, 10, ( short ) 1, ( short ) 5, 0.1, -12 );
2397             final Domain a12 = new BasicDomain( "a", 2, 20, ( short ) 1, ( short ) 5, 0.1, -12 );
2398             aa1.addProteinDomain( a11 );
2399             aa1.addProteinDomain( a12 );
2400             if ( !aa1.toDomainArchitectureString( "~" ).equals( "a~a" ) ) {
2401                 return false;
2402             }
2403             if ( !aa1.toDomainArchitectureString( "~", 3, "" ).equals( "a~a" ) ) {
2404                 return false;
2405             }
2406             aa1.addProteinDomain( new BasicDomain( "a", 20, 30, ( short ) 1, ( short ) 5, 0.1, -12 ) );
2407             if ( !aa1.toDomainArchitectureString( "~" ).equals( "a~a~a" ) ) {
2408                 return false;
2409             }
2410             if ( !aa1.toDomainArchitectureString( "~", 3, "" ).equals( "aaa" ) ) {
2411                 return false;
2412             }
2413             if ( !aa1.toDomainArchitectureString( "~", 4, "" ).equals( "a~a~a" ) ) {
2414                 return false;
2415             }
2416             aa1.addProteinDomain( new BasicDomain( "a", 30, 40, ( short ) 1, ( short ) 5, 0.1, -12 ) );
2417             if ( !aa1.toDomainArchitectureString( "~" ).equals( "a~a~a~a" ) ) {
2418                 return false;
2419             }
2420             if ( !aa1.toDomainArchitectureString( "~", 3, "" ).equals( "aaa" ) ) {
2421                 return false;
2422             }
2423             if ( !aa1.toDomainArchitectureString( "~", 4, "" ).equals( "aaa" ) ) {
2424                 return false;
2425             }
2426             if ( !aa1.toDomainArchitectureString( "~", 5, "" ).equals( "a~a~a~a" ) ) {
2427                 return false;
2428             }
2429             aa1.addProteinDomain( new BasicDomain( "b", 32, 40, ( short ) 1, ( short ) 5, 0.1, -12 ) );
2430             if ( !aa1.toDomainArchitectureString( "~" ).equals( "a~a~a~a~b" ) ) {
2431                 return false;
2432             }
2433             if ( !aa1.toDomainArchitectureString( "~", 3, "" ).equals( "aaa~b" ) ) {
2434                 return false;
2435             }
2436             if ( !aa1.toDomainArchitectureString( "~", 4, "" ).equals( "aaa~b" ) ) {
2437                 return false;
2438             }
2439             if ( !aa1.toDomainArchitectureString( "~", 5, "" ).equals( "a~a~a~a~b" ) ) {
2440                 return false;
2441             }
2442             aa1.addProteinDomain( new BasicDomain( "c", 1, 2, ( short ) 1, ( short ) 5, 0.1, -12 ) );
2443             if ( !aa1.toDomainArchitectureString( "~" ).equals( "c~a~a~a~a~b" ) ) {
2444                 return false;
2445             }
2446             if ( !aa1.toDomainArchitectureString( "~", 3, "" ).equals( "c~aaa~b" ) ) {
2447                 return false;
2448             }
2449             if ( !aa1.toDomainArchitectureString( "~", 4, "" ).equals( "c~aaa~b" ) ) {
2450                 return false;
2451             }
2452             if ( !aa1.toDomainArchitectureString( "~", 5, "" ).equals( "c~a~a~a~a~b" ) ) {
2453                 return false;
2454             }
2455             //
2456             final BasicProtein p00 = new BasicProtein( "p0", "owl", 0 );
2457             final Domain a0 = new BasicDomain( "a", 1, 10, ( short ) 1, ( short ) 5, 0.1, -12 );
2458             final Domain b0 = new BasicDomain( "b", 11, 20, ( short ) 1, ( short ) 5, 0.1, -12 );
2459             final Domain c0 = new BasicDomain( "c", 9, 23, ( short ) 1, ( short ) 5, 0.1, -12 );
2460             final Domain d0 = new BasicDomain( "d", 15, 30, ( short ) 1, ( short ) 5, 0.1, -12 );
2461             final Domain e0 = new BasicDomain( "e", 60, 70, ( short ) 1, ( short ) 5, 0.1, -12 );
2462             final Domain e1 = new BasicDomain( "e", 61, 71, ( short ) 1, ( short ) 5, 0.1, -12 );
2463             final Domain e2 = new BasicDomain( "e", 62, 72, ( short ) 1, ( short ) 5, 0.1, -12 );
2464             final Domain e3 = new BasicDomain( "e", 63, 73, ( short ) 1, ( short ) 5, 0.1, -12 );
2465             final Domain e4 = new BasicDomain( "e", 64, 74, ( short ) 1, ( short ) 5, 0.1, -12 );
2466             final Domain e5 = new BasicDomain( "e", 65, 75, ( short ) 1, ( short ) 5, 0.1, -12 );
2467             final Domain x0 = new BasicDomain( "x", 100, 110, ( short ) 1, ( short ) 5, 0.1, -12 );
2468             final Domain y0 = new BasicDomain( "y", 100, 110, ( short ) 1, ( short ) 5, 0.1, -12 );
2469             final Domain y1 = new BasicDomain( "y", 120, 130, ( short ) 1, ( short ) 5, 0.1, -12 );
2470             final Domain y2 = new BasicDomain( "y", 140, 150, ( short ) 1, ( short ) 5, 0.1, -12 );
2471             final Domain y3 = new BasicDomain( "y", 160, 170, ( short ) 1, ( short ) 5, 0.1, -12 );
2472             final Domain z0 = new BasicDomain( "z", 200, 210, ( short ) 1, ( short ) 5, 0.1, -12 );
2473             final Domain z1 = new BasicDomain( "z", 300, 310, ( short ) 1, ( short ) 5, 0.1, -12 );
2474             final Domain z2 = new BasicDomain( "z", 400, 410, ( short ) 1, ( short ) 5, 0.1, -12 );
2475             final Domain zz0 = new BasicDomain( "Z", 500, 510, ( short ) 1, ( short ) 5, 0.1, -12 );
2476             final Domain zz1 = new BasicDomain( "Z", 600, 610, ( short ) 1, ( short ) 5, 0.1, -12 );
2477             p00.addProteinDomain( y0 );
2478             p00.addProteinDomain( e0 );
2479             p00.addProteinDomain( b0 );
2480             p00.addProteinDomain( c0 );
2481             p00.addProteinDomain( d0 );
2482             p00.addProteinDomain( a0 );
2483             p00.addProteinDomain( x0 );
2484             p00.addProteinDomain( y1 );
2485             p00.addProteinDomain( y2 );
2486             p00.addProteinDomain( y3 );
2487             p00.addProteinDomain( e1 );
2488             p00.addProteinDomain( e2 );
2489             p00.addProteinDomain( e3 );
2490             p00.addProteinDomain( e4 );
2491             p00.addProteinDomain( e5 );
2492             p00.addProteinDomain( z0 );
2493             p00.addProteinDomain( z1 );
2494             p00.addProteinDomain( z2 );
2495             p00.addProteinDomain( zz0 );
2496             p00.addProteinDomain( zz1 );
2497             if ( !p00.toDomainArchitectureString( "~", 3, "" ).equals( "a~b~c~d~eee~x~yyy~zzz~Z~Z" ) ) {
2498                 return false;
2499             }
2500             if ( !p00.toDomainArchitectureString( "~", 4, "" ).equals( "a~b~c~d~eee~x~yyy~z~z~z~Z~Z" ) ) {
2501                 return false;
2502             }
2503             if ( !p00.toDomainArchitectureString( "~", 5, "" ).equals( "a~b~c~d~eee~x~y~y~y~y~z~z~z~Z~Z" ) ) {
2504                 return false;
2505             }
2506             if ( !p00.toDomainArchitectureString( "~", 6, "" ).equals( "a~b~c~d~eee~x~y~y~y~y~z~z~z~Z~Z" ) ) {
2507                 return false;
2508             }
2509             if ( !p00.toDomainArchitectureString( "~", 7, "" ).equals( "a~b~c~d~e~e~e~e~e~e~x~y~y~y~y~z~z~z~Z~Z" ) ) {
2510                 return false;
2511             }
2512             // A0  A10  B15  A20  B25  A30  B35  B40  C50  A60  C70  D80
2513             final Domain A0 = new BasicDomain( "A", 0, 25, ( short ) 1, ( short ) 4, 0.1, -12 );
2514             final Domain A10 = new BasicDomain( "A", 10, 11, ( short ) 1, ( short ) 4, 0.1, -12 );
2515             final Domain B15 = new BasicDomain( "B", 11, 16, ( short ) 1, ( short ) 4, 0.1, -12 );
2516             final Domain A20 = new BasicDomain( "A", 20, 100, ( short ) 1, ( short ) 4, 0.1, -12 );
2517             final Domain B25 = new BasicDomain( "B", 25, 26, ( short ) 1, ( short ) 4, 0.1, -12 );
2518             final Domain A30 = new BasicDomain( "A", 30, 31, ( short ) 1, ( short ) 4, 0.1, -12 );
2519             final Domain B35 = new BasicDomain( "B", 31, 40, ( short ) 1, ( short ) 4, 0.1, -12 );
2520             final Domain B40 = new BasicDomain( "B", 40, 600, ( short ) 1, ( short ) 4, 0.1, -12 );
2521             final Domain C50 = new BasicDomain( "C", 50, 59, ( short ) 1, ( short ) 4, 0.1, -12 );
2522             final Domain A60 = new BasicDomain( "A", 60, 395, ( short ) 1, ( short ) 4, 0.1, -12 );
2523             final Domain C70 = new BasicDomain( "C", 70, 71, ( short ) 1, ( short ) 4, 0.1, -12 );
2524             final Domain D80 = new BasicDomain( "D", 80, 81, ( short ) 1, ( short ) 4, 0.1, -12 );
2525             final BasicProtein p = new BasicProtein( "p", "owl", 0 );
2526             p.addProteinDomain( B15 );
2527             p.addProteinDomain( C50 );
2528             p.addProteinDomain( A60 );
2529             p.addProteinDomain( A30 );
2530             p.addProteinDomain( C70 );
2531             p.addProteinDomain( B35 );
2532             p.addProteinDomain( B40 );
2533             p.addProteinDomain( A0 );
2534             p.addProteinDomain( A10 );
2535             p.addProteinDomain( A20 );
2536             p.addProteinDomain( B25 );
2537             p.addProteinDomain( D80 );
2538             List<String> domains_ids = new ArrayList<String>();
2539             domains_ids.add( "A" );
2540             domains_ids.add( "B" );
2541             domains_ids.add( "C" );
2542             if ( !p.contains( domains_ids, false ) ) {
2543                 return false;
2544             }
2545             if ( !p.contains( domains_ids, true ) ) {
2546                 return false;
2547             }
2548             domains_ids.add( "X" );
2549             if ( p.contains( domains_ids, false ) ) {
2550                 return false;
2551             }
2552             if ( p.contains( domains_ids, true ) ) {
2553                 return false;
2554             }
2555             domains_ids = new ArrayList<String>();
2556             domains_ids.add( "A" );
2557             domains_ids.add( "C" );
2558             domains_ids.add( "D" );
2559             if ( !p.contains( domains_ids, false ) ) {
2560                 return false;
2561             }
2562             if ( !p.contains( domains_ids, true ) ) {
2563                 return false;
2564             }
2565             domains_ids = new ArrayList<String>();
2566             domains_ids.add( "A" );
2567             domains_ids.add( "D" );
2568             domains_ids.add( "C" );
2569             if ( !p.contains( domains_ids, false ) ) {
2570                 return false;
2571             }
2572             if ( p.contains( domains_ids, true ) ) {
2573                 return false;
2574             }
2575             domains_ids = new ArrayList<String>();
2576             domains_ids.add( "A" );
2577             domains_ids.add( "A" );
2578             domains_ids.add( "B" );
2579             if ( !p.contains( domains_ids, false ) ) {
2580                 return false;
2581             }
2582             if ( !p.contains( domains_ids, true ) ) {
2583                 return false;
2584             }
2585             domains_ids = new ArrayList<String>();
2586             domains_ids.add( "A" );
2587             domains_ids.add( "A" );
2588             domains_ids.add( "A" );
2589             domains_ids.add( "B" );
2590             domains_ids.add( "B" );
2591             if ( !p.contains( domains_ids, false ) ) {
2592                 return false;
2593             }
2594             if ( !p.contains( domains_ids, true ) ) {
2595                 return false;
2596             }
2597             domains_ids = new ArrayList<String>();
2598             domains_ids.add( "A" );
2599             domains_ids.add( "A" );
2600             domains_ids.add( "B" );
2601             domains_ids.add( "A" );
2602             domains_ids.add( "B" );
2603             domains_ids.add( "B" );
2604             domains_ids.add( "A" );
2605             domains_ids.add( "B" );
2606             domains_ids.add( "C" );
2607             domains_ids.add( "A" );
2608             domains_ids.add( "C" );
2609             domains_ids.add( "D" );
2610             if ( !p.contains( domains_ids, false ) ) {
2611                 return false;
2612             }
2613             if ( p.contains( domains_ids, true ) ) {
2614                 return false;
2615             }
2616         }
2617         catch ( final Exception e ) {
2618             e.printStackTrace( System.out );
2619             return false;
2620         }
2621         return true;
2622     }
2623
2624     private static boolean testBasicTable() {
2625         try {
2626             final BasicTable<String> t0 = new BasicTable<String>();
2627             if ( t0.getNumberOfColumns() != 0 ) {
2628                 return false;
2629             }
2630             if ( t0.getNumberOfRows() != 0 ) {
2631                 return false;
2632             }
2633             t0.setValue( 3, 2, "23" );
2634             t0.setValue( 10, 1, "error" );
2635             t0.setValue( 10, 1, "110" );
2636             t0.setValue( 9, 1, "19" );
2637             t0.setValue( 1, 10, "101" );
2638             t0.setValue( 10, 10, "1010" );
2639             t0.setValue( 100, 10, "10100" );
2640             t0.setValue( 0, 0, "00" );
2641             if ( !t0.getValue( 3, 2 ).equals( "23" ) ) {
2642                 return false;
2643             }
2644             if ( !t0.getValue( 10, 1 ).equals( "110" ) ) {
2645                 return false;
2646             }
2647             if ( !t0.getValueAsString( 1, 10 ).equals( "101" ) ) {
2648                 return false;
2649             }
2650             if ( !t0.getValueAsString( 10, 10 ).equals( "1010" ) ) {
2651                 return false;
2652             }
2653             if ( !t0.getValueAsString( 100, 10 ).equals( "10100" ) ) {
2654                 return false;
2655             }
2656             if ( !t0.getValueAsString( 9, 1 ).equals( "19" ) ) {
2657                 return false;
2658             }
2659             if ( !t0.getValueAsString( 0, 0 ).equals( "00" ) ) {
2660                 return false;
2661             }
2662             if ( t0.getNumberOfColumns() != 101 ) {
2663                 return false;
2664             }
2665             if ( t0.getNumberOfRows() != 11 ) {
2666                 return false;
2667             }
2668             if ( t0.getValueAsString( 49, 4 ) != null ) {
2669                 return false;
2670             }
2671             final String l = ForesterUtil.getLineSeparator();
2672             final StringBuffer source = new StringBuffer();
2673             source.append( "" + l );
2674             source.append( "# 1 1 1 1 1 1 1 1" + l );
2675             source.append( " 00 01 02 03" + l );
2676             source.append( "   10 11 12 13  " + l );
2677             source.append( "20 21 22 23 " + l );
2678             source.append( "    30  31    32 33" + l );
2679             source.append( "40 41 42 43" + l );
2680             source.append( "  # 1 1 1 1 1 " + l );
2681             source.append( "50 51 52 53 54" + l );
2682             final BasicTable<String> t1 = BasicTableParser.parse( source.toString(), ' ' );
2683             if ( t1.getNumberOfColumns() != 5 ) {
2684                 return false;
2685             }
2686             if ( t1.getNumberOfRows() != 6 ) {
2687                 return false;
2688             }
2689             if ( !t1.getValueAsString( 0, 0 ).equals( "00" ) ) {
2690                 return false;
2691             }
2692             if ( !t1.getValueAsString( 1, 0 ).equals( "01" ) ) {
2693                 return false;
2694             }
2695             if ( !t1.getValueAsString( 3, 0 ).equals( "03" ) ) {
2696                 return false;
2697             }
2698             if ( !t1.getValueAsString( 4, 5 ).equals( "54" ) ) {
2699                 return false;
2700             }
2701             final StringBuffer source1 = new StringBuffer();
2702             source1.append( "" + l );
2703             source1.append( "# 1; 1; 1; 1 ;1 ;1; 1 ;1;" + l );
2704             source1.append( " 00; 01 ;02;03" + l );
2705             source1.append( "   10; 11; 12; 13  " + l );
2706             source1.append( "20; 21; 22; 23 " + l );
2707             source1.append( "    30;  31;    32; 33" + l );
2708             source1.append( "40;41;42;43" + l );
2709             source1.append( "  # 1 1 1 1 1 " + l );
2710             source1.append( ";;;50  ;  ;52; 53;;54   " + l );
2711             final BasicTable<String> t2 = BasicTableParser.parse( source1.toString(), ';' );
2712             if ( t2.getNumberOfColumns() != 5 ) {
2713                 return false;
2714             }
2715             if ( t2.getNumberOfRows() != 6 ) {
2716                 return false;
2717             }
2718             if ( !t2.getValueAsString( 0, 0 ).equals( "00" ) ) {
2719                 return false;
2720             }
2721             if ( !t2.getValueAsString( 1, 0 ).equals( "01" ) ) {
2722                 return false;
2723             }
2724             if ( !t2.getValueAsString( 3, 0 ).equals( "03" ) ) {
2725                 return false;
2726             }
2727             if ( !t2.getValueAsString( 3, 3 ).equals( "33" ) ) {
2728                 return false;
2729             }
2730             if ( !t2.getValueAsString( 3, 5 ).equals( "53" ) ) {
2731                 return false;
2732             }
2733             if ( !t2.getValueAsString( 1, 5 ).equals( "" ) ) {
2734                 return false;
2735             }
2736             final StringBuffer source2 = new StringBuffer();
2737             source2.append( "" + l );
2738             source2.append( "comment: 1; 1; 1; 1 ;1 ;1; 1 ;1;" + l );
2739             source2.append( " 00; 01 ;02;03" + l );
2740             source2.append( "   10; 11; 12; 13  " + l );
2741             source2.append( "20; 21; 22; 23 " + l );
2742             source2.append( "                     " + l );
2743             source2.append( "    30;  31;    32; 33" + l );
2744             source2.append( "40;41;42;43" + l );
2745             source2.append( "  comment: 1 1 1 1 1 " + l );
2746             source2.append( ";;;50  ;   52; 53;;54   " + l );
2747             final List<BasicTable<String>> tl = BasicTableParser.parse( source2.toString(),
2748                                                                         ';',
2749                                                                         false,
2750                                                                         false,
2751                                                                         "comment:",
2752                                                                         false );
2753             if ( tl.size() != 2 ) {
2754                 return false;
2755             }
2756             final BasicTable<String> t3 = tl.get( 0 );
2757             final BasicTable<String> t4 = tl.get( 1 );
2758             if ( t3.getNumberOfColumns() != 4 ) {
2759                 return false;
2760             }
2761             if ( t3.getNumberOfRows() != 3 ) {
2762                 return false;
2763             }
2764             if ( t4.getNumberOfColumns() != 4 ) {
2765                 return false;
2766             }
2767             if ( t4.getNumberOfRows() != 3 ) {
2768                 return false;
2769             }
2770             if ( !t3.getValueAsString( 0, 0 ).equals( "00" ) ) {
2771                 return false;
2772             }
2773             if ( !t4.getValueAsString( 0, 0 ).equals( "30" ) ) {
2774                 return false;
2775             }
2776         }
2777         catch ( final Exception e ) {
2778             e.printStackTrace( System.out );
2779             return false;
2780         }
2781         return true;
2782     }
2783
2784     private static boolean testBasicTolXMLparsing() {
2785         try {
2786             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
2787             final TolParser parser = new TolParser();
2788             final Phylogeny[] phylogenies_0 = factory.create( Test.PATH_TO_TEST_DATA + "tol_2484.tol", parser );
2789             if ( parser.getErrorCount() > 0 ) {
2790                 System.out.println( parser.getErrorMessages().toString() );
2791                 return false;
2792             }
2793             if ( phylogenies_0.length != 1 ) {
2794                 return false;
2795             }
2796             final Phylogeny t1 = phylogenies_0[ 0 ];
2797             if ( t1.getNumberOfExternalNodes() != 5 ) {
2798                 return false;
2799             }
2800             if ( !t1.isRooted() ) {
2801                 return false;
2802             }
2803             if ( !t1.getRoot().getNodeData().getTaxonomy().getScientificName().equals( "Mesozoa" ) ) {
2804                 return false;
2805             }
2806             if ( !t1.getRoot().getNodeData().getTaxonomy().getIdentifier().getValue().equals( "2484" ) ) {
2807                 return false;
2808             }
2809             if ( !t1.getRoot().getChildNode( 0 ).getNodeData().getTaxonomy().getScientificName().equals( "Rhombozoa" ) ) {
2810                 return false;
2811             }
2812             if ( t1.getRoot().getChildNode( 0 ).getNumberOfDescendants() != 3 ) {
2813                 return false;
2814             }
2815             final Phylogeny[] phylogenies_1 = factory.create( Test.PATH_TO_TEST_DATA + "tol_2.tol", parser );
2816             if ( parser.getErrorCount() > 0 ) {
2817                 System.out.println( parser.getErrorMessages().toString() );
2818                 return false;
2819             }
2820             if ( phylogenies_1.length != 1 ) {
2821                 return false;
2822             }
2823             final Phylogeny t2 = phylogenies_1[ 0 ];
2824             if ( t2.getNumberOfExternalNodes() != 664 ) {
2825                 return false;
2826             }
2827             if ( !t2.isRooted() ) {
2828                 return false;
2829             }
2830             if ( !t2.getRoot().getNodeData().getTaxonomy().getScientificName().equals( "Eubacteria" ) ) {
2831                 return false;
2832             }
2833             if ( !t2.getRoot().getNodeData().getTaxonomy().getIdentifier().getValue().equals( "2" ) ) {
2834                 return false;
2835             }
2836             if ( t2.getRoot().getNumberOfDescendants() != 24 ) {
2837                 return false;
2838             }
2839             if ( t2.getRoot().getNumberOfDescendants() != 24 ) {
2840                 return false;
2841             }
2842             if ( !t2.getRoot().getChildNode( 0 ).getNodeData().getTaxonomy().getScientificName().equals( "Aquificae" ) ) {
2843                 return false;
2844             }
2845             if ( !t2.getRoot().getChildNode( 0 ).getChildNode( 0 ).getNodeData().getTaxonomy().getScientificName()
2846                     .equals( "Aquifex" ) ) {
2847                 return false;
2848             }
2849             final Phylogeny[] phylogenies_2 = factory.create( Test.PATH_TO_TEST_DATA + "tol_5.tol", parser );
2850             if ( parser.getErrorCount() > 0 ) {
2851                 System.out.println( parser.getErrorMessages().toString() );
2852                 return false;
2853             }
2854             if ( phylogenies_2.length != 1 ) {
2855                 return false;
2856             }
2857             final Phylogeny t3 = phylogenies_2[ 0 ];
2858             if ( t3.getNumberOfExternalNodes() != 184 ) {
2859                 return false;
2860             }
2861             if ( !t3.getRoot().getNodeData().getTaxonomy().getScientificName().equals( "Viruses" ) ) {
2862                 return false;
2863             }
2864             if ( !t3.getRoot().getNodeData().getTaxonomy().getIdentifier().getValue().equals( "5" ) ) {
2865                 return false;
2866             }
2867             if ( t3.getRoot().getNumberOfDescendants() != 6 ) {
2868                 return false;
2869             }
2870             final Phylogeny[] phylogenies_3 = factory.create( Test.PATH_TO_TEST_DATA + "tol_4567.tol", parser );
2871             if ( parser.getErrorCount() > 0 ) {
2872                 System.out.println( parser.getErrorMessages().toString() );
2873                 return false;
2874             }
2875             if ( phylogenies_3.length != 1 ) {
2876                 return false;
2877             }
2878             final Phylogeny t4 = phylogenies_3[ 0 ];
2879             if ( t4.getNumberOfExternalNodes() != 1 ) {
2880                 return false;
2881             }
2882             if ( !t4.getRoot().getNodeData().getTaxonomy().getScientificName().equals( "Marpissa decorata" ) ) {
2883                 return false;
2884             }
2885             if ( !t4.getRoot().getNodeData().getTaxonomy().getIdentifier().getValue().equals( "4567" ) ) {
2886                 return false;
2887             }
2888             if ( t4.getRoot().getNumberOfDescendants() != 0 ) {
2889                 return false;
2890             }
2891             final Phylogeny[] phylogenies_4 = factory.create( Test.PATH_TO_TEST_DATA + "tol_16299.tol", parser );
2892             if ( parser.getErrorCount() > 0 ) {
2893                 System.out.println( parser.getErrorMessages().toString() );
2894                 return false;
2895             }
2896             if ( phylogenies_4.length != 1 ) {
2897                 return false;
2898             }
2899             final Phylogeny t5 = phylogenies_4[ 0 ];
2900             if ( t5.getNumberOfExternalNodes() != 13 ) {
2901                 return false;
2902             }
2903             if ( !t5.getRoot().getNodeData().getTaxonomy().getScientificName().equals( "Hominidae" ) ) {
2904                 return false;
2905             }
2906             if ( !t5.getRoot().getNodeData().getTaxonomy().getIdentifier().getValue().equals( "16299" ) ) {
2907                 return false;
2908             }
2909             if ( t5.getRoot().getNumberOfDescendants() != 2 ) {
2910                 return false;
2911             }
2912         }
2913         catch ( final Exception e ) {
2914             e.printStackTrace( System.out );
2915             return false;
2916         }
2917         return true;
2918     }
2919
2920     private static boolean testBasicTreeMethods() {
2921         try {
2922             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
2923             final Phylogeny t2 = factory.create( "((A:1,B:2)AB:1,(C:3,D:5)CD:3)ABCD:0.5", new NHXParser() )[ 0 ];
2924             if ( t2.getNumberOfExternalNodes() != 4 ) {
2925                 return false;
2926             }
2927             if ( t2.getHeight() != 8.5 ) {
2928                 return false;
2929             }
2930             if ( !t2.isCompletelyBinary() ) {
2931                 return false;
2932             }
2933             if ( t2.isEmpty() ) {
2934                 return false;
2935             }
2936             final Phylogeny t3 = factory.create( "((A:1,B:2,C:10)ABC:1,(D:3,E:5)DE:3)", new NHXParser() )[ 0 ];
2937             if ( t3.getNumberOfExternalNodes() != 5 ) {
2938                 return false;
2939             }
2940             if ( t3.getHeight() != 11 ) {
2941                 return false;
2942             }
2943             if ( t3.isCompletelyBinary() ) {
2944                 return false;
2945             }
2946             final PhylogenyNode n = t3.getNode( "ABC" );
2947             final Phylogeny t4 = factory.create( "((A:1,B:2,C:10)ABC:1,(D:3,E:5)DE:3,(F,G,H,I))", new NHXParser() )[ 0 ];
2948             if ( t4.getNumberOfExternalNodes() != 9 ) {
2949                 return false;
2950             }
2951             if ( t4.getHeight() != 11 ) {
2952                 return false;
2953             }
2954             if ( t4.isCompletelyBinary() ) {
2955                 return false;
2956             }
2957             final StringBuffer sb5 = new StringBuffer( "(((A11:2)A1:2,(A21:1,A22:2,A23)A2:11,A3:2)A:2,B:10,C:3,D:8)" );
2958             final Phylogeny t5 = factory.create( sb5, new NHXParser() )[ 0 ];
2959             if ( t5.getNumberOfExternalNodes() != 8 ) {
2960                 return false;
2961             }
2962             if ( t5.getHeight() != 15 ) {
2963                 return false;
2964             }
2965             final StringBuffer sb6 = new StringBuffer( "(X,Y,Z,(((A111)A11:2)A1:2,(X,Y,Z,A21:1,A22:2,A23)A2:11,A3:2)A:2,B:10,C:3,D:8)" );
2966             final Phylogeny t6 = factory.create( sb6, new NHXParser() )[ 0 ];
2967             if ( t6.getHeight() != 15 ) {
2968                 return false;
2969             }
2970             final StringBuffer sb7 = new StringBuffer( "(((A11:2)A1:2,(A21:1,A22:2,A23)A2:11,A3:2)A:2,B:10,C:15,D:8)" );
2971             final Phylogeny t7 = factory.create( sb7, new NHXParser() )[ 0 ];
2972             if ( t7.getHeight() != 15 ) {
2973                 return false;
2974             }
2975             final StringBuffer sb8 = new StringBuffer( "(((A11:11)A1:2,(A21:2,A22:2,A23,A24,AA:)A2:11,A3:2)A:2,B:15,C:15,D:15)" );
2976             final Phylogeny t8 = factory.create( sb8, new NHXParser() )[ 0 ];
2977             if ( t8.getNumberOfExternalNodes() != 10 ) {
2978                 return false;
2979             }
2980             if ( t8.getHeight() != 15 ) {
2981                 return false;
2982             }
2983             final char[] a9 = new char[] { 'a' };
2984             final Phylogeny t9 = factory.create( a9, new NHXParser() )[ 0 ];
2985             if ( t9.getHeight() != 0 ) {
2986                 return false;
2987             }
2988             final char[] a10 = new char[] { 'a', ':', '6' };
2989             final Phylogeny t10 = factory.create( a10, new NHXParser() )[ 0 ];
2990             if ( t10.getHeight() != 6 ) {
2991                 return false;
2992             }
2993         }
2994         catch ( final Exception e ) {
2995             e.printStackTrace( System.out );
2996             return false;
2997         }
2998         return true;
2999     }
3000
3001     private static boolean testConfidenceAssessor() {
3002         try {
3003             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
3004             final Phylogeny t0 = factory.create( "((((A,B)ab,C)abc,D)abcd,E)abcde", new NHXParser() )[ 0 ];
3005             final Phylogeny[] ev0 = factory
3006                     .create( "((((A,B),C),D),E);((((A,B),C),D),E);((((A,B),C),D),E);((((A,B),C),D),E);",
3007                              new NHXParser() );
3008             ConfidenceAssessor.evaluate( "bootstrap", ev0, t0, false, 1, 0, 2 );
3009             if ( !isEqual( t0.getNode( "ab" ).getBranchData().getConfidence( 0 ).getValue(), 3 ) ) {
3010                 return false;
3011             }
3012             if ( !isEqual( t0.getNode( "abc" ).getBranchData().getConfidence( 0 ).getValue(), 3 ) ) {
3013                 return false;
3014             }
3015             final Phylogeny t1 = factory.create( "((((A,B)ab[&&NHX:B=50],C)abc,D)abcd,E)abcde", new NHXParser() )[ 0 ];
3016             final Phylogeny[] ev1 = factory
3017                     .create( "((((A,B),C),D),E);((A,B),((E,D),C));(((A,B),C),(E,D));(A,(((E,D),C),B));(B,(A,((E,D),C)));(C,((E,D),(A,B)));(D,(E,((A,B),C)));",
3018                              new NHXParser() );
3019             ConfidenceAssessor.evaluate( "bootstrap", ev1, t1, false, 1 );
3020             if ( !isEqual( t1.getNode( "ab" ).getBranchData().getConfidence( 1 ).getValue(), 7 ) ) {
3021                 return false;
3022             }
3023             if ( !isEqual( t1.getNode( "abc" ).getBranchData().getConfidence( 0 ).getValue(), 7 ) ) {
3024                 return false;
3025             }
3026             final Phylogeny t_b = factory.create( "((((A,C)ac,D)acd,E)acde,B)abcde", new NHXParser() )[ 0 ];
3027             final Phylogeny[] ev_b = factory
3028                     .create( "((A,C),X);((A,X),C);(A,C);((((A,B),C),D),E);((A,B),((E,D),C));(((A,B),C),(E,D));(A,(((E,D),C),B));(B,(A,((E,D),C)));(C,((E,D),(A,B)));(D,(E,((A,B),C)));((((A,C)ac,D)acd,E)acde,B)abcd",
3029                              new NHXParser() );
3030             ConfidenceAssessor.evaluate( "bootstrap", ev_b, t_b, false, 1 );
3031             if ( !isEqual( t_b.getNode( "ac" ).getBranchData().getConfidence( 0 ).getValue(), 4 ) ) {
3032                 return false;
3033             }
3034             if ( !isEqual( t_b.getNode( "acd" ).getBranchData().getConfidence( 0 ).getValue(), 1 ) ) {
3035                 return false;
3036             }
3037             //
3038             final Phylogeny t1x = factory.create( "((((A,B)ab,C)abc,D)abcd,E)abcde", new NHXParser() )[ 0 ];
3039             final Phylogeny[] ev1x = factory
3040                     .create( "((((A,B),C),D),E);((A,B),((E,D),C));(((A,B),C),(E,D));(A,(((E,D),C),B));(B,(A,((E,D),C)));(C,((E,D),(A,B)));(D,(E,((A,B),C)));",
3041                              new NHXParser() );
3042             ConfidenceAssessor.evaluate( "bootstrap", ev1x, t1x, true, 1 );
3043             if ( !isEqual( t1x.getNode( "ab" ).getBranchData().getConfidence( 0 ).getValue(), 7 ) ) {
3044                 return false;
3045             }
3046             if ( !isEqual( t1x.getNode( "abc" ).getBranchData().getConfidence( 0 ).getValue(), 7 ) ) {
3047                 return false;
3048             }
3049             final Phylogeny t_bx = factory.create( "((((A,C)ac,D)acd,E)acde,B)abcde", new NHXParser() )[ 0 ];
3050             final Phylogeny[] ev_bx = factory
3051                     .create( "((((A,B),C),D),E);((A,B),((E,D),C));(((A,B),C),(E,D));(A,(((E,D),C),B));(B,(A,((E,D),C)));(C,((E,D),(A,B)));(D,(E,((A,B),C)));((((A,C)ac,D)acd,E)acde,B)abcd",
3052                              new NHXParser() );
3053             ConfidenceAssessor.evaluate( "bootstrap", ev_bx, t_bx, true, 1 );
3054             if ( !isEqual( t_bx.getNode( "ac" ).getBranchData().getConfidence( 0 ).getValue(), 1 ) ) {
3055                 return false;
3056             }
3057             if ( !isEqual( t_bx.getNode( "acd" ).getBranchData().getConfidence( 0 ).getValue(), 1 ) ) {
3058                 return false;
3059             }
3060             final Phylogeny[] t2 = factory
3061                     .create( "((((a,b),c),d),e);(((a,b),c),(d,e));(((((a,b),c),d),e),f);((((a,b),c),(d,e)),f);(((a,b),c),d,e);((a,b,c),d,e);",
3062                              new NHXParser() );
3063             final Phylogeny[] ev2 = factory
3064                     .create( "((((a,b),c),d),e);((((a,b),c),d),e);((((a,b),e),d),c);((((a,b),e),d),c);(((a,b),(c,d)),e);((a,b),x);((a,b),(x,y));(a,b);(a,e);(a,b,c);",
3065                              new NHXParser() );
3066             for( final Phylogeny target : t2 ) {
3067                 ConfidenceAssessor.evaluate( "bootstrap", ev2, target, false, 1 );
3068             }
3069             final Phylogeny t4 = factory.create( "((((((A,B)ab,C)abc,D)abcd,E)abcde,F)abcdef,G)abcdefg",
3070                                                  new NHXParser() )[ 0 ];
3071             final Phylogeny[] ev4 = factory.create( "(((A,B),C),(X,Y));((F,G),((A,B,C),(D,E)))", new NHXParser() );
3072             ConfidenceAssessor.evaluate( "bootstrap", ev4, t4, false, 1 );
3073             if ( !isEqual( t4.getNode( "ab" ).getBranchData().getConfidence( 0 ).getValue(), 1 ) ) {
3074                 return false;
3075             }
3076             if ( !isEqual( t4.getNode( "abc" ).getBranchData().getConfidence( 0 ).getValue(), 2 ) ) {
3077                 return false;
3078             }
3079             if ( !isEqual( t4.getNode( "abcde" ).getBranchData().getConfidence( 0 ).getValue(), 1 ) ) {
3080                 return false;
3081             }
3082         }
3083         catch ( final Exception e ) {
3084             e.printStackTrace();
3085             return false;
3086         }
3087         return true;
3088     }
3089
3090     private static boolean testCopyOfNodeData() {
3091         try {
3092             final PhylogenyNode n1 = PhylogenyNode
3093                     .createInstanceFromNhxString( "n5:0.1[&&NHX:S=Ecoli:E=1.1.1.1:D=Y:Co=Y:B=56:T=1:O=22:SO=33:SN=44:W=2:C=10.20.30:XN=S=tag1=value1=unit1]" );
3094             final PhylogenyNode n2 = n1.copyNodeData();
3095             if ( !n1.toNewHampshireX().equals( n2.toNewHampshireX() ) ) {
3096                 return false;
3097             }
3098         }
3099         catch ( final Exception e ) {
3100             e.printStackTrace();
3101             return false;
3102         }
3103         return true;
3104     }
3105
3106     private static boolean testCreateBalancedPhylogeny() {
3107         try {
3108             final Phylogeny p0 = DevelopmentTools.createBalancedPhylogeny( 6, 5 );
3109             if ( p0.getRoot().getNumberOfDescendants() != 5 ) {
3110                 return false;
3111             }
3112             if ( p0.getNumberOfExternalNodes() != 15625 ) {
3113                 return false;
3114             }
3115             final Phylogeny p1 = DevelopmentTools.createBalancedPhylogeny( 2, 10 );
3116             if ( p1.getRoot().getNumberOfDescendants() != 10 ) {
3117                 return false;
3118             }
3119             if ( p1.getNumberOfExternalNodes() != 100 ) {
3120                 return false;
3121             }
3122         }
3123         catch ( final Exception e ) {
3124             e.printStackTrace();
3125             return false;
3126         }
3127         return true;
3128     }
3129
3130     private static boolean testCreateUriForSeqWeb() {
3131         try {
3132             final PhylogenyNode n = new PhylogenyNode();
3133             n.setName( "tr|B3RJ64" );
3134             if ( !TreePanelUtil.createUriForSeqWeb( n, null, null ).equals( ForesterUtil.UNIPROT_KB + "B3RJ64" ) ) {
3135                 return false;
3136             }
3137             n.setName( "B0LM41_HUMAN" );
3138             if ( !TreePanelUtil.createUriForSeqWeb( n, null, null ).equals( ForesterUtil.UNIPROT_KB + "B0LM41_HUMAN" ) ) {
3139                 return false;
3140             }
3141             n.setName( "NP_001025424" );
3142             if ( !TreePanelUtil.createUriForSeqWeb( n, null, null ).equals( ForesterUtil.NCBI_PROTEIN + "NP_001025424" ) ) {
3143                 return false;
3144             }
3145             n.setName( "_NM_001030253-" );
3146             if ( !TreePanelUtil.createUriForSeqWeb( n, null, null ).equals( ForesterUtil.NCBI_NUCCORE + "NM_001030253" ) ) {
3147                 return false;
3148             }
3149             n.setName( "XM_002122186" );
3150             if ( !TreePanelUtil.createUriForSeqWeb( n, null, null ).equals( ForesterUtil.NCBI_NUCCORE + "XM_002122186" ) ) {
3151                 return false;
3152             }
3153             n.setName( "dgh_AAA34956_gdg" );
3154             if ( !TreePanelUtil.createUriForSeqWeb( n, null, null ).equals( ForesterUtil.NCBI_PROTEIN + "AAA34956" ) ) {
3155                 return false;
3156             }
3157             n.setName( "AAA34956" );
3158             if ( !TreePanelUtil.createUriForSeqWeb( n, null, null ).equals( ForesterUtil.NCBI_PROTEIN + "AAA34956" ) ) {
3159                 return false;
3160             }
3161             n.setName( "GI:394892" );
3162             if ( !TreePanelUtil.createUriForSeqWeb( n, null, null ).equals( ForesterUtil.NCBI_GI + "394892" ) ) {
3163                 System.out.println( TreePanelUtil.createUriForSeqWeb( n, null, null ) );
3164                 return false;
3165             }
3166             n.setName( "gi_394892" );
3167             if ( !TreePanelUtil.createUriForSeqWeb( n, null, null ).equals( ForesterUtil.NCBI_GI + "394892" ) ) {
3168                 System.out.println( TreePanelUtil.createUriForSeqWeb( n, null, null ) );
3169                 return false;
3170             }
3171             n.setName( "gi6335_gi_394892_56635_Gi_43" );
3172             if ( !TreePanelUtil.createUriForSeqWeb( n, null, null ).equals( ForesterUtil.NCBI_GI + "394892" ) ) {
3173                 System.out.println( TreePanelUtil.createUriForSeqWeb( n, null, null ) );
3174                 return false;
3175             }
3176             n.setName( "P12345" );
3177             if ( !TreePanelUtil.createUriForSeqWeb( n, null, null ).equals( ForesterUtil.UNIPROT_KB + "P12345" ) ) {
3178                 System.out.println( TreePanelUtil.createUriForSeqWeb( n, null, null ) );
3179                 return false;
3180             }
3181             n.setName( "gi_fdgjmn-3jk5-243 mnefmn fg023-0 P12345 4395jtmnsrg02345m1ggi92450jrg890j4t0j240" );
3182             if ( !TreePanelUtil.createUriForSeqWeb( n, null, null ).equals( ForesterUtil.UNIPROT_KB + "P12345" ) ) {
3183                 System.out.println( TreePanelUtil.createUriForSeqWeb( n, null, null ) );
3184                 return false;
3185             }
3186         }
3187         catch ( final Exception e ) {
3188             e.printStackTrace( System.out );
3189             return false;
3190         }
3191         return true;
3192     }
3193
3194     private static boolean testDataObjects() {
3195         try {
3196             final Confidence s0 = new Confidence();
3197             final Confidence s1 = new Confidence();
3198             if ( !s0.isEqual( s1 ) ) {
3199                 return false;
3200             }
3201             final Confidence s2 = new Confidence( 0.23, "bootstrap" );
3202             final Confidence s3 = new Confidence( 0.23, "bootstrap" );
3203             if ( s2.isEqual( s1 ) ) {
3204                 return false;
3205             }
3206             if ( !s2.isEqual( s3 ) ) {
3207                 return false;
3208             }
3209             final Confidence s4 = ( Confidence ) s3.copy();
3210             if ( !s4.isEqual( s3 ) ) {
3211                 return false;
3212             }
3213             s3.asSimpleText();
3214             s3.asText();
3215             // Taxonomy
3216             // ----------
3217             final Taxonomy t1 = new Taxonomy();
3218             final Taxonomy t2 = new Taxonomy();
3219             final Taxonomy t3 = new Taxonomy();
3220             final Taxonomy t4 = new Taxonomy();
3221             final Taxonomy t5 = new Taxonomy();
3222             t1.setIdentifier( new Identifier( "ecoli" ) );
3223             t1.setTaxonomyCode( "ECOLI" );
3224             t1.setScientificName( "E. coli" );
3225             t1.setCommonName( "coli" );
3226             final Taxonomy t0 = ( Taxonomy ) t1.copy();
3227             if ( !t1.isEqual( t0 ) ) {
3228                 return false;
3229             }
3230             t2.setIdentifier( new Identifier( "ecoli" ) );
3231             t2.setTaxonomyCode( "OTHER" );
3232             t2.setScientificName( "what" );
3233             t2.setCommonName( "something" );
3234             if ( !t1.isEqual( t2 ) ) {
3235                 return false;
3236             }
3237             t2.setIdentifier( new Identifier( "nemve" ) );
3238             if ( t1.isEqual( t2 ) ) {
3239                 return false;
3240             }
3241             t1.setIdentifier( null );
3242             t3.setTaxonomyCode( "ECOLI" );
3243             t3.setScientificName( "what" );
3244             t3.setCommonName( "something" );
3245             if ( !t1.isEqual( t3 ) ) {
3246                 return false;
3247             }
3248             t1.setIdentifier( null );
3249             t1.setTaxonomyCode( "" );
3250             t4.setScientificName( "E. ColI" );
3251             t4.setCommonName( "something" );
3252             if ( !t1.isEqual( t4 ) ) {
3253                 return false;
3254             }
3255             t4.setScientificName( "B. subtilis" );
3256             t4.setCommonName( "something" );
3257             if ( t1.isEqual( t4 ) ) {
3258                 return false;
3259             }
3260             t1.setIdentifier( null );
3261             t1.setTaxonomyCode( "" );
3262             t1.setScientificName( "" );
3263             t5.setCommonName( "COLI" );
3264             if ( !t1.isEqual( t5 ) ) {
3265                 return false;
3266             }
3267             t5.setCommonName( "vibrio" );
3268             if ( t1.isEqual( t5 ) ) {
3269                 return false;
3270             }
3271             // Identifier
3272             // ----------
3273             final Identifier id0 = new Identifier( "123", "pfam" );
3274             final Identifier id1 = ( Identifier ) id0.copy();
3275             if ( !id1.isEqual( id1 ) ) {
3276                 return false;
3277             }
3278             if ( !id1.isEqual( id0 ) ) {
3279                 return false;
3280             }
3281             if ( !id0.isEqual( id1 ) ) {
3282                 return false;
3283             }
3284             id1.asSimpleText();
3285             id1.asText();
3286             // ProteinDomain
3287             // ---------------
3288             final ProteinDomain pd0 = new ProteinDomain( "abc", 100, 200 );
3289             final ProteinDomain pd1 = ( ProteinDomain ) pd0.copy();
3290             if ( !pd1.isEqual( pd1 ) ) {
3291                 return false;
3292             }
3293             if ( !pd1.isEqual( pd0 ) ) {
3294                 return false;
3295             }
3296             pd1.asSimpleText();
3297             pd1.asText();
3298             final ProteinDomain pd2 = new ProteinDomain( pd0.getName(), pd0.getFrom(), pd0.getTo(), "id" );
3299             final ProteinDomain pd3 = ( ProteinDomain ) pd2.copy();
3300             if ( !pd3.isEqual( pd3 ) ) {
3301                 return false;
3302             }
3303             if ( !pd2.isEqual( pd3 ) ) {
3304                 return false;
3305             }
3306             if ( !pd0.isEqual( pd3 ) ) {
3307                 return false;
3308             }
3309             pd3.asSimpleText();
3310             pd3.asText();
3311             // DomainArchitecture
3312             // ------------------
3313             final ProteinDomain d0 = new ProteinDomain( "domain0", 10, 20 );
3314             final ProteinDomain d1 = new ProteinDomain( "domain1", 30, 40 );
3315             final ProteinDomain d2 = new ProteinDomain( "domain2", 50, 60 );
3316             final ProteinDomain d3 = new ProteinDomain( "domain3", 70, 80 );
3317             final ProteinDomain d4 = new ProteinDomain( "domain4", 90, 100 );
3318             final ArrayList<PhylogenyData> domains0 = new ArrayList<PhylogenyData>();
3319             domains0.add( d2 );
3320             domains0.add( d0 );
3321             domains0.add( d3 );
3322             domains0.add( d1 );
3323             final DomainArchitecture ds0 = new DomainArchitecture( domains0, 110 );
3324             if ( ds0.getNumberOfDomains() != 4 ) {
3325                 return false;
3326             }
3327             final DomainArchitecture ds1 = ( DomainArchitecture ) ds0.copy();
3328             if ( !ds0.isEqual( ds0 ) ) {
3329                 return false;
3330             }
3331             if ( !ds0.isEqual( ds1 ) ) {
3332                 return false;
3333             }
3334             if ( ds1.getNumberOfDomains() != 4 ) {
3335                 return false;
3336             }
3337             final ArrayList<PhylogenyData> domains1 = new ArrayList<PhylogenyData>();
3338             domains1.add( d1 );
3339             domains1.add( d2 );
3340             domains1.add( d4 );
3341             domains1.add( d0 );
3342             final DomainArchitecture ds2 = new DomainArchitecture( domains1, 200 );
3343             if ( ds0.isEqual( ds2 ) ) {
3344                 return false;
3345             }
3346             ds1.asSimpleText();
3347             ds1.asText();
3348             ds1.toNHX();
3349             final DomainArchitecture ds3 = new DomainArchitecture( "120>30>40>0.9>b>50>60>0.4>c>10>20>0.1>a" );
3350             if ( !ds3.toNHX().toString().equals( ":DS=120>10>20>0.1>a>30>40>0.9>b>50>60>0.4>c" ) ) {
3351                 System.out.println( ds3.toNHX() );
3352                 return false;
3353             }
3354             if ( ds3.getNumberOfDomains() != 3 ) {
3355                 return false;
3356             }
3357             // Event
3358             // -----
3359             final Event e1 = new Event( Event.EventType.fusion );
3360             if ( e1.isDuplication() ) {
3361                 return false;
3362             }
3363             if ( !e1.isFusion() ) {
3364                 return false;
3365             }
3366             if ( !e1.asText().toString().equals( "fusion" ) ) {
3367                 return false;
3368             }
3369             if ( !e1.asSimpleText().toString().equals( "fusion" ) ) {
3370                 return false;
3371             }
3372             final Event e11 = new Event( Event.EventType.fusion );
3373             if ( !e11.isEqual( e1 ) ) {
3374                 return false;
3375             }
3376             if ( !e11.toNHX().toString().equals( "" ) ) {
3377                 return false;
3378             }
3379             final Event e2 = new Event( Event.EventType.speciation_or_duplication );
3380             if ( e2.isDuplication() ) {
3381                 return false;
3382             }
3383             if ( !e2.isSpeciationOrDuplication() ) {
3384                 return false;
3385             }
3386             if ( !e2.asText().toString().equals( "speciation_or_duplication" ) ) {
3387                 return false;
3388             }
3389             if ( !e2.asSimpleText().toString().equals( "?" ) ) {
3390                 return false;
3391             }
3392             if ( !e2.toNHX().toString().equals( ":D=?" ) ) {
3393                 return false;
3394             }
3395             if ( e11.isEqual( e2 ) ) {
3396                 return false;
3397             }
3398             final Event e2c = ( Event ) e2.copy();
3399             if ( !e2c.isEqual( e2 ) ) {
3400                 return false;
3401             }
3402             Event e3 = new Event( 1, 2, 3 );
3403             if ( e3.isDuplication() ) {
3404                 return false;
3405             }
3406             if ( e3.isSpeciation() ) {
3407                 return false;
3408             }
3409             if ( e3.isGeneLoss() ) {
3410                 return false;
3411             }
3412             if ( !e3.asText().toString().equals( "duplications [1] speciations [2] gene-losses [3]" ) ) {
3413                 return false;
3414             }
3415             final Event e3c = ( Event ) e3.copy();
3416             final Event e3cc = ( Event ) e3c.copy();
3417             if ( !e3c.asSimpleText().toString().equals( "D2S3L" ) ) {
3418                 return false;
3419             }
3420             e3 = null;
3421             if ( !e3c.isEqual( e3cc ) ) {
3422                 return false;
3423             }
3424             Event e4 = new Event( 1, 2, 3 );
3425             if ( !e4.asText().toString().equals( "duplications [1] speciations [2] gene-losses [3]" ) ) {
3426                 return false;
3427             }
3428             if ( !e4.asSimpleText().toString().equals( "D2S3L" ) ) {
3429                 return false;
3430             }
3431             final Event e4c = ( Event ) e4.copy();
3432             e4 = null;
3433             final Event e4cc = ( Event ) e4c.copy();
3434             if ( !e4cc.asText().toString().equals( "duplications [1] speciations [2] gene-losses [3]" ) ) {
3435                 return false;
3436             }
3437             if ( !e4c.isEqual( e4cc ) ) {
3438                 return false;
3439             }
3440             final Event e5 = new Event();
3441             if ( !e5.isUnassigned() ) {
3442                 return false;
3443             }
3444             if ( !e5.asText().toString().equals( "unassigned" ) ) {
3445                 return false;
3446             }
3447             if ( !e5.asSimpleText().toString().equals( "" ) ) {
3448                 return false;
3449             }
3450             final Event e6 = new Event( 1, 0, 0 );
3451             if ( !e6.asText().toString().equals( "duplication" ) ) {
3452                 return false;
3453             }
3454             if ( !e6.asSimpleText().toString().equals( "D" ) ) {
3455                 return false;
3456             }
3457             final Event e7 = new Event( 0, 1, 0 );
3458             if ( !e7.asText().toString().equals( "speciation" ) ) {
3459                 return false;
3460             }
3461             if ( !e7.asSimpleText().toString().equals( "S" ) ) {
3462                 return false;
3463             }
3464             final Event e8 = new Event( 0, 0, 1 );
3465             if ( !e8.asText().toString().equals( "gene-loss" ) ) {
3466                 return false;
3467             }
3468             if ( !e8.asSimpleText().toString().equals( "L" ) ) {
3469                 return false;
3470             }
3471         }
3472         catch ( final Exception e ) {
3473             e.printStackTrace( System.out );
3474             return false;
3475         }
3476         return true;
3477     }
3478
3479     private static boolean testDeletionOfExternalNodes() {
3480         try {
3481             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
3482             final Phylogeny t0 = factory.create( "A", new NHXParser() )[ 0 ];
3483             final PhylogenyWriter w = new PhylogenyWriter();
3484             if ( t0.isEmpty() ) {
3485                 return false;
3486             }
3487             if ( t0.getNumberOfExternalNodes() != 1 ) {
3488                 return false;
3489             }
3490             t0.deleteSubtree( t0.getNode( "A" ), false );
3491             if ( t0.getNumberOfExternalNodes() != 0 ) {
3492                 return false;
3493             }
3494             if ( !t0.isEmpty() ) {
3495                 return false;
3496             }
3497             final Phylogeny t1 = factory.create( "(A,B)r", new NHXParser() )[ 0 ];
3498             if ( t1.getNumberOfExternalNodes() != 2 ) {
3499                 return false;
3500             }
3501             t1.deleteSubtree( t1.getNode( "A" ), false );
3502             if ( t1.getNumberOfExternalNodes() != 1 ) {
3503                 return false;
3504             }
3505             if ( !t1.getNode( "B" ).getName().equals( "B" ) ) {
3506                 return false;
3507             }
3508             t1.deleteSubtree( t1.getNode( "B" ), false );
3509             if ( t1.getNumberOfExternalNodes() != 1 ) {
3510                 return false;
3511             }
3512             t1.deleteSubtree( t1.getNode( "r" ), false );
3513             if ( !t1.isEmpty() ) {
3514                 return false;
3515             }
3516             final Phylogeny t2 = factory.create( "((A,B),C)", new NHXParser() )[ 0 ];
3517             if ( t2.getNumberOfExternalNodes() != 3 ) {
3518                 return false;
3519             }
3520             t2.deleteSubtree( t2.getNode( "B" ), false );
3521             if ( t2.getNumberOfExternalNodes() != 2 ) {
3522                 return false;
3523             }
3524             t2.toNewHampshireX();
3525             PhylogenyNode n = t2.getNode( "A" );
3526             if ( !n.getNextExternalNode().getName().equals( "C" ) ) {
3527                 return false;
3528             }
3529             t2.deleteSubtree( t2.getNode( "A" ), false );
3530             if ( t2.getNumberOfExternalNodes() != 2 ) {
3531                 return false;
3532             }
3533             t2.deleteSubtree( t2.getNode( "C" ), true );
3534             if ( t2.getNumberOfExternalNodes() != 1 ) {
3535                 return false;
3536             }
3537             final Phylogeny t3 = factory.create( "((A,B),(C,D))", new NHXParser() )[ 0 ];
3538             if ( t3.getNumberOfExternalNodes() != 4 ) {
3539                 return false;
3540             }
3541             t3.deleteSubtree( t3.getNode( "B" ), true );
3542             if ( t3.getNumberOfExternalNodes() != 3 ) {
3543                 return false;
3544             }
3545             n = t3.getNode( "A" );
3546             if ( !n.getNextExternalNode().getName().equals( "C" ) ) {
3547                 return false;
3548             }
3549             n = n.getNextExternalNode();
3550             if ( !n.getNextExternalNode().getName().equals( "D" ) ) {
3551                 return false;
3552             }
3553             t3.deleteSubtree( t3.getNode( "A" ), true );
3554             if ( t3.getNumberOfExternalNodes() != 2 ) {
3555                 return false;
3556             }
3557             n = t3.getNode( "C" );
3558             if ( !n.getNextExternalNode().getName().equals( "D" ) ) {
3559                 return false;
3560             }
3561             t3.deleteSubtree( t3.getNode( "C" ), true );
3562             if ( t3.getNumberOfExternalNodes() != 1 ) {
3563                 return false;
3564             }
3565             t3.deleteSubtree( t3.getNode( "D" ), true );
3566             if ( t3.getNumberOfExternalNodes() != 0 ) {
3567                 return false;
3568             }
3569             final Phylogeny t4 = factory.create( "((A,((B11,B12),B2)),(C,D))", new NHXParser() )[ 0 ];
3570             if ( t4.getNumberOfExternalNodes() != 6 ) {
3571                 return false;
3572             }
3573             t4.deleteSubtree( t4.getNode( "B2" ), true );
3574             if ( t4.getNumberOfExternalNodes() != 5 ) {
3575                 return false;
3576             }
3577             String s = w.toNewHampshire( t4, true ).toString();
3578             if ( !s.equals( "((A,(B11,B12)),(C,D));" ) ) {
3579                 return false;
3580             }
3581             t4.deleteSubtree( t4.getNode( "B11" ), true );
3582             if ( t4.getNumberOfExternalNodes() != 4 ) {
3583                 return false;
3584             }
3585             t4.deleteSubtree( t4.getNode( "C" ), true );
3586             if ( t4.getNumberOfExternalNodes() != 3 ) {
3587                 return false;
3588             }
3589             n = t4.getNode( "A" );
3590             n = n.getNextExternalNode();
3591             if ( !n.getName().equals( "B12" ) ) {
3592                 return false;
3593             }
3594             n = n.getNextExternalNode();
3595             if ( !n.getName().equals( "D" ) ) {
3596                 return false;
3597             }
3598             s = w.toNewHampshire( t4, true ).toString();
3599             if ( !s.equals( "((A,B12),D);" ) ) {
3600                 return false;
3601             }
3602             final Phylogeny t5 = factory.create( "((A,((B11,B12),B2)),(C,D))", new NHXParser() )[ 0 ];
3603             t5.deleteSubtree( t5.getNode( "A" ), true );
3604             if ( t5.getNumberOfExternalNodes() != 5 ) {
3605                 return false;
3606             }
3607             s = w.toNewHampshire( t5, true ).toString();
3608             if ( !s.equals( "(((B11,B12),B2),(C,D));" ) ) {
3609                 return false;
3610             }
3611             final Phylogeny t6 = factory.create( "((A,((B11,B12),B2)),(C,D))", new NHXParser() )[ 0 ];
3612             t6.deleteSubtree( t6.getNode( "B11" ), true );
3613             if ( t6.getNumberOfExternalNodes() != 5 ) {
3614                 return false;
3615             }
3616             s = w.toNewHampshire( t6, false ).toString();
3617             if ( !s.equals( "((A,(B12,B2)),(C,D));" ) ) {
3618                 return false;
3619             }
3620             final Phylogeny t7 = factory.create( "((A,((B11,B12),B2)),(C,D))", new NHXParser() )[ 0 ];
3621             t7.deleteSubtree( t7.getNode( "B12" ), true );
3622             if ( t7.getNumberOfExternalNodes() != 5 ) {
3623                 return false;
3624             }
3625             s = w.toNewHampshire( t7, true ).toString();
3626             if ( !s.equals( "((A,(B11,B2)),(C,D));" ) ) {
3627                 return false;
3628             }
3629             final Phylogeny t8 = factory.create( "((A,((B11,B12),B2)),(C,D))", new NHXParser() )[ 0 ];
3630             t8.deleteSubtree( t8.getNode( "B2" ), true );
3631             if ( t8.getNumberOfExternalNodes() != 5 ) {
3632                 return false;
3633             }
3634             s = w.toNewHampshire( t8, false ).toString();
3635             if ( !s.equals( "((A,(B11,B12)),(C,D));" ) ) {
3636                 return false;
3637             }
3638             final Phylogeny t9 = factory.create( "((A,((B11,B12),B2)),(C,D))", new NHXParser() )[ 0 ];
3639             t9.deleteSubtree( t9.getNode( "C" ), true );
3640             if ( t9.getNumberOfExternalNodes() != 5 ) {
3641                 return false;
3642             }
3643             s = w.toNewHampshire( t9, true ).toString();
3644             if ( !s.equals( "((A,((B11,B12),B2)),D);" ) ) {
3645                 return false;
3646             }
3647             final Phylogeny t10 = factory.create( "((A,((B11,B12),B2)),(C,D))", new NHXParser() )[ 0 ];
3648             t10.deleteSubtree( t10.getNode( "D" ), true );
3649             if ( t10.getNumberOfExternalNodes() != 5 ) {
3650                 return false;
3651             }
3652             s = w.toNewHampshire( t10, true ).toString();
3653             if ( !s.equals( "((A,((B11,B12),B2)),C);" ) ) {
3654                 return false;
3655             }
3656             final Phylogeny t11 = factory.create( "(A,B,C)", new NHXParser() )[ 0 ];
3657             t11.deleteSubtree( t11.getNode( "A" ), true );
3658             if ( t11.getNumberOfExternalNodes() != 2 ) {
3659                 return false;
3660             }
3661             s = w.toNewHampshire( t11, true ).toString();
3662             if ( !s.equals( "(B,C);" ) ) {
3663                 return false;
3664             }
3665             t11.deleteSubtree( t11.getNode( "C" ), true );
3666             if ( t11.getNumberOfExternalNodes() != 1 ) {
3667                 return false;
3668             }
3669             s = w.toNewHampshire( t11, false ).toString();
3670             if ( !s.equals( "B;" ) ) {
3671                 return false;
3672             }
3673             final Phylogeny t12 = factory.create( "((A1,A2,A3),(B1,B2,B3),(C1,C2,C3))", new NHXParser() )[ 0 ];
3674             t12.deleteSubtree( t12.getNode( "B2" ), true );
3675             if ( t12.getNumberOfExternalNodes() != 8 ) {
3676                 return false;
3677             }
3678             s = w.toNewHampshire( t12, true ).toString();
3679             if ( !s.equals( "((A1,A2,A3),(B1,B3),(C1,C2,C3));" ) ) {
3680                 return false;
3681             }
3682             t12.deleteSubtree( t12.getNode( "B3" ), true );
3683             if ( t12.getNumberOfExternalNodes() != 7 ) {
3684                 return false;
3685             }
3686             s = w.toNewHampshire( t12, true ).toString();
3687             if ( !s.equals( "((A1,A2,A3),B1,(C1,C2,C3));" ) ) {
3688                 return false;
3689             }
3690             t12.deleteSubtree( t12.getNode( "C3" ), true );
3691             if ( t12.getNumberOfExternalNodes() != 6 ) {
3692                 return false;
3693             }
3694             s = w.toNewHampshire( t12, true ).toString();
3695             if ( !s.equals( "((A1,A2,A3),B1,(C1,C2));" ) ) {
3696                 return false;
3697             }
3698             t12.deleteSubtree( t12.getNode( "A1" ), true );
3699             if ( t12.getNumberOfExternalNodes() != 5 ) {
3700                 return false;
3701             }
3702             s = w.toNewHampshire( t12, true ).toString();
3703             if ( !s.equals( "((A2,A3),B1,(C1,C2));" ) ) {
3704                 return false;
3705             }
3706             t12.deleteSubtree( t12.getNode( "B1" ), true );
3707             if ( t12.getNumberOfExternalNodes() != 4 ) {
3708                 return false;
3709             }
3710             s = w.toNewHampshire( t12, true ).toString();
3711             if ( !s.equals( "((A2,A3),(C1,C2));" ) ) {
3712                 return false;
3713             }
3714             t12.deleteSubtree( t12.getNode( "A3" ), true );
3715             if ( t12.getNumberOfExternalNodes() != 3 ) {
3716                 return false;
3717             }
3718             s = w.toNewHampshire( t12, true ).toString();
3719             if ( !s.equals( "(A2,(C1,C2));" ) ) {
3720                 return false;
3721             }
3722             t12.deleteSubtree( t12.getNode( "A2" ), true );
3723             if ( t12.getNumberOfExternalNodes() != 2 ) {
3724                 return false;
3725             }
3726             s = w.toNewHampshire( t12, true ).toString();
3727             if ( !s.equals( "(C1,C2);" ) ) {
3728                 return false;
3729             }
3730             final Phylogeny t13 = factory.create( "(A,B,C,(D:1.0,E:2.0):3.0)", new NHXParser() )[ 0 ];
3731             t13.deleteSubtree( t13.getNode( "D" ), true );
3732             if ( t13.getNumberOfExternalNodes() != 4 ) {
3733                 return false;
3734             }
3735             s = w.toNewHampshire( t13, true ).toString();
3736             if ( !s.equals( "(A,B,C,E:5.0);" ) ) {
3737                 return false;
3738             }
3739             final Phylogeny t14 = factory.create( "((A,B,C,(D:0.1,E:0.4):1.0),F)", new NHXParser() )[ 0 ];
3740             t14.deleteSubtree( t14.getNode( "E" ), true );
3741             if ( t14.getNumberOfExternalNodes() != 5 ) {
3742                 return false;
3743             }
3744             s = w.toNewHampshire( t14, true ).toString();
3745             if ( !s.equals( "((A,B,C,D:1.1),F);" ) ) {
3746                 return false;
3747             }
3748             final Phylogeny t15 = factory.create( "((A1,A2,A3,A4),(B1,B2,B3,B4),(C1,C2,C3,C4))", new NHXParser() )[ 0 ];
3749             t15.deleteSubtree( t15.getNode( "B2" ), true );
3750             if ( t15.getNumberOfExternalNodes() != 11 ) {
3751                 return false;
3752             }
3753             t15.deleteSubtree( t15.getNode( "B1" ), true );
3754             if ( t15.getNumberOfExternalNodes() != 10 ) {
3755                 return false;
3756             }
3757             t15.deleteSubtree( t15.getNode( "B3" ), true );
3758             if ( t15.getNumberOfExternalNodes() != 9 ) {
3759                 return false;
3760             }
3761             t15.deleteSubtree( t15.getNode( "B4" ), true );
3762             if ( t15.getNumberOfExternalNodes() != 8 ) {
3763                 return false;
3764             }
3765             t15.deleteSubtree( t15.getNode( "A1" ), true );
3766             if ( t15.getNumberOfExternalNodes() != 7 ) {
3767                 return false;
3768             }
3769             t15.deleteSubtree( t15.getNode( "C4" ), true );
3770             if ( t15.getNumberOfExternalNodes() != 6 ) {
3771                 return false;
3772             }
3773         }
3774         catch ( final Exception e ) {
3775             e.printStackTrace( System.out );
3776             return false;
3777         }
3778         return true;
3779     }
3780
3781     private static boolean testDescriptiveStatistics() {
3782         try {
3783             final DescriptiveStatistics dss1 = new BasicDescriptiveStatistics();
3784             dss1.addValue( 82 );
3785             dss1.addValue( 78 );
3786             dss1.addValue( 70 );
3787             dss1.addValue( 58 );
3788             dss1.addValue( 42 );
3789             if ( dss1.getN() != 5 ) {
3790                 return false;
3791             }
3792             if ( !Test.isEqual( dss1.getMin(), 42 ) ) {
3793                 return false;
3794             }
3795             if ( !Test.isEqual( dss1.getMax(), 82 ) ) {
3796                 return false;
3797             }
3798             if ( !Test.isEqual( dss1.arithmeticMean(), 66 ) ) {
3799                 return false;
3800             }
3801             if ( !Test.isEqual( dss1.sampleStandardDeviation(), 16.24807680927192 ) ) {
3802                 return false;
3803             }
3804             if ( !Test.isEqual( dss1.median(), 70 ) ) {
3805                 return false;
3806             }
3807             if ( !Test.isEqual( dss1.midrange(), 62 ) ) {
3808                 return false;
3809             }
3810             if ( !Test.isEqual( dss1.sampleVariance(), 264 ) ) {
3811                 return false;
3812             }
3813             if ( !Test.isEqual( dss1.pearsonianSkewness(), -0.7385489458759964 ) ) {
3814                 return false;
3815             }
3816             if ( !Test.isEqual( dss1.coefficientOfVariation(), 0.24618298195866547 ) ) {
3817                 return false;
3818             }
3819             if ( !Test.isEqual( dss1.sampleStandardUnit( 66 - 16.24807680927192 ), -1.0 ) ) {
3820                 return false;
3821             }
3822             if ( !Test.isEqual( dss1.getValue( 1 ), 78 ) ) {
3823                 return false;
3824             }
3825             dss1.addValue( 123 );
3826             if ( !Test.isEqual( dss1.arithmeticMean(), 75.5 ) ) {
3827                 return false;
3828             }
3829             if ( !Test.isEqual( dss1.getMax(), 123 ) ) {
3830                 return false;
3831             }
3832             if ( !Test.isEqual( dss1.standardErrorOfMean(), 11.200446419674531 ) ) {
3833                 return false;
3834             }
3835             final DescriptiveStatistics dss2 = new BasicDescriptiveStatistics();
3836             dss2.addValue( -1.85 );
3837             dss2.addValue( 57.5 );
3838             dss2.addValue( 92.78 );
3839             dss2.addValue( 57.78 );
3840             if ( !Test.isEqual( dss2.median(), 57.64 ) ) {
3841                 return false;
3842             }
3843             if ( !Test.isEqual( dss2.sampleStandardDeviation(), 39.266984753946495 ) ) {
3844                 return false;
3845             }
3846             final double[] a = dss2.getDataAsDoubleArray();
3847             if ( !Test.isEqual( a[ 3 ], 57.78 ) ) {
3848                 return false;
3849             }
3850             dss2.addValue( -100 );
3851             if ( !Test.isEqual( dss2.sampleStandardDeviation(), 75.829111296388 ) ) {
3852                 return false;
3853             }
3854             if ( !Test.isEqual( dss2.sampleVariance(), 5750.05412 ) ) {
3855                 return false;
3856             }
3857             final double[] ds = new double[ 14 ];
3858             ds[ 0 ] = 34;
3859             ds[ 1 ] = 23;
3860             ds[ 2 ] = 1;
3861             ds[ 3 ] = 32;
3862             ds[ 4 ] = 11;
3863             ds[ 5 ] = 2;
3864             ds[ 6 ] = 12;
3865             ds[ 7 ] = 33;
3866             ds[ 8 ] = 13;
3867             ds[ 9 ] = 22;
3868             ds[ 10 ] = 21;
3869             ds[ 11 ] = 35;
3870             ds[ 12 ] = 24;
3871             ds[ 13 ] = 31;
3872             final int[] bins = BasicDescriptiveStatistics.performBinning( ds, 0, 40, 4 );
3873             if ( bins.length != 4 ) {
3874                 return false;
3875             }
3876             if ( bins[ 0 ] != 2 ) {
3877                 return false;
3878             }
3879             if ( bins[ 1 ] != 3 ) {
3880                 return false;
3881             }
3882             if ( bins[ 2 ] != 4 ) {
3883                 return false;
3884             }
3885             if ( bins[ 3 ] != 5 ) {
3886                 return false;
3887             }
3888             final double[] ds1 = new double[ 9 ];
3889             ds1[ 0 ] = 10.0;
3890             ds1[ 1 ] = 19.0;
3891             ds1[ 2 ] = 9.999;
3892             ds1[ 3 ] = 0.0;
3893             ds1[ 4 ] = 39.9;
3894             ds1[ 5 ] = 39.999;
3895             ds1[ 6 ] = 30.0;
3896             ds1[ 7 ] = 19.999;
3897             ds1[ 8 ] = 30.1;
3898             final int[] bins1 = BasicDescriptiveStatistics.performBinning( ds1, 0, 40, 4 );
3899             if ( bins1.length != 4 ) {
3900                 return false;
3901             }
3902             if ( bins1[ 0 ] != 2 ) {
3903                 return false;
3904             }
3905             if ( bins1[ 1 ] != 3 ) {
3906                 return false;
3907             }
3908             if ( bins1[ 2 ] != 0 ) {
3909                 return false;
3910             }
3911             if ( bins1[ 3 ] != 4 ) {
3912                 return false;
3913             }
3914             final int[] bins1_1 = BasicDescriptiveStatistics.performBinning( ds1, 0, 40, 3 );
3915             if ( bins1_1.length != 3 ) {
3916                 return false;
3917             }
3918             if ( bins1_1[ 0 ] != 3 ) {
3919                 return false;
3920             }
3921             if ( bins1_1[ 1 ] != 2 ) {
3922                 return false;
3923             }
3924             if ( bins1_1[ 2 ] != 4 ) {
3925                 return false;
3926             }
3927             final int[] bins1_2 = BasicDescriptiveStatistics.performBinning( ds1, 1, 39, 3 );
3928             if ( bins1_2.length != 3 ) {
3929                 return false;
3930             }
3931             if ( bins1_2[ 0 ] != 2 ) {
3932                 return false;
3933             }
3934             if ( bins1_2[ 1 ] != 2 ) {
3935                 return false;
3936             }
3937             if ( bins1_2[ 2 ] != 2 ) {
3938                 return false;
3939             }
3940             final DescriptiveStatistics dss3 = new BasicDescriptiveStatistics();
3941             dss3.addValue( 1 );
3942             dss3.addValue( 1 );
3943             dss3.addValue( 1 );
3944             dss3.addValue( 2 );
3945             dss3.addValue( 3 );
3946             dss3.addValue( 4 );
3947             dss3.addValue( 5 );
3948             dss3.addValue( 5 );
3949             dss3.addValue( 5 );
3950             dss3.addValue( 6 );
3951             dss3.addValue( 7 );
3952             dss3.addValue( 8 );
3953             dss3.addValue( 9 );
3954             dss3.addValue( 10 );
3955             dss3.addValue( 10 );
3956             dss3.addValue( 10 );
3957             final AsciiHistogram histo = new AsciiHistogram( dss3 );
3958             histo.toStringBuffer( 10, '=', 40, 5 );
3959             histo.toStringBuffer( 3, 8, 10, '=', 40, 5, null );
3960         }
3961         catch ( final Exception e ) {
3962             e.printStackTrace( System.out );
3963             return false;
3964         }
3965         return true;
3966     }
3967
3968     private static boolean testDir( final String file ) {
3969         try {
3970             final File f = new File( file );
3971             if ( !f.exists() ) {
3972                 return false;
3973             }
3974             if ( !f.isDirectory() ) {
3975                 return false;
3976             }
3977             if ( !f.canRead() ) {
3978                 return false;
3979             }
3980         }
3981         catch ( final Exception e ) {
3982             return false;
3983         }
3984         return true;
3985     }
3986
3987     private static boolean testEbiEntryRetrieval() {
3988         try {
3989             final SequenceDatabaseEntry entry = SequenceDbWsTools.obtainEntry( "AAK41263" );
3990             if ( !entry.getAccession().equals( "AAK41263" ) ) {
3991                 System.out.println( entry.getAccession() );
3992                 return false;
3993             }
3994             if ( !entry.getTaxonomyScientificName().equals( "Sulfolobus solfataricus P2" ) ) {
3995                 System.out.println( entry.getTaxonomyScientificName() );
3996                 return false;
3997             }
3998             if ( !entry.getSequenceName()
3999                     .equals( "Sulfolobus solfataricus P2 Glycogen debranching enzyme, hypothetical (treX-like)" ) ) {
4000                 System.out.println( entry.getSequenceName() );
4001                 return false;
4002             }
4003             if ( !entry.getGeneName().equals( "treX-like" ) ) {
4004                 System.out.println( entry.getGeneName() );
4005                 return false;
4006             }
4007             if ( !entry.getTaxonomyIdentifier().equals( "273057" ) ) {
4008                 System.out.println( entry.getTaxonomyIdentifier() );
4009                 return false;
4010             }
4011             if ( !entry.getAnnotations().first().getRefValue().equals( "3.2.1.33" ) ) {
4012                 System.out.println( entry.getAnnotations().first().getRefValue() );
4013                 return false;
4014             }
4015             if ( !entry.getAnnotations().first().getRefSource().equals( "EC" ) ) {
4016                 System.out.println( entry.getAnnotations().first().getRefSource() );
4017                 return false;
4018             }
4019             if ( entry.getCrossReferences().size() != 5 ) {
4020                 return false;
4021             }
4022             final SequenceDatabaseEntry entry1 = SequenceDbWsTools.obtainEntry( "ABJ16409" );
4023             if ( !entry1.getAccession().equals( "ABJ16409" ) ) {
4024                 return false;
4025             }
4026             if ( !entry1.getTaxonomyScientificName().equals( "Felis catus" ) ) {
4027                 System.out.println( entry1.getTaxonomyScientificName() );
4028                 return false;
4029             }
4030             if ( !entry1.getSequenceName().equals( "Felis catus (domestic cat) partial BCL2" ) ) {
4031                 System.out.println( entry1.getSequenceName() );
4032                 return false;
4033             }
4034             if ( !entry1.getTaxonomyIdentifier().equals( "9685" ) ) {
4035                 System.out.println( entry1.getTaxonomyIdentifier() );
4036                 return false;
4037             }
4038             if ( !entry1.getGeneName().equals( "BCL2" ) ) {
4039                 System.out.println( entry1.getGeneName() );
4040                 return false;
4041             }
4042             if ( entry1.getCrossReferences().size() != 6 ) {
4043                 return false;
4044             }
4045             final SequenceDatabaseEntry entry2 = SequenceDbWsTools.obtainEntry( "NM_184234" );
4046             if ( !entry2.getAccession().equals( "NM_184234" ) ) {
4047                 return false;
4048             }
4049             if ( !entry2.getTaxonomyScientificName().equals( "Homo sapiens" ) ) {
4050                 System.out.println( entry2.getTaxonomyScientificName() );
4051                 return false;
4052             }
4053             if ( !entry2.getSequenceName()
4054                     .equals( "Homo sapiens RNA binding motif protein 39 (RBM39), transcript variant 1, mRNA" ) ) {
4055                 System.out.println( entry2.getSequenceName() );
4056                 return false;
4057             }
4058             if ( !entry2.getTaxonomyIdentifier().equals( "9606" ) ) {
4059                 System.out.println( entry2.getTaxonomyIdentifier() );
4060                 return false;
4061             }
4062             if ( !entry2.getGeneName().equals( "RBM39" ) ) {
4063                 System.out.println( entry2.getGeneName() );
4064                 return false;
4065             }
4066             if ( entry2.getCrossReferences().size() != 3 ) {
4067                 return false;
4068             }
4069             //
4070             final SequenceDatabaseEntry entry3 = SequenceDbWsTools.obtainEntry( "HM043801" );
4071             if ( !entry3.getAccession().equals( "HM043801" ) ) {
4072                 return false;
4073             }
4074             if ( !entry3.getTaxonomyScientificName().equals( "Bursaphelenchus xylophilus" ) ) {
4075                 System.out.println( entry3.getTaxonomyScientificName() );
4076                 return false;
4077             }
4078             if ( !entry3.getSequenceName().equals( "Bursaphelenchus xylophilus RAF gene, complete cds" ) ) {
4079                 System.out.println( entry3.getSequenceName() );
4080                 return false;
4081             }
4082             if ( !entry3.getTaxonomyIdentifier().equals( "6326" ) ) {
4083                 System.out.println( entry3.getTaxonomyIdentifier() );
4084                 return false;
4085             }
4086             if ( !entry3.getSequenceSymbol().equals( "RAF" ) ) {
4087                 System.out.println( entry3.getSequenceSymbol() );
4088                 return false;
4089             }
4090             if ( !ForesterUtil.isEmpty( entry3.getGeneName() ) ) {
4091                 return false;
4092             }
4093             if ( entry3.getCrossReferences().size() < 7 ) {
4094                 return false;
4095             }
4096             final SequenceDatabaseEntry entry4 = SequenceDbWsTools.obtainEntry( "AAA36557.1" );
4097             if ( !entry4.getAccession().equals( "AAA36557" ) ) {
4098                 return false;
4099             }
4100             if ( !entry4.getTaxonomyScientificName().equals( "Homo sapiens" ) ) {
4101                 System.out.println( entry4.getTaxonomyScientificName() );
4102                 return false;
4103             }
4104             if ( !entry4.getSequenceName().equals( "Homo sapiens (human) ras protein" ) ) {
4105                 System.out.println( entry4.getSequenceName() );
4106                 return false;
4107             }
4108             if ( !entry4.getTaxonomyIdentifier().equals( "9606" ) ) {
4109                 System.out.println( entry4.getTaxonomyIdentifier() );
4110                 return false;
4111             }
4112             if ( !entry4.getGeneName().equals( "ras" ) ) {
4113                 System.out.println( entry4.getGeneName() );
4114                 return false;
4115             }
4116             //   if ( !entry4.getChromosome().equals( "ras" ) ) {
4117             //     System.out.println( entry4.getChromosome() );
4118             //     return false;
4119             // }
4120             // if ( !entry4.getMap().equals( "ras" ) ) {
4121             //     System.out.println( entry4.getMap() );
4122             //     return false;
4123             // }
4124             //TODO FIXME gi...
4125             //
4126             //TODO fails:
4127             //            final SequenceDatabaseEntry entry5 = SequenceDbWsTools.obtainEntry( "M30539" );
4128             //            if ( !entry5.getAccession().equals( "HM043801" ) ) {
4129             //                return false;
4130             //            }
4131             final SequenceDatabaseEntry entry5 = SequenceDbWsTools.obtainEntry( "AAZ45343.1" );
4132             if ( !entry5.getAccession().equals( "AAZ45343" ) ) {
4133                 return false;
4134             }
4135             if ( !entry5.getTaxonomyScientificName().equals( "Dechloromonas aromatica RCB" ) ) {
4136                 System.out.println( entry5.getTaxonomyScientificName() );
4137                 return false;
4138             }
4139             if ( !entry5.getSequenceName().equals( "Dechloromonas aromatica RCB 1,4-alpha-glucan branching enzyme" ) ) {
4140                 System.out.println( entry5.getSequenceName() );
4141                 return false;
4142             }
4143             if ( !entry5.getTaxonomyIdentifier().equals( "159087" ) ) {
4144                 System.out.println( entry5.getTaxonomyIdentifier() );
4145                 return false;
4146             }
4147         }
4148         catch ( final IOException e ) {
4149             System.out.println();
4150             System.out.println( "the following might be due to absence internet connection:" );
4151             e.printStackTrace( System.out );
4152             return true;
4153         }
4154         catch ( final Exception e ) {
4155             e.printStackTrace();
4156             return false;
4157         }
4158         return true;
4159     }
4160
4161     private static boolean testExternalNodeRelatedMethods() {
4162         try {
4163             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
4164             final Phylogeny t1 = factory.create( "((A,B),(C,D))", new NHXParser() )[ 0 ];
4165             PhylogenyNode n = t1.getNode( "A" );
4166             n = n.getNextExternalNode();
4167             if ( !n.getName().equals( "B" ) ) {
4168                 return false;
4169             }
4170             n = n.getNextExternalNode();
4171             if ( !n.getName().equals( "C" ) ) {
4172                 return false;
4173             }
4174             n = n.getNextExternalNode();
4175             if ( !n.getName().equals( "D" ) ) {
4176                 return false;
4177             }
4178             n = t1.getNode( "B" );
4179             while ( !n.isLastExternalNode() ) {
4180                 n = n.getNextExternalNode();
4181             }
4182             final Phylogeny t2 = factory.create( "(((A,B),C),D)", new NHXParser() )[ 0 ];
4183             n = t2.getNode( "A" );
4184             n = n.getNextExternalNode();
4185             if ( !n.getName().equals( "B" ) ) {
4186                 return false;
4187             }
4188             n = n.getNextExternalNode();
4189             if ( !n.getName().equals( "C" ) ) {
4190                 return false;
4191             }
4192             n = n.getNextExternalNode();
4193             if ( !n.getName().equals( "D" ) ) {
4194                 return false;
4195             }
4196             n = t2.getNode( "B" );
4197             while ( !n.isLastExternalNode() ) {
4198                 n = n.getNextExternalNode();
4199             }
4200             final Phylogeny t3 = factory.create( "(((A,B),(C,D)),((E,F),(G,H)))", new NHXParser() )[ 0 ];
4201             n = t3.getNode( "A" );
4202             n = n.getNextExternalNode();
4203             if ( !n.getName().equals( "B" ) ) {
4204                 return false;
4205             }
4206             n = n.getNextExternalNode();
4207             if ( !n.getName().equals( "C" ) ) {
4208                 return false;
4209             }
4210             n = n.getNextExternalNode();
4211             if ( !n.getName().equals( "D" ) ) {
4212                 return false;
4213             }
4214             n = n.getNextExternalNode();
4215             if ( !n.getName().equals( "E" ) ) {
4216                 return false;
4217             }
4218             n = n.getNextExternalNode();
4219             if ( !n.getName().equals( "F" ) ) {
4220                 return false;
4221             }
4222             n = n.getNextExternalNode();
4223             if ( !n.getName().equals( "G" ) ) {
4224                 return false;
4225             }
4226             n = n.getNextExternalNode();
4227             if ( !n.getName().equals( "H" ) ) {
4228                 return false;
4229             }
4230             n = t3.getNode( "B" );
4231             while ( !n.isLastExternalNode() ) {
4232                 n = n.getNextExternalNode();
4233             }
4234             final Phylogeny t4 = factory.create( "((A,B),(C,D))", new NHXParser() )[ 0 ];
4235             for( final PhylogenyNodeIterator iter = t4.iteratorExternalForward(); iter.hasNext(); ) {
4236                 final PhylogenyNode node = iter.next();
4237             }
4238             final Phylogeny t5 = factory.create( "(((A,B),(C,D)),((E,F),(G,H)))", new NHXParser() )[ 0 ];
4239             for( final PhylogenyNodeIterator iter = t5.iteratorExternalForward(); iter.hasNext(); ) {
4240                 final PhylogenyNode node = iter.next();
4241             }
4242             final Phylogeny t6 = factory.create( "((((((A))),(((B))),((C)),((((D)))),E)),((F)))", new NHXParser() )[ 0 ];
4243             final PhylogenyNodeIterator iter = t6.iteratorExternalForward();
4244             if ( !iter.next().getName().equals( "A" ) ) {
4245                 return false;
4246             }
4247             if ( !iter.next().getName().equals( "B" ) ) {
4248                 return false;
4249             }
4250             if ( !iter.next().getName().equals( "C" ) ) {
4251                 return false;
4252             }
4253             if ( !iter.next().getName().equals( "D" ) ) {
4254                 return false;
4255             }
4256             if ( !iter.next().getName().equals( "E" ) ) {
4257                 return false;
4258             }
4259             if ( !iter.next().getName().equals( "F" ) ) {
4260                 return false;
4261             }
4262             if ( iter.hasNext() ) {
4263                 return false;
4264             }
4265         }
4266         catch ( final Exception e ) {
4267             e.printStackTrace( System.out );
4268             return false;
4269         }
4270         return true;
4271     }
4272
4273     private static boolean testExtractSNFromNodeName() {
4274         try {
4275             if ( !ParserUtils.extractScientificNameFromNodeName( "BCDO2_Mus_musculus" ).equals( "Mus musculus" ) ) {
4276                 return false;
4277             }
4278             if ( !ParserUtils.extractScientificNameFromNodeName( "BCDO2 Mus musculus" ).equals( "Mus musculus" ) ) {
4279                 return false;
4280             }
4281             if ( !ParserUtils.extractScientificNameFromNodeName( "Mus_musculus_BCDO2" ).equals( "Mus musculus" ) ) {
4282                 return false;
4283             }
4284             if ( !ParserUtils.extractScientificNameFromNodeName( "Mus musculus musculus BCDO2" )
4285                     .equals( "Mus musculus musculus" ) ) {
4286                 return false;
4287             }
4288             if ( !ParserUtils.extractScientificNameFromNodeName( "Mus_musculus_musculus_BCDO2" )
4289                     .equals( "Mus musculus musculus" ) ) {
4290                 return false;
4291             }
4292             if ( !ParserUtils.extractScientificNameFromNodeName( "BCDO2 Mus musculus musculus" )
4293                     .equals( "Mus musculus musculus" ) ) {
4294                 return false;
4295             }
4296             if ( !ParserUtils.extractScientificNameFromNodeName( "Bcl Mus musculus musculus" )
4297                     .equals( "Mus musculus musculus" ) ) {
4298                 return false;
4299             }
4300             if ( ParserUtils.extractScientificNameFromNodeName( "vcl Mus musculus musculus" ) != null ) {
4301                 return false;
4302             }
4303             if ( !ParserUtils.extractScientificNameFromNodeName( "could_be_anything_Mus_musculus_musculus_BCDO2" )
4304                     .equals( "Mus musculus musculus" ) ) {
4305                 return false;
4306             }
4307             if ( !ParserUtils.extractScientificNameFromNodeName( "could_be_anything_Mus_musculus_musculus_Musculus" )
4308                     .equals( "Mus musculus musculus" ) ) {
4309                 return false;
4310             }
4311             if ( ParserUtils.extractScientificNameFromNodeName( "could_be_anything_Mus_musculus_musculus_musculus" ) != null ) {
4312                 return false;
4313             }
4314             if ( ParserUtils.extractScientificNameFromNodeName( "musculus" ) != null ) {
4315                 return false;
4316             }
4317             if ( ParserUtils.extractScientificNameFromNodeName( "mus_musculus" ) != null ) {
4318                 return false;
4319             }
4320             if ( ParserUtils.extractScientificNameFromNodeName( "mus_musculus_musculus" ) != null ) {
4321                 return false;
4322             }
4323             if ( !ParserUtils.extractScientificNameFromNodeName( "Mus_musculus_musculus_1" )
4324                     .equals( "Mus musculus musculus" ) ) {
4325                 return false;
4326             }
4327             if ( !ParserUtils.extractScientificNameFromNodeName( "Mus_musculus_1" ).equals( "Mus musculus" ) ) {
4328                 return false;
4329             }
4330             if ( ParserUtils.extractScientificNameFromNodeName( "Mus_musculus_bcl" ) != null ) {
4331                 return false;
4332             }
4333             if ( !ParserUtils.extractScientificNameFromNodeName( "Mus_musculus_BCL" ).equals( "Mus musculus" ) ) {
4334                 return false;
4335             }
4336             if ( ParserUtils.extractScientificNameFromNodeName( "Mus musculus bcl" ) != null ) {
4337                 return false;
4338             }
4339             if ( !ParserUtils.extractScientificNameFromNodeName( "Mus musculus BCL" ).equals( "Mus musculus" ) ) {
4340                 return false;
4341             }
4342             if ( !ParserUtils.extractScientificNameFromNodeName( "Mus musculus xBCL" ).equals( "Mus musculus" ) ) {
4343                 return false;
4344             }
4345             if ( !ParserUtils.extractScientificNameFromNodeName( "Mus musculus x1" ).equals( "Mus musculus" ) ) {
4346                 return false;
4347             }
4348             if ( !ParserUtils.extractScientificNameFromNodeName( " -XS12_Mus_musculus_12" ).equals( "Mus musculus" ) ) {
4349                 return false;
4350             }
4351             if ( !ParserUtils.extractScientificNameFromNodeName( " -1234_Mus_musculus_12 affrre e" )
4352                     .equals( "Mus musculus" ) ) {
4353                 return false;
4354             }
4355             if ( !ParserUtils.extractScientificNameFromNodeName( " -1234_Mus_musculus_12_affrre_e" )
4356                     .equals( "Mus musculus" ) ) {
4357                 return false;
4358             }
4359             if ( !ParserUtils.extractScientificNameFromNodeName( "Mus_musculus" ).equals( "Mus musculus" ) ) {
4360                 return false;
4361             }
4362             if ( !ParserUtils.extractScientificNameFromNodeName( "Mus_musculus_musculus_2bcl2" )
4363                     .equals( "Mus musculus musculus" ) ) {
4364                 return false;
4365             }
4366             if ( !ParserUtils.extractScientificNameFromNodeName( "Mus_musculus_musculus_2bcl2" )
4367                     .equals( "Mus musculus musculus" ) ) {
4368                 return false;
4369             }
4370             if ( !ParserUtils.extractScientificNameFromNodeName( "Mus_musculus_musculus_bcl2" )
4371                     .equals( "Mus musculus musculus" ) ) {
4372                 return false;
4373             }
4374             if ( !ParserUtils.extractScientificNameFromNodeName( "Mus_musculus_123" ).equals( "Mus musculus" ) ) {
4375                 return false;
4376             }
4377             if ( !ParserUtils.extractScientificNameFromNodeName( "Pilostyles mexicana Mexico Breedlove 27233" )
4378                     .equals( "Pilostyles mexicana" ) ) {
4379                 return false;
4380             }
4381             if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia_coli_strain_K12/DH10B" )
4382                     .equals( "Escherichia coli strain K12/DH10B" ) ) {
4383                 return false;
4384             }
4385             if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia_coli_str_K12/DH10B" )
4386                     .equals( "Escherichia coli str. K12/DH10B" ) ) {
4387                 return false;
4388             }
4389             if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia coli str. K12/DH10B" )
4390                     .equals( "Escherichia coli str. K12/DH10B" ) ) {
4391                 return false;
4392             }
4393             if ( !ParserUtils.extractScientificNameFromNodeName( "Arabidopsis_lyrata_subsp_lyrata" )
4394                     .equals( "Arabidopsis lyrata subsp. lyrata" ) ) {
4395                 return false;
4396             }
4397             if ( !ParserUtils.extractScientificNameFromNodeName( "Arabidopsis lyrata subsp. lyrata" )
4398                     .equals( "Arabidopsis lyrata subsp. lyrata" ) ) {
4399                 return false;
4400             }
4401             if ( !ParserUtils.extractScientificNameFromNodeName( "Arabidopsis lyrata subsp. lyrata 395" )
4402                     .equals( "Arabidopsis lyrata subsp. lyrata" ) ) {
4403                 return false;
4404             }
4405             if ( !ParserUtils.extractScientificNameFromNodeName( "Arabidopsis lyrata subsp. lyrata bcl2" )
4406                     .equals( "Arabidopsis lyrata subsp. lyrata" ) ) {
4407                 return false;
4408             }
4409             if ( !ParserUtils.extractScientificNameFromNodeName( "Arabidopsis lyrata subsp lyrata bcl2" )
4410                     .equals( "Arabidopsis lyrata subsp. lyrata" ) ) {
4411                 return false;
4412             }
4413             if ( !ParserUtils.extractScientificNameFromNodeName( "Arabidopsis lyrata subspecies lyrata bcl2" )
4414                     .equals( "Arabidopsis lyrata subspecies lyrata" ) ) {
4415                 return false;
4416             }
4417             if ( !ParserUtils.extractScientificNameFromNodeName( "Verbascum sinuatum var. adenosepalum bcl2" )
4418                     .equals( "Verbascum sinuatum var. adenosepalum" ) ) {
4419                 return false;
4420             }
4421             if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia coli (strain K12)" )
4422                     .equals( "Escherichia coli (strain K12)" ) ) {
4423                 return false;
4424             }
4425             if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia coli (strain K12) bcl2" )
4426                     .equals( "Escherichia coli (strain K12)" ) ) {
4427                 return false;
4428             }
4429             if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia coli (str. K12)" )
4430                     .equals( "Escherichia coli (str. K12)" ) ) {
4431                 return false;
4432             }
4433             if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia coli (str K12)" )
4434                     .equals( "Escherichia coli (str. K12)" ) ) {
4435                 return false;
4436             }
4437             if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia coli (str. K12) bcl2" )
4438                     .equals( "Escherichia coli (str. K12)" ) ) {
4439                 return false;
4440             }
4441             if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia coli (var K12) bcl2" )
4442                     .equals( "Escherichia coli (var. K12)" ) ) {
4443                 return false;
4444             }
4445             if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia coli str. K-12 substr. MG1655star" )
4446                     .equals( "Escherichia coli str. K-12 substr. MG1655star" ) ) {
4447                 return false;
4448             }
4449             if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia coli str K-12 substr MG1655star" )
4450                     .equals( "Escherichia coli str. K-12 substr. MG1655star" ) ) {
4451                 return false;
4452             }
4453             if ( !ParserUtils
4454                     .extractScientificNameFromNodeName( "could be anything Escherichia coli str K-12 substr MG1655star" )
4455                     .equals( "Escherichia coli str. K-12 substr. MG1655star" ) ) {
4456                 return false;
4457             }
4458             if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia coli str K-12 substr MG1655star gene1" )
4459                     .equals( "Escherichia coli str. K-12 substr. MG1655star" ) ) {
4460                 return false;
4461             }
4462             if ( !ParserUtils
4463                     .extractScientificNameFromNodeName( "could be anything Escherichia coli str K-12 substr MG1655star GENE1" )
4464                     .equals( "Escherichia coli str. K-12 substr. MG1655star" ) ) {
4465                 return false;
4466             }
4467             if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia_coli_str_K-12_substr_MG1655star" )
4468                     .equals( "Escherichia coli str. K-12 substr. MG1655star" ) ) {
4469                 return false;
4470             }
4471             if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia_coli_str_K-12_substr_MG1655star" )
4472                     .equals( "Escherichia coli str. K-12 substr. MG1655star" ) ) {
4473                 return false;
4474             }
4475             if ( !ParserUtils.extractScientificNameFromNodeName( "Macrocera sp." ).equals( "Macrocera sp." ) ) {
4476                 return false;
4477             }
4478             if ( !ParserUtils.extractScientificNameFromNodeName( "Macrocera sp. 123" ).equals( "Macrocera sp." ) ) {
4479                 return false;
4480             }
4481             if ( !ParserUtils.extractScientificNameFromNodeName( "Macrocera sp. K12" ).equals( "Macrocera sp." ) ) {
4482                 return false;
4483             }
4484             if ( !ParserUtils.extractScientificNameFromNodeName( "something Macrocera sp. K12" )
4485                     .equals( "Macrocera sp." ) ) {
4486                 return false;
4487             }
4488             if ( !ParserUtils.extractScientificNameFromNodeName( "Macrocera sp" ).equals( "Macrocera sp." ) ) {
4489                 return false;
4490             }
4491             if ( !ParserUtils.extractScientificNameFromNodeName( "Sesamum rigidum ssp merenskyanum 07 48" )
4492                     .equals( "Sesamum rigidum subsp. merenskyanum" ) ) {
4493                 return false;
4494             }
4495             if ( !ParserUtils.extractScientificNameFromNodeName( "Sesamum rigidum ssp. merenskyanum" )
4496                     .equals( "Sesamum rigidum subsp. merenskyanum" ) ) {
4497                 return false;
4498             }
4499             if ( !ParserUtils.extractScientificNameFromNodeName( "Sesamum rigidum (ssp. merenskyanum)" )
4500                     .equals( "Sesamum rigidum (subsp. merenskyanum)" ) ) {
4501                 return false;
4502             }
4503             if ( !ParserUtils.extractScientificNameFromNodeName( "Sesamum rigidum (ssp merenskyanum)" )
4504                     .equals( "Sesamum rigidum (subsp. merenskyanum)" ) ) {
4505                 return false;
4506             }
4507         }
4508         catch ( final Exception e ) {
4509             e.printStackTrace( System.out );
4510             return false;
4511         }
4512         return true;
4513     }
4514
4515     private static boolean testExtractTaxonomyDataFromNodeName() {
4516         try {
4517             PhylogenyNode n = new PhylogenyNode( "tr|B1AM49|B1AM49_HUMAN" );
4518             if ( !ParserUtils.extractTaxonomyDataFromNodeName( n, TAXONOMY_EXTRACTION.AGGRESSIVE ).equals( "HUMAN" ) ) {
4519                 return false;
4520             }
4521             n = new PhylogenyNode( "tr|B1AM49|B1AM49_HUMAN~1-2" );
4522             if ( !ParserUtils.extractTaxonomyDataFromNodeName( n, TAXONOMY_EXTRACTION.AGGRESSIVE ).equals( "HUMAN" ) ) {
4523                 return false;
4524             }
4525             n = new PhylogenyNode( "tr|B1AM49|HNRPR_HUMAN" );
4526             if ( !ParserUtils.extractTaxonomyDataFromNodeName( n, TAXONOMY_EXTRACTION.AGGRESSIVE ).equals( "HUMAN" ) ) {
4527                 return false;
4528             }
4529             n = new PhylogenyNode( "tr|B1AM49|HNRPR_HUMAN|" );
4530             if ( !ParserUtils.extractTaxonomyDataFromNodeName( n, TAXONOMY_EXTRACTION.AGGRESSIVE ).equals( "HUMAN" ) ) {
4531                 return false;
4532             }
4533             n = new PhylogenyNode( "tr|B1AM49|HNRPR_HUMAN~12" );
4534             if ( !ParserUtils.extractTaxonomyDataFromNodeName( n, TAXONOMY_EXTRACTION.AGGRESSIVE ).equals( "HUMAN" ) ) {
4535                 return false;
4536             }
4537             n = new PhylogenyNode( "HNRPR_HUMAN" );
4538             if ( !ParserUtils.extractTaxonomyDataFromNodeName( n, TAXONOMY_EXTRACTION.AGGRESSIVE ).equals( "HUMAN" ) ) {
4539                 return false;
4540             }
4541             n = new PhylogenyNode( "HNRPR_HUMAN_X" );
4542             if ( !ParserUtils.extractTaxonomyDataFromNodeName( n, TAXONOMY_EXTRACTION.AGGRESSIVE ).equals( "HUMAN" ) ) {
4543                 return false;
4544             }
4545         }
4546         catch ( final Exception e ) {
4547             e.printStackTrace( System.out );
4548             return false;
4549         }
4550         return true;
4551     }
4552
4553     private static boolean testExtractTaxonomyCodeFromNodeName() {
4554         try {
4555             if ( ParserUtils.extractTaxonomyCodeFromNodeName( "MOUSE", TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ) != null ) {
4556                 return false;
4557             }
4558             if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "SOYBN", TAXONOMY_EXTRACTION.AGGRESSIVE )
4559                     .equals( "SOYBN" ) ) {
4560                 return false;
4561             }
4562             if ( !ParserUtils.extractTaxonomyCodeFromNodeName( " ARATH ", TAXONOMY_EXTRACTION.AGGRESSIVE )
4563                     .equals( "ARATH" ) ) {
4564                 return false;
4565             }
4566             if ( !ParserUtils.extractTaxonomyCodeFromNodeName( " ARATH ", TAXONOMY_EXTRACTION.AGGRESSIVE )
4567                     .equals( "ARATH" ) ) {
4568                 return false;
4569             }
4570             if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "RAT", TAXONOMY_EXTRACTION.AGGRESSIVE ).equals( "RAT" ) ) {
4571                 return false;
4572             }
4573             if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "RAT", TAXONOMY_EXTRACTION.AGGRESSIVE ).equals( "RAT" ) ) {
4574                 return false;
4575             }
4576             if ( ParserUtils.extractTaxonomyCodeFromNodeName( "RAT1", TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ) != null ) {
4577                 return false;
4578             }
4579             if ( !ParserUtils.extractTaxonomyCodeFromNodeName( " _SOYBN", TAXONOMY_EXTRACTION.AGGRESSIVE )
4580                     .equals( "SOYBN" ) ) {
4581                 return false;
4582             }
4583             if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "SOYBN", TAXONOMY_EXTRACTION.AGGRESSIVE )
4584                     .equals( "SOYBN" ) ) {
4585                 return false;
4586             }
4587             if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "qwerty SOYBN", TAXONOMY_EXTRACTION.AGGRESSIVE )
4588                     .equals( "SOYBN" ) ) {
4589                 return false;
4590             }
4591             if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "qwerty_SOYBN", TAXONOMY_EXTRACTION.AGGRESSIVE )
4592                     .equals( "SOYBN" ) ) {
4593                 return false;
4594             }
4595             if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "ABCD_SOYBN ", TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED )
4596                     .equals( "SOYBN" ) ) {
4597                 return false;
4598             }
4599             if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "SOYBN", TAXONOMY_EXTRACTION.AGGRESSIVE )
4600                     .equals( "SOYBN" ) ) {
4601                 return false;
4602             }
4603             if ( !ParserUtils.extractTaxonomyCodeFromNodeName( ",SOYBN,", TAXONOMY_EXTRACTION.AGGRESSIVE )
4604                     .equals( "SOYBN" ) ) {
4605                 return false;
4606             }
4607             if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "xxx,SOYBN,xxx", TAXONOMY_EXTRACTION.AGGRESSIVE )
4608                     .equals( "SOYBN" ) ) {
4609                 return false;
4610             }
4611             if ( ParserUtils.extractTaxonomyCodeFromNodeName( "xxxSOYBNxxx", TAXONOMY_EXTRACTION.AGGRESSIVE ) != null ) {
4612                 return false;
4613             }
4614             if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "-SOYBN~", TAXONOMY_EXTRACTION.AGGRESSIVE )
4615                     .equals( "SOYBN" ) ) {
4616                 return false;
4617             }
4618             if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "NNN8_ECOLI/1-2:0.01",
4619                                                                TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT ).equals( "ECOLI" ) ) {
4620                 return false;
4621             }
4622             if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "blag_9YX45-blag", TAXONOMY_EXTRACTION.AGGRESSIVE )
4623                     .equals( "9YX45" ) ) {
4624                 return false;
4625             }
4626             if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "BCL2_MOUSE function = 23445",
4627                                                                TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED )
4628                                                                .equals( "MOUSE" ) ) {
4629                 return false;
4630             }
4631             if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "BCL2_MOUSE+function = 23445",
4632                                                                TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED )
4633                                                                .equals( "MOUSE" ) ) {
4634                 return false;
4635             }
4636             if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "BCL2_MOUSE|function = 23445",
4637                                                                TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED )
4638                                                                .equals( "MOUSE" ) ) {
4639                 return false;
4640             }
4641             if ( ParserUtils.extractTaxonomyCodeFromNodeName( "BCL2_MOUSEfunction = 23445",
4642                                                               TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ) != null ) {
4643                 return false;
4644             }
4645             if ( ParserUtils.extractTaxonomyCodeFromNodeName( "BCL2_MOUSEFunction = 23445",
4646                                                               TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ) != null ) {
4647                 return false;
4648             }
4649             if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "BCL2_RAT function = 23445",
4650                                                                TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ).equals( "RAT" ) ) {
4651                 return false;
4652             }
4653             if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "BCL2_RAT function = 23445",
4654                                                                TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ).equals( "RAT" ) ) {
4655                 return false;
4656             }
4657             if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "BCL2_RAT|function = 23445",
4658                                                                TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ).equals( "RAT" ) ) {
4659                 return false;
4660             }
4661             if ( ParserUtils.extractTaxonomyCodeFromNodeName( "BCL2_RATfunction = 23445",
4662                                                               TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ) != null ) {
4663                 return false;
4664             }
4665             if ( ParserUtils.extractTaxonomyCodeFromNodeName( "BCL2_RATFunction = 23445",
4666                                                               TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ) != null ) {
4667                 return false;
4668             }
4669             if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "BCL2_RAT/1-3", TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED )
4670                     .equals( "RAT" ) ) {
4671                 return false;
4672             }
4673             if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "BCL2_PIG/1-3", TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT )
4674                     .equals( "PIG" ) ) {
4675                 return false;
4676             }
4677             if ( !ParserUtils
4678                     .extractTaxonomyCodeFromNodeName( "BCL2_MOUSE/1-3", TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED )
4679                     .equals( "MOUSE" ) ) {
4680                 return false;
4681             }
4682             if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "BCL2_MOUSE/1-3", TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT )
4683                     .equals( "MOUSE" ) ) {
4684                 return false;
4685             }
4686             if ( ParserUtils.extractTaxonomyCodeFromNodeName( "_MOUSE ", TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ) != null ) {
4687                 return false;
4688             }
4689         }
4690         catch ( final Exception e ) {
4691             e.printStackTrace( System.out );
4692             return false;
4693         }
4694         return true;
4695     }
4696
4697     private static boolean testExtractUniProtKbProteinSeqIdentifier() {
4698         try {
4699             PhylogenyNode n = new PhylogenyNode();
4700             n.setName( "tr|B3RJ64" );
4701             if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "B3RJ64" ) ) {
4702                 return false;
4703             }
4704             n.setName( "tr.B3RJ64" );
4705             if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "B3RJ64" ) ) {
4706                 return false;
4707             }
4708             n.setName( "tr=B3RJ64" );
4709             if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "B3RJ64" ) ) {
4710                 return false;
4711             }
4712             n.setName( "tr-B3RJ64" );
4713             if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "B3RJ64" ) ) {
4714                 return false;
4715             }
4716             n.setName( "tr/B3RJ64" );
4717             if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "B3RJ64" ) ) {
4718                 return false;
4719             }
4720             n.setName( "tr\\B3RJ64" );
4721             if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "B3RJ64" ) ) {
4722                 return false;
4723             }
4724             n.setName( "tr_B3RJ64" );
4725             if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "B3RJ64" ) ) {
4726                 return false;
4727             }
4728             n.setName( " tr|B3RJ64 " );
4729             if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "B3RJ64" ) ) {
4730                 return false;
4731             }
4732             n.setName( "-tr|B3RJ64-" );
4733             if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "B3RJ64" ) ) {
4734                 return false;
4735             }
4736             n.setName( "-tr=B3RJ64-" );
4737             if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "B3RJ64" ) ) {
4738                 return false;
4739             }
4740             n.setName( "_tr=B3RJ64_" );
4741             if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "B3RJ64" ) ) {
4742                 return false;
4743             }
4744             n.setName( " tr_tr|B3RJ64_sp|123 " );
4745             if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "B3RJ64" ) ) {
4746                 return false;
4747             }
4748             n.setName( "B3RJ64" );
4749             if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "B3RJ64" ) ) {
4750                 return false;
4751             }
4752             n.setName( "sp|B3RJ64" );
4753             if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "B3RJ64" ) ) {
4754                 return false;
4755             }
4756             n.setName( "sp|B3RJ64C" );
4757             if ( SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ) != null ) {
4758                 return false;
4759             }
4760             n.setName( "sp B3RJ64" );
4761             if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "B3RJ64" ) ) {
4762                 return false;
4763             }
4764             n.setName( "sp|B3RJ6X" );
4765             if ( SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ) != null ) {
4766                 return false;
4767             }
4768             n.setName( "sp|B3RJ6" );
4769             if ( SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ) != null ) {
4770                 return false;
4771             }
4772             n.setName( "K1PYK7_CRAGI" );
4773             if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "K1PYK7_CRAGI" ) ) {
4774                 return false;
4775             }
4776             n.setName( "K1PYK7_PEA" );
4777             if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "K1PYK7_PEA" ) ) {
4778                 return false;
4779             }
4780             n.setName( "K1PYK7_RAT" );
4781             if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "K1PYK7_RAT" ) ) {
4782                 return false;
4783             }
4784             n.setName( "K1PYK7_PIG" );
4785             if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "K1PYK7_PIG" ) ) {
4786                 return false;
4787             }
4788             n.setName( "~K1PYK7_PIG~" );
4789             if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "K1PYK7_PIG" ) ) {
4790                 return false;
4791             }
4792             n.setName( "123456_ECOLI-K1PYK7_CRAGI-sp" );
4793             if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "K1PYK7_CRAGI" ) ) {
4794                 return false;
4795             }
4796             n.setName( "K1PYKX_CRAGI" );
4797             if ( SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ) != null ) {
4798                 return false;
4799             }
4800             n.setName( "XXXXX_CRAGI" );
4801             if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "XXXXX_CRAGI" ) ) {
4802                 return false;
4803             }
4804             n.setName( "tr|H3IB65|H3IB65_STRPU~2-2" );
4805             if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "H3IB65" ) ) {
4806                 return false;
4807             }
4808             n.setName( "jgi|Lacbi2|181470|Lacbi1.estExt_GeneWisePlus_human.C_10729~2-3" );
4809             if ( SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ) != null ) {
4810                 return false;
4811             }
4812             n.setName( "sp|Q86U06|RBM23_HUMAN~2-2" );
4813             if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "Q86U06" ) ) {
4814                 return false;
4815             }
4816             n = new PhylogenyNode();
4817             org.forester.phylogeny.data.Sequence seq = new org.forester.phylogeny.data.Sequence();
4818             seq.setSymbol( "K1PYK7_CRAGI" );
4819             n.getNodeData().addSequence( seq );
4820             if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "K1PYK7_CRAGI" ) ) {
4821                 return false;
4822             }
4823             seq.setSymbol( "tr|B3RJ64" );
4824             if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "B3RJ64" ) ) {
4825                 return false;
4826             }
4827             n = new PhylogenyNode();
4828             seq = new org.forester.phylogeny.data.Sequence();
4829             seq.setName( "K1PYK7_CRAGI" );
4830             n.getNodeData().addSequence( seq );
4831             if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "K1PYK7_CRAGI" ) ) {
4832                 return false;
4833             }
4834             seq.setName( "tr|B3RJ64" );
4835             if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "B3RJ64" ) ) {
4836                 return false;
4837             }
4838             n = new PhylogenyNode();
4839             seq = new org.forester.phylogeny.data.Sequence();
4840             seq.setAccession( new Accession( "K1PYK8_CRAGI", "?" ) );
4841             n.getNodeData().addSequence( seq );
4842             if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "K1PYK8_CRAGI" ) ) {
4843                 return false;
4844             }
4845             n = new PhylogenyNode();
4846             seq = new org.forester.phylogeny.data.Sequence();
4847             seq.setAccession( new Accession( "tr|B3RJ64", "?" ) );
4848             n.getNodeData().addSequence( seq );
4849             if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "B3RJ64" ) ) {
4850                 return false;
4851             }
4852             //
4853             n = new PhylogenyNode();
4854             n.setName( "ACP19736" );
4855             if ( !SequenceAccessionTools.obtainGenbankAccessorFromDataFields( n ).equals( "ACP19736" ) ) {
4856                 return false;
4857             }
4858             n = new PhylogenyNode();
4859             n.setName( "|ACP19736|" );
4860             if ( !SequenceAccessionTools.obtainGenbankAccessorFromDataFields( n ).equals( "ACP19736" ) ) {
4861                 return false;
4862             }
4863         }
4864         catch ( final Exception e ) {
4865             e.printStackTrace( System.out );
4866             return false;
4867         }
4868         return true;
4869     }
4870
4871     private static boolean testFastaParser() {
4872         try {
4873             if ( !FastaParser.isLikelyFasta( new FileInputStream( PATH_TO_TEST_DATA + "fasta_0.fasta" ) ) ) {
4874                 return false;
4875             }
4876             if ( FastaParser.isLikelyFasta( new FileInputStream( PATH_TO_TEST_DATA + "msa_3.txt" ) ) ) {
4877                 return false;
4878             }
4879             final Msa msa_0 = FastaParser.parseMsa( new FileInputStream( PATH_TO_TEST_DATA + "fasta_0.fasta" ) );
4880             if ( !msa_0.getSequenceAsString( 0 ).toString().equalsIgnoreCase( "ACGTGKXFMFDMXEXXXSFMFMF" ) ) {
4881                 return false;
4882             }
4883             if ( !msa_0.getIdentifier( 0 ).equals( "one dumb" ) ) {
4884                 return false;
4885             }
4886             if ( !msa_0.getSequenceAsString( 1 ).toString().equalsIgnoreCase( "DKXASDFXSFXFKFKSXDFKSLX" ) ) {
4887                 return false;
4888             }
4889             if ( !msa_0.getSequenceAsString( 2 ).toString().equalsIgnoreCase( "SXDFKSXLFSFPWEXPROWXERR" ) ) {
4890                 return false;
4891             }
4892             if ( !msa_0.getSequenceAsString( 3 ).toString().equalsIgnoreCase( "AAAAAAAAAAAAAAAAAAAAAAA" ) ) {
4893                 return false;
4894             }
4895             if ( !msa_0.getSequenceAsString( 4 ).toString().equalsIgnoreCase( "DDDDDDDDDDDDDDDDDDDDAXF" ) ) {
4896                 return false;
4897             }
4898         }
4899         catch ( final Exception e ) {
4900             e.printStackTrace();
4901             return false;
4902         }
4903         return true;
4904     }
4905
4906     private static boolean testGenbankAccessorParsing() {
4907         //The format for GenBank Accession numbers are:
4908         //Nucleotide: 1 letter + 5 numerals OR 2 letters + 6 numerals
4909         //Protein:    3 letters + 5 numerals
4910         //http://www.ncbi.nlm.nih.gov/Sequin/acc.html
4911         if ( !SequenceAccessionTools.parseGenbankAccessorFromString( "AY423861" ).equals( "AY423861" ) ) {
4912             return false;
4913         }
4914         if ( !SequenceAccessionTools.parseGenbankAccessorFromString( ".AY423861.2" ).equals( "AY423861.2" ) ) {
4915             return false;
4916         }
4917         if ( !SequenceAccessionTools.parseGenbankAccessorFromString( "345_.AY423861.24_345" ).equals( "AY423861.24" ) ) {
4918             return false;
4919         }
4920         if ( SequenceAccessionTools.parseGenbankAccessorFromString( "AAY423861" ) != null ) {
4921             return false;
4922         }
4923         if ( SequenceAccessionTools.parseGenbankAccessorFromString( "AY4238612" ) != null ) {
4924             return false;
4925         }
4926         if ( SequenceAccessionTools.parseGenbankAccessorFromString( "AAY4238612" ) != null ) {
4927             return false;
4928         }
4929         if ( SequenceAccessionTools.parseGenbankAccessorFromString( "Y423861" ) != null ) {
4930             return false;
4931         }
4932         if ( !SequenceAccessionTools.parseGenbankAccessorFromString( "S12345" ).equals( "S12345" ) ) {
4933             return false;
4934         }
4935         if ( !SequenceAccessionTools.parseGenbankAccessorFromString( "|S12345|" ).equals( "S12345" ) ) {
4936             return false;
4937         }
4938         if ( SequenceAccessionTools.parseGenbankAccessorFromString( "|S123456" ) != null ) {
4939             return false;
4940         }
4941         if ( SequenceAccessionTools.parseGenbankAccessorFromString( "ABC123456" ) != null ) {
4942             return false;
4943         }
4944         if ( !SequenceAccessionTools.parseGenbankAccessorFromString( "ABC12345" ).equals( "ABC12345" ) ) {
4945             return false;
4946         }
4947         if ( !SequenceAccessionTools.parseGenbankAccessorFromString( "&ABC12345&" ).equals( "ABC12345" ) ) {
4948             return false;
4949         }
4950         if ( SequenceAccessionTools.parseGenbankAccessorFromString( "ABCD12345" ) != null ) {
4951             return false;
4952         }
4953         return true;
4954     }
4955
4956     private static boolean testGeneralMsaParser() {
4957         try {
4958             final String msa_str_0 = "seq1 abcd\n\nseq2 efgh\n";
4959             final Msa msa_0 = GeneralMsaParser.parse( new ByteArrayInputStream( msa_str_0.getBytes() ) );
4960             final String msa_str_1 = "seq1 abc\nseq2 ghi\nseq1 def\nseq2 jkm\n";
4961             final Msa msa_1 = GeneralMsaParser.parse( new ByteArrayInputStream( msa_str_1.getBytes() ) );
4962             final String msa_str_2 = "seq1 abc\nseq2 ghi\n\ndef\njkm\n";
4963             final Msa msa_2 = GeneralMsaParser.parse( new ByteArrayInputStream( msa_str_2.getBytes() ) );
4964             final String msa_str_3 = "seq1 abc\n def\nseq2 ghi\n jkm\n";
4965             final Msa msa_3 = GeneralMsaParser.parse( new ByteArrayInputStream( msa_str_3.getBytes() ) );
4966             if ( !msa_1.getSequenceAsString( 0 ).toString().equalsIgnoreCase( "abcdef" ) ) {
4967                 return false;
4968             }
4969             if ( !msa_1.getSequenceAsString( 1 ).toString().equalsIgnoreCase( "ghixkm" ) ) {
4970                 return false;
4971             }
4972             if ( !msa_1.getIdentifier( 0 ).toString().equals( "seq1" ) ) {
4973                 return false;
4974             }
4975             if ( !msa_1.getIdentifier( 1 ).toString().equals( "seq2" ) ) {
4976                 return false;
4977             }
4978             if ( !msa_2.getSequenceAsString( 0 ).toString().equalsIgnoreCase( "abcdef" ) ) {
4979                 return false;
4980             }
4981             if ( !msa_2.getSequenceAsString( 1 ).toString().equalsIgnoreCase( "ghixkm" ) ) {
4982                 return false;
4983             }
4984             if ( !msa_2.getIdentifier( 0 ).toString().equals( "seq1" ) ) {
4985                 return false;
4986             }
4987             if ( !msa_2.getIdentifier( 1 ).toString().equals( "seq2" ) ) {
4988                 return false;
4989             }
4990             if ( !msa_3.getSequenceAsString( 0 ).toString().equalsIgnoreCase( "abcdef" ) ) {
4991                 return false;
4992             }
4993             if ( !msa_3.getSequenceAsString( 1 ).toString().equalsIgnoreCase( "ghixkm" ) ) {
4994                 return false;
4995             }
4996             if ( !msa_3.getIdentifier( 0 ).toString().equals( "seq1" ) ) {
4997                 return false;
4998             }
4999             if ( !msa_3.getIdentifier( 1 ).toString().equals( "seq2" ) ) {
5000                 return false;
5001             }
5002             final Msa msa_4 = GeneralMsaParser.parse( new FileInputStream( PATH_TO_TEST_DATA + "msa_1.txt" ) );
5003             if ( !msa_4.getSequenceAsString( 0 ).toString().equalsIgnoreCase( "abcdefeeeeeeeexx" ) ) {
5004                 return false;
5005             }
5006             if ( !msa_4.getSequenceAsString( 1 ).toString().equalsIgnoreCase( "efghixffffffffyy" ) ) {
5007                 return false;
5008             }
5009             if ( !msa_4.getSequenceAsString( 2 ).toString().equalsIgnoreCase( "klmnxphhhhhhhhzz" ) ) {
5010                 return false;
5011             }
5012             final Msa msa_5 = GeneralMsaParser.parse( new FileInputStream( PATH_TO_TEST_DATA + "msa_2.txt" ) );
5013             if ( !msa_5.getSequenceAsString( 0 ).toString().equalsIgnoreCase( "abcdefxx" ) ) {
5014                 return false;
5015             }
5016             if ( !msa_5.getSequenceAsString( 1 ).toString().equalsIgnoreCase( "efghixyy" ) ) {
5017                 return false;
5018             }
5019             if ( !msa_5.getSequenceAsString( 2 ).toString().equalsIgnoreCase( "klmnxpzz" ) ) {
5020                 return false;
5021             }
5022             final Msa msa_6 = GeneralMsaParser.parse( new FileInputStream( PATH_TO_TEST_DATA + "msa_3.txt" ) );
5023             if ( !msa_6.getSequenceAsString( 0 ).toString().equalsIgnoreCase( "abcdefeeeeeeeexx" ) ) {
5024                 return false;
5025             }
5026             if ( !msa_6.getSequenceAsString( 1 ).toString().equalsIgnoreCase( "efghixffffffffyy" ) ) {
5027                 return false;
5028             }
5029             if ( !msa_6.getSequenceAsString( 2 ).toString().equalsIgnoreCase( "klmnxphhhhhhhhzz" ) ) {
5030                 return false;
5031             }
5032         }
5033         catch ( final Exception e ) {
5034             e.printStackTrace();
5035             return false;
5036         }
5037         return true;
5038     }
5039
5040     private static boolean testGeneralTable() {
5041         try {
5042             final GeneralTable<Integer, String> t0 = new GeneralTable<Integer, String>();
5043             t0.setValue( 3, 2, "23" );
5044             t0.setValue( 10, 1, "error" );
5045             t0.setValue( 10, 1, "110" );
5046             t0.setValue( 9, 1, "19" );
5047             t0.setValue( 1, 10, "101" );
5048             t0.setValue( 10, 10, "1010" );
5049             t0.setValue( 100, 10, "10100" );
5050             t0.setValue( 0, 0, "00" );
5051             if ( !t0.getValue( 3, 2 ).equals( "23" ) ) {
5052                 return false;
5053             }
5054             if ( !t0.getValue( 10, 1 ).equals( "110" ) ) {
5055                 return false;
5056             }
5057             if ( !t0.getValueAsString( 1, 10 ).equals( "101" ) ) {
5058                 return false;
5059             }
5060             if ( !t0.getValueAsString( 10, 10 ).equals( "1010" ) ) {
5061                 return false;
5062             }
5063             if ( !t0.getValueAsString( 100, 10 ).equals( "10100" ) ) {
5064                 return false;
5065             }
5066             if ( !t0.getValueAsString( 9, 1 ).equals( "19" ) ) {
5067                 return false;
5068             }
5069             if ( !t0.getValueAsString( 0, 0 ).equals( "00" ) ) {
5070                 return false;
5071             }
5072             if ( !t0.getValueAsString( 49, 4 ).equals( "" ) ) {
5073                 return false;
5074             }
5075             if ( !t0.getValueAsString( 22349, 3434344 ).equals( "" ) ) {
5076                 return false;
5077             }
5078             final GeneralTable<String, String> t1 = new GeneralTable<String, String>();
5079             t1.setValue( "3", "2", "23" );
5080             t1.setValue( "10", "1", "error" );
5081             t1.setValue( "10", "1", "110" );
5082             t1.setValue( "9", "1", "19" );
5083             t1.setValue( "1", "10", "101" );
5084             t1.setValue( "10", "10", "1010" );
5085             t1.setValue( "100", "10", "10100" );
5086             t1.setValue( "0", "0", "00" );
5087             t1.setValue( "qwerty", "zxcvbnm", "asdef" );
5088             if ( !t1.getValue( "3", "2" ).equals( "23" ) ) {
5089                 return false;
5090             }
5091             if ( !t1.getValue( "10", "1" ).equals( "110" ) ) {
5092                 return false;
5093             }
5094             if ( !t1.getValueAsString( "1", "10" ).equals( "101" ) ) {
5095                 return false;
5096             }
5097             if ( !t1.getValueAsString( "10", "10" ).equals( "1010" ) ) {
5098                 return false;
5099             }
5100             if ( !t1.getValueAsString( "100", "10" ).equals( "10100" ) ) {
5101                 return false;
5102             }
5103             if ( !t1.getValueAsString( "9", "1" ).equals( "19" ) ) {
5104                 return false;
5105             }
5106             if ( !t1.getValueAsString( "0", "0" ).equals( "00" ) ) {
5107                 return false;
5108             }
5109             if ( !t1.getValueAsString( "qwerty", "zxcvbnm" ).equals( "asdef" ) ) {
5110                 return false;
5111             }
5112             if ( !t1.getValueAsString( "49", "4" ).equals( "" ) ) {
5113                 return false;
5114             }
5115             if ( !t1.getValueAsString( "22349", "3434344" ).equals( "" ) ) {
5116                 return false;
5117             }
5118         }
5119         catch ( final Exception e ) {
5120             e.printStackTrace( System.out );
5121             return false;
5122         }
5123         return true;
5124     }
5125
5126     private static boolean testGetDistance() {
5127         try {
5128             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
5129             final Phylogeny p1 = factory.create( "(((A:1,B:2,X:100)ab:3,C:4)abc:5,(D:7,(E:9,F:10)ef:8)def:6)r",
5130                                                  new NHXParser() )[ 0 ];
5131             if ( PhylogenyMethods.calculateDistance( p1.getNode( "C" ), p1.getNode( "C" ) ) != 0 ) {
5132                 return false;
5133             }
5134             if ( PhylogenyMethods.calculateDistance( p1.getNode( "def" ), p1.getNode( "def" ) ) != 0 ) {
5135                 return false;
5136             }
5137             if ( PhylogenyMethods.calculateDistance( p1.getNode( "ef" ), p1.getNode( "ef" ) ) != 0 ) {
5138                 return false;
5139             }
5140             if ( PhylogenyMethods.calculateDistance( p1.getNode( "r" ), p1.getNode( "r" ) ) != 0 ) {
5141                 return false;
5142             }
5143             if ( PhylogenyMethods.calculateDistance( p1.getNode( "A" ), p1.getNode( "A" ) ) != 0 ) {
5144                 return false;
5145             }
5146             if ( PhylogenyMethods.calculateDistance( p1.getNode( "A" ), p1.getNode( "B" ) ) != 3 ) {
5147                 return false;
5148             }
5149             if ( PhylogenyMethods.calculateDistance( p1.getNode( "B" ), p1.getNode( "A" ) ) != 3 ) {
5150                 return false;
5151             }
5152             if ( PhylogenyMethods.calculateDistance( p1.getNode( "A" ), p1.getNode( "C" ) ) != 8 ) {
5153                 return false;
5154             }
5155             if ( PhylogenyMethods.calculateDistance( p1.getNode( "C" ), p1.getNode( "A" ) ) != 8 ) {
5156                 return false;
5157             }
5158             if ( PhylogenyMethods.calculateDistance( p1.getNode( "A" ), p1.getNode( "D" ) ) != 22 ) {
5159                 return false;
5160             }
5161             if ( PhylogenyMethods.calculateDistance( p1.getNode( "A" ), p1.getNode( "E" ) ) != 32 ) {
5162                 return false;
5163             }
5164             if ( PhylogenyMethods.calculateDistance( p1.getNode( "E" ), p1.getNode( "A" ) ) != 32 ) {
5165                 return false;
5166             }
5167             if ( PhylogenyMethods.calculateDistance( p1.getNode( "A" ), p1.getNode( "F" ) ) != 33 ) {
5168                 return false;
5169             }
5170             if ( PhylogenyMethods.calculateDistance( p1.getNode( "F" ), p1.getNode( "A" ) ) != 33 ) {
5171                 return false;
5172             }
5173             if ( PhylogenyMethods.calculateDistance( p1.getNode( "A" ), p1.getNode( "ab" ) ) != 1 ) {
5174                 return false;
5175             }
5176             if ( PhylogenyMethods.calculateDistance( p1.getNode( "ab" ), p1.getNode( "A" ) ) != 1 ) {
5177                 return false;
5178             }
5179             if ( PhylogenyMethods.calculateDistance( p1.getNode( "A" ), p1.getNode( "abc" ) ) != 4 ) {
5180                 return false;
5181             }
5182             if ( PhylogenyMethods.calculateDistance( p1.getNode( "abc" ), p1.getNode( "A" ) ) != 4 ) {
5183                 return false;
5184             }
5185             if ( PhylogenyMethods.calculateDistance( p1.getNode( "A" ), p1.getNode( "r" ) ) != 9 ) {
5186                 return false;
5187             }
5188             if ( PhylogenyMethods.calculateDistance( p1.getNode( "r" ), p1.getNode( "A" ) ) != 9 ) {
5189                 return false;
5190             }
5191             if ( PhylogenyMethods.calculateDistance( p1.getNode( "A" ), p1.getNode( "def" ) ) != 15 ) {
5192                 return false;
5193             }
5194             if ( PhylogenyMethods.calculateDistance( p1.getNode( "def" ), p1.getNode( "A" ) ) != 15 ) {
5195                 return false;
5196             }
5197             if ( PhylogenyMethods.calculateDistance( p1.getNode( "A" ), p1.getNode( "ef" ) ) != 23 ) {
5198                 return false;
5199             }
5200             if ( PhylogenyMethods.calculateDistance( p1.getNode( "ef" ), p1.getNode( "A" ) ) != 23 ) {
5201                 return false;
5202             }
5203             if ( PhylogenyMethods.calculateDistance( p1.getNode( "ef" ), p1.getNode( "def" ) ) != 8 ) {
5204                 return false;
5205             }
5206             if ( PhylogenyMethods.calculateDistance( p1.getNode( "def" ), p1.getNode( "ef" ) ) != 8 ) {
5207                 return false;
5208             }
5209             if ( PhylogenyMethods.calculateDistance( p1.getNode( "ef" ), p1.getNode( "r" ) ) != 14 ) {
5210                 return false;
5211             }
5212             if ( PhylogenyMethods.calculateDistance( p1.getNode( "ef" ), p1.getNode( "abc" ) ) != 19 ) {
5213                 return false;
5214             }
5215             if ( PhylogenyMethods.calculateDistance( p1.getNode( "ef" ), p1.getNode( "ab" ) ) != 22 ) {
5216                 return false;
5217             }
5218             if ( PhylogenyMethods.calculateDistance( p1.getNode( "ab" ), p1.getNode( "ef" ) ) != 22 ) {
5219                 return false;
5220             }
5221             if ( PhylogenyMethods.calculateDistance( p1.getNode( "def" ), p1.getNode( "abc" ) ) != 11 ) {
5222                 return false;
5223             }
5224             final Phylogeny p2 = factory.create( "((A:4,B:5,C:6)abc:1,(D:7,E:8,F:9)def:2,(G:10,H:11,I:12)ghi:3)r",
5225                                                  new NHXParser() )[ 0 ];
5226             if ( PhylogenyMethods.calculateDistance( p2.getNode( "A" ), p2.getNode( "B" ) ) != 9 ) {
5227                 return false;
5228             }
5229             if ( PhylogenyMethods.calculateDistance( p2.getNode( "A" ), p2.getNode( "C" ) ) != 10 ) {
5230                 return false;
5231             }
5232             if ( PhylogenyMethods.calculateDistance( p2.getNode( "A" ), p2.getNode( "D" ) ) != 14 ) {
5233                 return false;
5234             }
5235             if ( PhylogenyMethods.calculateDistance( p2.getNode( "A" ), p2.getNode( "ghi" ) ) != 8 ) {
5236                 return false;
5237             }
5238             if ( PhylogenyMethods.calculateDistance( p2.getNode( "A" ), p2.getNode( "I" ) ) != 20 ) {
5239                 return false;
5240             }
5241             if ( PhylogenyMethods.calculateDistance( p2.getNode( "G" ), p2.getNode( "ghi" ) ) != 10 ) {
5242                 return false;
5243             }
5244             if ( PhylogenyMethods.calculateDistance( p2.getNode( "r" ), p2.getNode( "r" ) ) != 0 ) {
5245                 return false;
5246             }
5247             if ( PhylogenyMethods.calculateDistance( p2.getNode( "r" ), p2.getNode( "G" ) ) != 13 ) {
5248                 return false;
5249             }
5250             if ( PhylogenyMethods.calculateDistance( p2.getNode( "G" ), p2.getNode( "r" ) ) != 13 ) {
5251                 return false;
5252             }
5253             if ( PhylogenyMethods.calculateDistance( p2.getNode( "G" ), p2.getNode( "H" ) ) != 21 ) {
5254                 return false;
5255             }
5256             if ( PhylogenyMethods.calculateDistance( p2.getNode( "G" ), p2.getNode( "I" ) ) != 22 ) {
5257                 return false;
5258             }
5259         }
5260         catch ( final Exception e ) {
5261             e.printStackTrace( System.out );
5262             return false;
5263         }
5264         return true;
5265     }
5266
5267     private static boolean testGetLCA() {
5268         try {
5269             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
5270             final Phylogeny p1 = factory.create( "((((((A,B)ab,C)abc,D)abcd,E)abcde,F)abcdef,(G,H)gh)abcdefgh",
5271                                                  new NHXParser() )[ 0 ];
5272             final PhylogenyNode A = PhylogenyMethods.calculateLCA( p1.getNode( "A" ), p1.getNode( "A" ) );
5273             if ( !A.getName().equals( "A" ) ) {
5274                 return false;
5275             }
5276             final PhylogenyNode gh = PhylogenyMethods.calculateLCA( p1.getNode( "gh" ), p1.getNode( "gh" ) );
5277             if ( !gh.getName().equals( "gh" ) ) {
5278                 return false;
5279             }
5280             final PhylogenyNode ab = PhylogenyMethods.calculateLCA( p1.getNode( "A" ), p1.getNode( "B" ) );
5281             if ( !ab.getName().equals( "ab" ) ) {
5282                 return false;
5283             }
5284             final PhylogenyNode ab2 = PhylogenyMethods.calculateLCA( p1.getNode( "B" ), p1.getNode( "A" ) );
5285             if ( !ab2.getName().equals( "ab" ) ) {
5286                 return false;
5287             }
5288             final PhylogenyNode gh2 = PhylogenyMethods.calculateLCA( p1.getNode( "H" ), p1.getNode( "G" ) );
5289             if ( !gh2.getName().equals( "gh" ) ) {
5290                 return false;
5291             }
5292             final PhylogenyNode gh3 = PhylogenyMethods.calculateLCA( p1.getNode( "G" ), p1.getNode( "H" ) );
5293             if ( !gh3.getName().equals( "gh" ) ) {
5294                 return false;
5295             }
5296             final PhylogenyNode abc = PhylogenyMethods.calculateLCA( p1.getNode( "C" ), p1.getNode( "A" ) );
5297             if ( !abc.getName().equals( "abc" ) ) {
5298                 return false;
5299             }
5300             final PhylogenyNode abc2 = PhylogenyMethods.calculateLCA( p1.getNode( "A" ), p1.getNode( "C" ) );
5301             if ( !abc2.getName().equals( "abc" ) ) {
5302                 return false;
5303             }
5304             final PhylogenyNode abcd = PhylogenyMethods.calculateLCA( p1.getNode( "A" ), p1.getNode( "D" ) );
5305             if ( !abcd.getName().equals( "abcd" ) ) {
5306                 return false;
5307             }
5308             final PhylogenyNode abcd2 = PhylogenyMethods.calculateLCA( p1.getNode( "D" ), p1.getNode( "A" ) );
5309             if ( !abcd2.getName().equals( "abcd" ) ) {
5310                 return false;
5311             }
5312             final PhylogenyNode abcdef = PhylogenyMethods.calculateLCA( p1.getNode( "A" ), p1.getNode( "F" ) );
5313             if ( !abcdef.getName().equals( "abcdef" ) ) {
5314                 return false;
5315             }
5316             final PhylogenyNode abcdef2 = PhylogenyMethods.calculateLCA( p1.getNode( "F" ), p1.getNode( "A" ) );
5317             if ( !abcdef2.getName().equals( "abcdef" ) ) {
5318                 return false;
5319             }
5320             final PhylogenyNode abcdef3 = PhylogenyMethods.calculateLCA( p1.getNode( "ab" ), p1.getNode( "F" ) );
5321             if ( !abcdef3.getName().equals( "abcdef" ) ) {
5322                 return false;
5323             }
5324             final PhylogenyNode abcdef4 = PhylogenyMethods.calculateLCA( p1.getNode( "F" ), p1.getNode( "ab" ) );
5325             if ( !abcdef4.getName().equals( "abcdef" ) ) {
5326                 return false;
5327             }
5328             final PhylogenyNode abcde = PhylogenyMethods.calculateLCA( p1.getNode( "A" ), p1.getNode( "E" ) );
5329             if ( !abcde.getName().equals( "abcde" ) ) {
5330                 return false;
5331             }
5332             final PhylogenyNode abcde2 = PhylogenyMethods.calculateLCA( p1.getNode( "E" ), p1.getNode( "A" ) );
5333             if ( !abcde2.getName().equals( "abcde" ) ) {
5334                 return false;
5335             }
5336             final PhylogenyNode r = PhylogenyMethods.calculateLCA( p1.getNode( "abcdefgh" ), p1.getNode( "abcdefgh" ) );
5337             if ( !r.getName().equals( "abcdefgh" ) ) {
5338                 return false;
5339             }
5340             final PhylogenyNode r2 = PhylogenyMethods.calculateLCA( p1.getNode( "A" ), p1.getNode( "H" ) );
5341             if ( !r2.getName().equals( "abcdefgh" ) ) {
5342                 return false;
5343             }
5344             final PhylogenyNode r3 = PhylogenyMethods.calculateLCA( p1.getNode( "H" ), p1.getNode( "A" ) );
5345             if ( !r3.getName().equals( "abcdefgh" ) ) {
5346                 return false;
5347             }
5348             final PhylogenyNode abcde3 = PhylogenyMethods.calculateLCA( p1.getNode( "E" ), p1.getNode( "abcde" ) );
5349             if ( !abcde3.getName().equals( "abcde" ) ) {
5350                 return false;
5351             }
5352             final PhylogenyNode abcde4 = PhylogenyMethods.calculateLCA( p1.getNode( "abcde" ), p1.getNode( "E" ) );
5353             if ( !abcde4.getName().equals( "abcde" ) ) {
5354                 return false;
5355             }
5356             final PhylogenyNode ab3 = PhylogenyMethods.calculateLCA( p1.getNode( "ab" ), p1.getNode( "B" ) );
5357             if ( !ab3.getName().equals( "ab" ) ) {
5358                 return false;
5359             }
5360             final PhylogenyNode ab4 = PhylogenyMethods.calculateLCA( p1.getNode( "B" ), p1.getNode( "ab" ) );
5361             if ( !ab4.getName().equals( "ab" ) ) {
5362                 return false;
5363             }
5364             final Phylogeny p2 = factory.create( "(a,b,(((c,d)cd,e)cde,f)cdef)r", new NHXParser() )[ 0 ];
5365             final PhylogenyNode cd = PhylogenyMethods.calculateLCA( p2.getNode( "c" ), p2.getNode( "d" ) );
5366             if ( !cd.getName().equals( "cd" ) ) {
5367                 return false;
5368             }
5369             final PhylogenyNode cd2 = PhylogenyMethods.calculateLCA( p2.getNode( "d" ), p2.getNode( "c" ) );
5370             if ( !cd2.getName().equals( "cd" ) ) {
5371                 return false;
5372             }
5373             final PhylogenyNode cde = PhylogenyMethods.calculateLCA( p2.getNode( "c" ), p2.getNode( "e" ) );
5374             if ( !cde.getName().equals( "cde" ) ) {
5375                 return false;
5376             }
5377             final PhylogenyNode cde2 = PhylogenyMethods.calculateLCA( p2.getNode( "e" ), p2.getNode( "c" ) );
5378             if ( !cde2.getName().equals( "cde" ) ) {
5379                 return false;
5380             }
5381             final PhylogenyNode cdef = PhylogenyMethods.calculateLCA( p2.getNode( "c" ), p2.getNode( "f" ) );
5382             if ( !cdef.getName().equals( "cdef" ) ) {
5383                 return false;
5384             }
5385             final PhylogenyNode cdef2 = PhylogenyMethods.calculateLCA( p2.getNode( "d" ), p2.getNode( "f" ) );
5386             if ( !cdef2.getName().equals( "cdef" ) ) {
5387                 return false;
5388             }
5389             final PhylogenyNode cdef3 = PhylogenyMethods.calculateLCA( p2.getNode( "f" ), p2.getNode( "d" ) );
5390             if ( !cdef3.getName().equals( "cdef" ) ) {
5391                 return false;
5392             }
5393             final PhylogenyNode rt = PhylogenyMethods.calculateLCA( p2.getNode( "c" ), p2.getNode( "a" ) );
5394             if ( !rt.getName().equals( "r" ) ) {
5395                 return false;
5396             }
5397             final Phylogeny p3 = factory
5398                     .create( "((((a,(b,c)bc)abc,(d,e)de)abcde,f)abcdef,(((g,h)gh,(i,j)ij)ghij,k)ghijk,l)",
5399                              new NHXParser() )[ 0 ];
5400             final PhylogenyNode bc_3 = PhylogenyMethods.calculateLCA( p3.getNode( "b" ), p3.getNode( "c" ) );
5401             if ( !bc_3.getName().equals( "bc" ) ) {
5402                 return false;
5403             }
5404             final PhylogenyNode ac_3 = PhylogenyMethods.calculateLCA( p3.getNode( "a" ), p3.getNode( "c" ) );
5405             if ( !ac_3.getName().equals( "abc" ) ) {
5406                 return false;
5407             }
5408             final PhylogenyNode ad_3 = PhylogenyMethods.calculateLCA( p3.getNode( "a" ), p3.getNode( "d" ) );
5409             if ( !ad_3.getName().equals( "abcde" ) ) {
5410                 return false;
5411             }
5412             final PhylogenyNode af_3 = PhylogenyMethods.calculateLCA( p3.getNode( "a" ), p3.getNode( "f" ) );
5413             if ( !af_3.getName().equals( "abcdef" ) ) {
5414                 return false;
5415             }
5416             final PhylogenyNode ag_3 = PhylogenyMethods.calculateLCA( p3.getNode( "a" ), p3.getNode( "g" ) );
5417             if ( !ag_3.getName().equals( "" ) ) {
5418                 return false;
5419             }
5420             if ( !ag_3.isRoot() ) {
5421                 return false;
5422             }
5423             final PhylogenyNode al_3 = PhylogenyMethods.calculateLCA( p3.getNode( "a" ), p3.getNode( "l" ) );
5424             if ( !al_3.getName().equals( "" ) ) {
5425                 return false;
5426             }
5427             if ( !al_3.isRoot() ) {
5428                 return false;
5429             }
5430             final PhylogenyNode kl_3 = PhylogenyMethods.calculateLCA( p3.getNode( "k" ), p3.getNode( "l" ) );
5431             if ( !kl_3.getName().equals( "" ) ) {
5432                 return false;
5433             }
5434             if ( !kl_3.isRoot() ) {
5435                 return false;
5436             }
5437             final PhylogenyNode fl_3 = PhylogenyMethods.calculateLCA( p3.getNode( "f" ), p3.getNode( "l" ) );
5438             if ( !fl_3.getName().equals( "" ) ) {
5439                 return false;
5440             }
5441             if ( !fl_3.isRoot() ) {
5442                 return false;
5443             }
5444             final PhylogenyNode gk_3 = PhylogenyMethods.calculateLCA( p3.getNode( "g" ), p3.getNode( "k" ) );
5445             if ( !gk_3.getName().equals( "ghijk" ) ) {
5446                 return false;
5447             }
5448             final Phylogeny p4 = factory.create( "(a,b,c)r", new NHXParser() )[ 0 ];
5449             final PhylogenyNode r_4 = PhylogenyMethods.calculateLCA( p4.getNode( "b" ), p4.getNode( "c" ) );
5450             if ( !r_4.getName().equals( "r" ) ) {
5451                 return false;
5452             }
5453             final Phylogeny p5 = factory.create( "((a,b),c,d)root", new NHXParser() )[ 0 ];
5454             final PhylogenyNode r_5 = PhylogenyMethods.calculateLCA( p5.getNode( "a" ), p5.getNode( "c" ) );
5455             if ( !r_5.getName().equals( "root" ) ) {
5456                 return false;
5457             }
5458             final Phylogeny p6 = factory.create( "((a,b),c,d)rot", new NHXParser() )[ 0 ];
5459             final PhylogenyNode r_6 = PhylogenyMethods.calculateLCA( p6.getNode( "c" ), p6.getNode( "a" ) );
5460             if ( !r_6.getName().equals( "rot" ) ) {
5461                 return false;
5462             }
5463             final Phylogeny p7 = factory.create( "(((a,b)x,c)x,d,e)rott", new NHXParser() )[ 0 ];
5464             final PhylogenyNode r_7 = PhylogenyMethods.calculateLCA( p7.getNode( "a" ), p7.getNode( "e" ) );
5465             if ( !r_7.getName().equals( "rott" ) ) {
5466                 return false;
5467             }
5468         }
5469         catch ( final Exception e ) {
5470             e.printStackTrace( System.out );
5471             return false;
5472         }
5473         return true;
5474     }
5475
5476     private static boolean testGetLCA2() {
5477         try {
5478             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
5479             // final Phylogeny p_a = factory.create( "(a)", new NHXParser() )[ 0 ];
5480             final Phylogeny p_a = NHXParser.parse( "(a)" )[ 0 ];
5481             PhylogenyMethods.preOrderReId( p_a );
5482             final PhylogenyNode p_a_1 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p_a.getNode( "a" ),
5483                                                                                               p_a.getNode( "a" ) );
5484             if ( !p_a_1.getName().equals( "a" ) ) {
5485                 return false;
5486             }
5487             final Phylogeny p_b = NHXParser.parse( "((a)b)" )[ 0 ];
5488             PhylogenyMethods.preOrderReId( p_b );
5489             final PhylogenyNode p_b_1 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p_b.getNode( "b" ),
5490                                                                                               p_b.getNode( "a" ) );
5491             if ( !p_b_1.getName().equals( "b" ) ) {
5492                 return false;
5493             }
5494             final PhylogenyNode p_b_2 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p_b.getNode( "a" ),
5495                                                                                               p_b.getNode( "b" ) );
5496             if ( !p_b_2.getName().equals( "b" ) ) {
5497                 return false;
5498             }
5499             final Phylogeny p_c = factory.create( "(((a)b)c)", new NHXParser() )[ 0 ];
5500             PhylogenyMethods.preOrderReId( p_c );
5501             final PhylogenyNode p_c_1 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p_c.getNode( "b" ),
5502                                                                                               p_c.getNode( "a" ) );
5503             if ( !p_c_1.getName().equals( "b" ) ) {
5504                 return false;
5505             }
5506             final PhylogenyNode p_c_2 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p_c.getNode( "a" ),
5507                                                                                               p_c.getNode( "c" ) );
5508             if ( !p_c_2.getName().equals( "c" ) ) {
5509                 System.out.println( p_c_2.getName() );
5510                 System.exit( -1 );
5511                 return false;
5512             }
5513             final PhylogenyNode p_c_3 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p_c.getNode( "a" ),
5514                                                                                               p_c.getNode( "b" ) );
5515             if ( !p_c_3.getName().equals( "b" ) ) {
5516                 return false;
5517             }
5518             final PhylogenyNode p_c_4 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p_c.getNode( "c" ),
5519                                                                                               p_c.getNode( "a" ) );
5520             if ( !p_c_4.getName().equals( "c" ) ) {
5521                 return false;
5522             }
5523             final Phylogeny p1 = factory.create( "((((((A,B)ab,C)abc,D)abcd,E)abcde,F)abcdef,(G,H)gh)abcdefgh",
5524                                                  new NHXParser() )[ 0 ];
5525             PhylogenyMethods.preOrderReId( p1 );
5526             final PhylogenyNode A = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "A" ),
5527                                                                                           p1.getNode( "A" ) );
5528             if ( !A.getName().equals( "A" ) ) {
5529                 return false;
5530             }
5531             final PhylogenyNode gh = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "gh" ),
5532                                                                                            p1.getNode( "gh" ) );
5533             if ( !gh.getName().equals( "gh" ) ) {
5534                 return false;
5535             }
5536             final PhylogenyNode ab = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "A" ),
5537                                                                                            p1.getNode( "B" ) );
5538             if ( !ab.getName().equals( "ab" ) ) {
5539                 return false;
5540             }
5541             final PhylogenyNode ab2 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "B" ),
5542                                                                                             p1.getNode( "A" ) );
5543             if ( !ab2.getName().equals( "ab" ) ) {
5544                 return false;
5545             }
5546             final PhylogenyNode gh2 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "H" ),
5547                                                                                             p1.getNode( "G" ) );
5548             if ( !gh2.getName().equals( "gh" ) ) {
5549                 return false;
5550             }
5551             final PhylogenyNode gh3 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "G" ),
5552                                                                                             p1.getNode( "H" ) );
5553             if ( !gh3.getName().equals( "gh" ) ) {
5554                 return false;
5555             }
5556             final PhylogenyNode abc = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "C" ),
5557                                                                                             p1.getNode( "A" ) );
5558             if ( !abc.getName().equals( "abc" ) ) {
5559                 return false;
5560             }
5561             final PhylogenyNode abc2 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "A" ),
5562                                                                                              p1.getNode( "C" ) );
5563             if ( !abc2.getName().equals( "abc" ) ) {
5564                 return false;
5565             }
5566             final PhylogenyNode abcd = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "A" ),
5567                                                                                              p1.getNode( "D" ) );
5568             if ( !abcd.getName().equals( "abcd" ) ) {
5569                 return false;
5570             }
5571             final PhylogenyNode abcd2 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "D" ),
5572                                                                                               p1.getNode( "A" ) );
5573             if ( !abcd2.getName().equals( "abcd" ) ) {
5574                 return false;
5575             }
5576             final PhylogenyNode abcdef = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "A" ),
5577                                                                                                p1.getNode( "F" ) );
5578             if ( !abcdef.getName().equals( "abcdef" ) ) {
5579                 return false;
5580             }
5581             final PhylogenyNode abcdef2 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "F" ),
5582                                                                                                 p1.getNode( "A" ) );
5583             if ( !abcdef2.getName().equals( "abcdef" ) ) {
5584                 return false;
5585             }
5586             final PhylogenyNode abcdef3 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "ab" ),
5587                                                                                                 p1.getNode( "F" ) );
5588             if ( !abcdef3.getName().equals( "abcdef" ) ) {
5589                 return false;
5590             }
5591             final PhylogenyNode abcdef4 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "F" ),
5592                                                                                                 p1.getNode( "ab" ) );
5593             if ( !abcdef4.getName().equals( "abcdef" ) ) {
5594                 return false;
5595             }
5596             final PhylogenyNode abcde = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "A" ),
5597                                                                                               p1.getNode( "E" ) );
5598             if ( !abcde.getName().equals( "abcde" ) ) {
5599                 return false;
5600             }
5601             final PhylogenyNode abcde2 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "E" ),
5602                                                                                                p1.getNode( "A" ) );
5603             if ( !abcde2.getName().equals( "abcde" ) ) {
5604                 return false;
5605             }
5606             final PhylogenyNode r = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "abcdefgh" ),
5607                                                                                           p1.getNode( "abcdefgh" ) );
5608             if ( !r.getName().equals( "abcdefgh" ) ) {
5609                 return false;
5610             }
5611             final PhylogenyNode r2 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "A" ),
5612                                                                                            p1.getNode( "H" ) );
5613             if ( !r2.getName().equals( "abcdefgh" ) ) {
5614                 return false;
5615             }
5616             final PhylogenyNode r3 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "H" ),
5617                                                                                            p1.getNode( "A" ) );
5618             if ( !r3.getName().equals( "abcdefgh" ) ) {
5619                 return false;
5620             }
5621             final PhylogenyNode abcde3 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "E" ),
5622                                                                                                p1.getNode( "abcde" ) );
5623             if ( !abcde3.getName().equals( "abcde" ) ) {
5624                 return false;
5625             }
5626             final PhylogenyNode abcde4 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "abcde" ),
5627                                                                                                p1.getNode( "E" ) );
5628             if ( !abcde4.getName().equals( "abcde" ) ) {
5629                 return false;
5630             }
5631             final PhylogenyNode ab3 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "ab" ),
5632                                                                                             p1.getNode( "B" ) );
5633             if ( !ab3.getName().equals( "ab" ) ) {
5634                 return false;
5635             }
5636             final PhylogenyNode ab4 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "B" ),
5637                                                                                             p1.getNode( "ab" ) );
5638             if ( !ab4.getName().equals( "ab" ) ) {
5639                 return false;
5640             }
5641             final Phylogeny p2 = factory.create( "(a,b,(((c,d)cd,e)cde,f)cdef)r", new NHXParser() )[ 0 ];
5642             PhylogenyMethods.preOrderReId( p2 );
5643             final PhylogenyNode cd = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p2.getNode( "c" ),
5644                                                                                            p2.getNode( "d" ) );
5645             if ( !cd.getName().equals( "cd" ) ) {
5646                 return false;
5647             }
5648             final PhylogenyNode cd2 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p2.getNode( "d" ),
5649                                                                                             p2.getNode( "c" ) );
5650             if ( !cd2.getName().equals( "cd" ) ) {
5651                 return false;
5652             }
5653             final PhylogenyNode cde = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p2.getNode( "c" ),
5654                                                                                             p2.getNode( "e" ) );
5655             if ( !cde.getName().equals( "cde" ) ) {
5656                 return false;
5657             }
5658             final PhylogenyNode cde2 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p2.getNode( "e" ),
5659                                                                                              p2.getNode( "c" ) );
5660             if ( !cde2.getName().equals( "cde" ) ) {
5661                 return false;
5662             }
5663             final PhylogenyNode cdef = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p2.getNode( "c" ),
5664                                                                                              p2.getNode( "f" ) );
5665             if ( !cdef.getName().equals( "cdef" ) ) {
5666                 return false;
5667             }
5668             final PhylogenyNode cdef2 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p2.getNode( "d" ),
5669                                                                                               p2.getNode( "f" ) );
5670             if ( !cdef2.getName().equals( "cdef" ) ) {
5671                 return false;
5672             }
5673             final PhylogenyNode cdef3 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p2.getNode( "f" ),
5674                                                                                               p2.getNode( "d" ) );
5675             if ( !cdef3.getName().equals( "cdef" ) ) {
5676                 return false;
5677             }
5678             final PhylogenyNode rt = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p2.getNode( "c" ),
5679                                                                                            p2.getNode( "a" ) );
5680             if ( !rt.getName().equals( "r" ) ) {
5681                 return false;
5682             }
5683             final Phylogeny p3 = factory
5684                     .create( "((((a,(b,c)bc)abc,(d,e)de)abcde,f)abcdef,(((g,h)gh,(i,j)ij)ghij,k)ghijk,l)",
5685                              new NHXParser() )[ 0 ];
5686             PhylogenyMethods.preOrderReId( p3 );
5687             final PhylogenyNode bc_3 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p3.getNode( "b" ),
5688                                                                                              p3.getNode( "c" ) );
5689             if ( !bc_3.getName().equals( "bc" ) ) {
5690                 return false;
5691             }
5692             final PhylogenyNode ac_3 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p3.getNode( "a" ),
5693                                                                                              p3.getNode( "c" ) );
5694             if ( !ac_3.getName().equals( "abc" ) ) {
5695                 return false;
5696             }
5697             final PhylogenyNode ad_3 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p3.getNode( "a" ),
5698                                                                                              p3.getNode( "d" ) );
5699             if ( !ad_3.getName().equals( "abcde" ) ) {
5700                 return false;
5701             }
5702             final PhylogenyNode af_3 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p3.getNode( "a" ),
5703                                                                                              p3.getNode( "f" ) );
5704             if ( !af_3.getName().equals( "abcdef" ) ) {
5705                 return false;
5706             }
5707             final PhylogenyNode ag_3 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p3.getNode( "a" ),
5708                                                                                              p3.getNode( "g" ) );
5709             if ( !ag_3.getName().equals( "" ) ) {
5710                 return false;
5711             }
5712             if ( !ag_3.isRoot() ) {
5713                 return false;
5714             }
5715             final PhylogenyNode al_3 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p3.getNode( "a" ),
5716                                                                                              p3.getNode( "l" ) );
5717             if ( !al_3.getName().equals( "" ) ) {
5718                 return false;
5719             }
5720             if ( !al_3.isRoot() ) {
5721                 return false;
5722             }
5723             final PhylogenyNode kl_3 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p3.getNode( "k" ),
5724                                                                                              p3.getNode( "l" ) );
5725             if ( !kl_3.getName().equals( "" ) ) {
5726                 return false;
5727             }
5728             if ( !kl_3.isRoot() ) {
5729                 return false;
5730             }
5731             final PhylogenyNode fl_3 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p3.getNode( "f" ),
5732                                                                                              p3.getNode( "l" ) );
5733             if ( !fl_3.getName().equals( "" ) ) {
5734                 return false;
5735             }
5736             if ( !fl_3.isRoot() ) {
5737                 return false;
5738             }
5739             final PhylogenyNode gk_3 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p3.getNode( "g" ),
5740                                                                                              p3.getNode( "k" ) );
5741             if ( !gk_3.getName().equals( "ghijk" ) ) {
5742                 return false;
5743             }
5744             final Phylogeny p4 = factory.create( "(a,b,c)r", new NHXParser() )[ 0 ];
5745             PhylogenyMethods.preOrderReId( p4 );
5746             final PhylogenyNode r_4 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p4.getNode( "b" ),
5747                                                                                             p4.getNode( "c" ) );
5748             if ( !r_4.getName().equals( "r" ) ) {
5749                 return false;
5750             }
5751             final Phylogeny p5 = factory.create( "((a,b),c,d)root", new NHXParser() )[ 0 ];
5752             PhylogenyMethods.preOrderReId( p5 );
5753             final PhylogenyNode r_5 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p5.getNode( "a" ),
5754                                                                                             p5.getNode( "c" ) );
5755             if ( !r_5.getName().equals( "root" ) ) {
5756                 return false;
5757             }
5758             final Phylogeny p6 = factory.create( "((a,b),c,d)rot", new NHXParser() )[ 0 ];
5759             PhylogenyMethods.preOrderReId( p6 );
5760             final PhylogenyNode r_6 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p6.getNode( "c" ),
5761                                                                                             p6.getNode( "a" ) );
5762             if ( !r_6.getName().equals( "rot" ) ) {
5763                 return false;
5764             }
5765             final Phylogeny p7 = factory.create( "(((a,b)x,c)x,d,e)rott", new NHXParser() )[ 0 ];
5766             PhylogenyMethods.preOrderReId( p7 );
5767             final PhylogenyNode r_7 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p7.getNode( "a" ),
5768                                                                                             p7.getNode( "e" ) );
5769             if ( !r_7.getName().equals( "rott" ) ) {
5770                 return false;
5771             }
5772             final PhylogenyNode r_71 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p7.getNode( "e" ),
5773                                                                                              p7.getNode( "a" ) );
5774             if ( !r_71.getName().equals( "rott" ) ) {
5775                 return false;
5776             }
5777             final PhylogenyNode r_72 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p7.getNode( "e" ),
5778                                                                                              p7.getNode( "rott" ) );
5779             if ( !r_72.getName().equals( "rott" ) ) {
5780                 return false;
5781             }
5782             final PhylogenyNode r_73 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p7.getNode( "rott" ),
5783                                                                                              p7.getNode( "a" ) );
5784             if ( !r_73.getName().equals( "rott" ) ) {
5785                 return false;
5786             }
5787             final PhylogenyNode r_74 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p7.getNode( "rott" ),
5788                                                                                              p7.getNode( "rott" ) );
5789             if ( !r_74.getName().equals( "rott" ) ) {
5790                 return false;
5791             }
5792             final PhylogenyNode r_75 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p7.getNode( "e" ),
5793                                                                                              p7.getNode( "e" ) );
5794             if ( !r_75.getName().equals( "e" ) ) {
5795                 return false;
5796             }
5797         }
5798         catch ( final Exception e ) {
5799             e.printStackTrace( System.out );
5800             return false;
5801         }
5802         return true;
5803     }
5804
5805     private static boolean testHmmscanOutputParser() {
5806         final String test_dir = Test.PATH_TO_TEST_DATA;
5807         try {
5808             final HmmscanPerDomainTableParser parser1 = new HmmscanPerDomainTableParser( new File( test_dir
5809                                                                                                    + ForesterUtil.getFileSeparator() + "hmmscan30b3_output_1" ), "MONBR", INDIVIDUAL_SCORE_CUTOFF.NONE );
5810             parser1.parse();
5811             final HmmscanPerDomainTableParser parser2 = new HmmscanPerDomainTableParser( new File( test_dir
5812                                                                                                    + ForesterUtil.getFileSeparator() + "hmmscan30b3_output_2" ), "MONBR", INDIVIDUAL_SCORE_CUTOFF.NONE );
5813             final List<Protein> proteins = parser2.parse();
5814             if ( parser2.getProteinsEncountered() != 4 ) {
5815                 return false;
5816             }
5817             if ( proteins.size() != 4 ) {
5818                 return false;
5819             }
5820             if ( parser2.getDomainsEncountered() != 69 ) {
5821                 return false;
5822             }
5823             if ( parser2.getDomainsIgnoredDueToDuf() != 0 ) {
5824                 return false;
5825             }
5826             if ( parser2.getDomainsIgnoredDueToFsEval() != 0 ) {
5827                 return false;
5828             }
5829             if ( parser2.getDomainsIgnoredDueToIEval() != 0 ) {
5830                 return false;
5831             }
5832             final Protein p1 = proteins.get( 0 );
5833             if ( p1.getNumberOfProteinDomains() != 15 ) {
5834                 return false;
5835             }
5836             if ( p1.getLength() != 850 ) {
5837                 return false;
5838             }
5839             final Protein p2 = proteins.get( 1 );
5840             if ( p2.getNumberOfProteinDomains() != 51 ) {
5841                 return false;
5842             }
5843             if ( p2.getLength() != 1291 ) {
5844                 return false;
5845             }
5846             final Protein p3 = proteins.get( 2 );
5847             if ( p3.getNumberOfProteinDomains() != 2 ) {
5848                 return false;
5849             }
5850             final Protein p4 = proteins.get( 3 );
5851             if ( p4.getNumberOfProteinDomains() != 1 ) {
5852                 return false;
5853             }
5854             if ( !p4.getProteinDomain( 0 ).getDomainId().toString().equals( "DNA_pol_B_new" ) ) {
5855                 return false;
5856             }
5857             if ( p4.getProteinDomain( 0 ).getFrom() != 51 ) {
5858                 return false;
5859             }
5860             if ( p4.getProteinDomain( 0 ).getTo() != 395 ) {
5861                 return false;
5862             }
5863             if ( !Test.isEqual( p4.getProteinDomain( 0 ).getPerDomainEvalue(), 1.2e-39 ) ) {
5864                 return false;
5865             }
5866             if ( !Test.isEqual( p4.getProteinDomain( 0 ).getPerDomainScore(), 135.7 ) ) {
5867                 return false;
5868             }
5869             if ( !Test.isEqual( p4.getProteinDomain( 0 ).getNumber(), 1 ) ) {
5870                 return false;
5871             }
5872             if ( !Test.isEqual( p4.getProteinDomain( 0 ).getTotalCount(), 1 ) ) {
5873                 return false;
5874             }
5875         }
5876         catch ( final Exception e ) {
5877             e.printStackTrace( System.out );
5878             return false;
5879         }
5880         return true;
5881     }
5882
5883     private static boolean testLastExternalNodeMethods() {
5884         try {
5885             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
5886             final char[] a0 = { '(', '(', 'A', ',', 'B', ')', ',', '(', 'C', ',', 'D', ')', ')', };
5887             final Phylogeny t0 = factory.create( a0, new NHXParser() )[ 0 ];
5888             final PhylogenyNode n1 = t0.getNode( "A" );
5889             if ( n1.isLastExternalNode() ) {
5890                 return false;
5891             }
5892             final PhylogenyNode n2 = t0.getNode( "B" );
5893             if ( n2.isLastExternalNode() ) {
5894                 return false;
5895             }
5896             final PhylogenyNode n3 = t0.getNode( "C" );
5897             if ( n3.isLastExternalNode() ) {
5898                 return false;
5899             }
5900             final PhylogenyNode n4 = t0.getNode( "D" );
5901             if ( !n4.isLastExternalNode() ) {
5902                 return false;
5903             }
5904         }
5905         catch ( final Exception e ) {
5906             e.printStackTrace( System.out );
5907             return false;
5908         }
5909         return true;
5910     }
5911
5912     private static boolean testLevelOrderIterator() {
5913         try {
5914             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
5915             final Phylogeny t0 = factory.create( "((A,B)ab,(C,D)cd)r", new NHXParser() )[ 0 ];
5916             PhylogenyNodeIterator it0;
5917             for( it0 = t0.iteratorLevelOrder(); it0.hasNext(); ) {
5918                 it0.next();
5919             }
5920             for( it0.reset(); it0.hasNext(); ) {
5921                 it0.next();
5922             }
5923             final PhylogenyNodeIterator it = t0.iteratorLevelOrder();
5924             if ( !it.next().getName().equals( "r" ) ) {
5925                 return false;
5926             }
5927             if ( !it.next().getName().equals( "ab" ) ) {
5928                 return false;
5929             }
5930             if ( !it.next().getName().equals( "cd" ) ) {
5931                 return false;
5932             }
5933             if ( !it.next().getName().equals( "A" ) ) {
5934                 return false;
5935             }
5936             if ( !it.next().getName().equals( "B" ) ) {
5937                 return false;
5938             }
5939             if ( !it.next().getName().equals( "C" ) ) {
5940                 return false;
5941             }
5942             if ( !it.next().getName().equals( "D" ) ) {
5943                 return false;
5944             }
5945             if ( it.hasNext() ) {
5946                 return false;
5947             }
5948             final Phylogeny t2 = factory.create( "(((1,2,(a,(X,Y,Z)b)3,4,5,6)A,B,C)abc,(D,E,(f1,(f21)f2,f3)F,G)defg)r",
5949                                                  new NHXParser() )[ 0 ];
5950             PhylogenyNodeIterator it2;
5951             for( it2 = t2.iteratorLevelOrder(); it2.hasNext(); ) {
5952                 it2.next();
5953             }
5954             for( it2.reset(); it2.hasNext(); ) {
5955                 it2.next();
5956             }
5957             final PhylogenyNodeIterator it3 = t2.iteratorLevelOrder();
5958             if ( !it3.next().getName().equals( "r" ) ) {
5959                 return false;
5960             }
5961             if ( !it3.next().getName().equals( "abc" ) ) {
5962                 return false;
5963             }
5964             if ( !it3.next().getName().equals( "defg" ) ) {
5965                 return false;
5966             }
5967             if ( !it3.next().getName().equals( "A" ) ) {
5968                 return false;
5969             }
5970             if ( !it3.next().getName().equals( "B" ) ) {
5971                 return false;
5972             }
5973             if ( !it3.next().getName().equals( "C" ) ) {
5974                 return false;
5975             }
5976             if ( !it3.next().getName().equals( "D" ) ) {
5977                 return false;
5978             }
5979             if ( !it3.next().getName().equals( "E" ) ) {
5980                 return false;
5981             }
5982             if ( !it3.next().getName().equals( "F" ) ) {
5983                 return false;
5984             }
5985             if ( !it3.next().getName().equals( "G" ) ) {
5986                 return false;
5987             }
5988             if ( !it3.next().getName().equals( "1" ) ) {
5989                 return false;
5990             }
5991             if ( !it3.next().getName().equals( "2" ) ) {
5992                 return false;
5993             }
5994             if ( !it3.next().getName().equals( "3" ) ) {
5995                 return false;
5996             }
5997             if ( !it3.next().getName().equals( "4" ) ) {
5998                 return false;
5999             }
6000             if ( !it3.next().getName().equals( "5" ) ) {
6001                 return false;
6002             }
6003             if ( !it3.next().getName().equals( "6" ) ) {
6004                 return false;
6005             }
6006             if ( !it3.next().getName().equals( "f1" ) ) {
6007                 return false;
6008             }
6009             if ( !it3.next().getName().equals( "f2" ) ) {
6010                 return false;
6011             }
6012             if ( !it3.next().getName().equals( "f3" ) ) {
6013                 return false;
6014             }
6015             if ( !it3.next().getName().equals( "a" ) ) {
6016                 return false;
6017             }
6018             if ( !it3.next().getName().equals( "b" ) ) {
6019                 return false;
6020             }
6021             if ( !it3.next().getName().equals( "f21" ) ) {
6022                 return false;
6023             }
6024             if ( !it3.next().getName().equals( "X" ) ) {
6025                 return false;
6026             }
6027             if ( !it3.next().getName().equals( "Y" ) ) {
6028                 return false;
6029             }
6030             if ( !it3.next().getName().equals( "Z" ) ) {
6031                 return false;
6032             }
6033             if ( it3.hasNext() ) {
6034                 return false;
6035             }
6036             final Phylogeny t4 = factory.create( "((((D)C)B)A)r", new NHXParser() )[ 0 ];
6037             PhylogenyNodeIterator it4;
6038             for( it4 = t4.iteratorLevelOrder(); it4.hasNext(); ) {
6039                 it4.next();
6040             }
6041             for( it4.reset(); it4.hasNext(); ) {
6042                 it4.next();
6043             }
6044             final PhylogenyNodeIterator it5 = t4.iteratorLevelOrder();
6045             if ( !it5.next().getName().equals( "r" ) ) {
6046                 return false;
6047             }
6048             if ( !it5.next().getName().equals( "A" ) ) {
6049                 return false;
6050             }
6051             if ( !it5.next().getName().equals( "B" ) ) {
6052                 return false;
6053             }
6054             if ( !it5.next().getName().equals( "C" ) ) {
6055                 return false;
6056             }
6057             if ( !it5.next().getName().equals( "D" ) ) {
6058                 return false;
6059             }
6060             final Phylogeny t5 = factory.create( "A", new NHXParser() )[ 0 ];
6061             PhylogenyNodeIterator it6;
6062             for( it6 = t5.iteratorLevelOrder(); it6.hasNext(); ) {
6063                 it6.next();
6064             }
6065             for( it6.reset(); it6.hasNext(); ) {
6066                 it6.next();
6067             }
6068             final PhylogenyNodeIterator it7 = t5.iteratorLevelOrder();
6069             if ( !it7.next().getName().equals( "A" ) ) {
6070                 return false;
6071             }
6072             if ( it.hasNext() ) {
6073                 return false;
6074             }
6075         }
6076         catch ( final Exception e ) {
6077             e.printStackTrace( System.out );
6078             return false;
6079         }
6080         return true;
6081     }
6082
6083     private static boolean testMafft( final String path ) {
6084         try {
6085             final List<String> opts = new ArrayList<String>();
6086             opts.add( "--maxiterate" );
6087             opts.add( "1000" );
6088             opts.add( "--localpair" );
6089             opts.add( "--quiet" );
6090             Msa msa = null;
6091             final MsaInferrer mafft = Mafft.createInstance( path );
6092             msa = mafft.infer( new File( PATH_TO_TEST_DATA + "ncbi_sn.fasta" ), opts );
6093             if ( ( msa == null ) || ( msa.getLength() < 20 ) || ( msa.getNumberOfSequences() != 19 ) ) {
6094                 return false;
6095             }
6096             if ( !msa.getIdentifier( 0 ).toString().equals( "a" ) ) {
6097                 return false;
6098             }
6099         }
6100         catch ( final Exception e ) {
6101             e.printStackTrace( System.out );
6102             return false;
6103         }
6104         return true;
6105     }
6106
6107     private static boolean testMidpointrooting() {
6108         try {
6109             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
6110             final Phylogeny t0 = factory.create( "(A:1,B:4,C:2,D:2,E:6,F:1,G:1,H:1)", new NHXParser() )[ 0 ];
6111             PhylogenyMethods.midpointRoot( t0 );
6112             if ( !isEqual( t0.getNode( "E" ).getDistanceToParent(), 5 ) ) {
6113                 return false;
6114             }
6115             if ( !isEqual( t0.getNode( "B" ).getDistanceToParent(), 4 ) ) {
6116                 return false;
6117             }
6118             if ( !isEqual( PhylogenyMethods.calculateLCA( t0.getNode( "F" ), t0.getNode( "G" ) ).getDistanceToParent(),
6119                            1 ) ) {
6120                 return false;
6121             }
6122             final Phylogeny t1 = factory.create( "((A:1,B:2)AB:1[&&NHX:B=55],(C:3,D:4)CD:3[&&NHX:B=10])ABCD:0.5",
6123                                                  new NHXParser() )[ 0 ];
6124             if ( !t1.isRooted() ) {
6125                 return false;
6126             }
6127             PhylogenyMethods.midpointRoot( t1 );
6128             if ( !isEqual( t1.getNode( "A" ).getDistanceToParent(), 1 ) ) {
6129                 return false;
6130             }
6131             if ( !isEqual( t1.getNode( "B" ).getDistanceToParent(), 2 ) ) {
6132                 return false;
6133             }
6134             if ( !isEqual( t1.getNode( "C" ).getDistanceToParent(), 3 ) ) {
6135                 return false;
6136             }
6137             if ( !isEqual( t1.getNode( "D" ).getDistanceToParent(), 4 ) ) {
6138                 return false;
6139             }
6140             if ( !isEqual( t1.getNode( "CD" ).getDistanceToParent(), 1 ) ) {
6141                 return false;
6142             }
6143             if ( !isEqual( t1.getNode( "AB" ).getDistanceToParent(), 3 ) ) {
6144                 return false;
6145             }
6146             t1.reRoot( t1.getNode( "A" ) );
6147             PhylogenyMethods.midpointRoot( t1 );
6148             if ( !isEqual( t1.getNode( "A" ).getDistanceToParent(), 1 ) ) {
6149                 return false;
6150             }
6151             if ( !isEqual( t1.getNode( "B" ).getDistanceToParent(), 2 ) ) {
6152                 return false;
6153             }
6154             if ( !isEqual( t1.getNode( "C" ).getDistanceToParent(), 3 ) ) {
6155                 return false;
6156             }
6157             if ( !isEqual( t1.getNode( "D" ).getDistanceToParent(), 4 ) ) {
6158                 return false;
6159             }
6160             if ( !isEqual( t1.getNode( "CD" ).getDistanceToParent(), 1 ) ) {
6161                 System.exit( -1 );
6162                 return false;
6163             }
6164             if ( !isEqual( t1.getNode( "AB" ).getDistanceToParent(), 3 ) ) {
6165                 return false;
6166             }
6167         }
6168         catch ( final Exception e ) {
6169             e.printStackTrace( System.out );
6170             return false;
6171         }
6172         return true;
6173     }
6174
6175     private static boolean testMsaQualityMethod() {
6176         try {
6177             final MolecularSequence s0 = BasicSequence.createAaSequence( "a", "ABAXEFGHIJJE-" );
6178             final MolecularSequence s1 = BasicSequence.createAaSequence( "b", "ABBXEFGHIJJBB" );
6179             final MolecularSequence s2 = BasicSequence.createAaSequence( "c", "AXCXEFGHIJJ--" );
6180             final MolecularSequence s3 = BasicSequence.createAaSequence( "d", "AXDDEFGHIJ---" );
6181             final List<MolecularSequence> l = new ArrayList<MolecularSequence>();
6182             l.add( s0 );
6183             l.add( s1 );
6184             l.add( s2 );
6185             l.add( s3 );
6186             final Msa msa = BasicMsa.createInstance( l );
6187             if ( !isEqual( 1, MsaMethods.calculateIdentityRatio( msa, 0 ) ) ) {
6188                 return false;
6189             }
6190             if ( !isEqual( 0.5, MsaMethods.calculateIdentityRatio( msa, 1 ) ) ) {
6191                 return false;
6192             }
6193             if ( !isEqual( 0.25, MsaMethods.calculateIdentityRatio( msa, 2 ) ) ) {
6194                 return false;
6195             }
6196             if ( !isEqual( 0.75, MsaMethods.calculateIdentityRatio( msa, 3 ) ) ) {
6197                 return false;
6198             }
6199             if ( !isEqual( 0.75, MsaMethods.calculateIdentityRatio( msa, 10 ) ) ) {
6200                 return false;
6201             }
6202             if ( !isEqual( 0.25, MsaMethods.calculateIdentityRatio( msa, 11 ) ) ) {
6203                 return false;
6204             }
6205             if ( !isEqual( 0.25, MsaMethods.calculateIdentityRatio( msa, 12 ) ) ) {
6206                 return false;
6207             }
6208         }
6209         catch ( final Exception e ) {
6210             e.printStackTrace( System.out );
6211             return false;
6212         }
6213         return true;
6214     }
6215
6216     private static boolean testMsaEntropy() {
6217         try {
6218             final MolecularSequence s0 = BasicSequence.createAaSequence( "a", "AAAAAAA" );
6219             final MolecularSequence s1 = BasicSequence.createAaSequence( "b", "AAAIACC" );
6220             final MolecularSequence s2 = BasicSequence.createAaSequence( "c", "AAIIIIF" );
6221             final MolecularSequence s3 = BasicSequence.createAaSequence( "d", "AIIIVVW" );
6222             final List<MolecularSequence> l = new ArrayList<MolecularSequence>();
6223             l.add( s0 );
6224             l.add( s1 );
6225             l.add( s2 );
6226             l.add( s3 );
6227             final Msa msa = BasicMsa.createInstance( l );
6228             System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa, 0 ) );
6229             System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa, 1 ) );
6230             System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa, 2 ) );
6231             System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa, 3 ) );
6232             System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa, 4 ) );
6233             System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa, 5 ) );
6234             System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa, 6 ) );
6235             System.out.println();
6236             System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 6, msa, 0 ) );
6237             System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 6, msa, 1 ) );
6238             System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 6, msa, 2 ) );
6239             System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 6, msa, 3 ) );
6240             System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 6, msa, 4 ) );
6241             System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 6, msa, 5 ) );
6242             System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 6, msa, 6 ) );
6243             final List<MolecularSequence> l2 = new ArrayList<MolecularSequence>();
6244             l2.add( BasicSequence.createAaSequence( "1", "AAAAAAA" ) );
6245             l2.add( BasicSequence.createAaSequence( "2", "AAAIACC" ) );
6246             l2.add( BasicSequence.createAaSequence( "3", "AAIIIIF" ) );
6247             l2.add( BasicSequence.createAaSequence( "4", "AIIIVVW" ) );
6248             l2.add( BasicSequence.createAaSequence( "5", "AAAAAAA" ) );
6249             l2.add( BasicSequence.createAaSequence( "6", "AAAIACC" ) );
6250             l2.add( BasicSequence.createAaSequence( "7", "AAIIIIF" ) );
6251             l2.add( BasicSequence.createAaSequence( "8", "AIIIVVW" ) );
6252             l2.add( BasicSequence.createAaSequence( "9", "AAAAAAA" ) );
6253             l2.add( BasicSequence.createAaSequence( "10", "AAAIACC" ) );
6254             l2.add( BasicSequence.createAaSequence( "11", "AAIIIIF" ) );
6255             l2.add( BasicSequence.createAaSequence( "12", "AIIIVVW" ) );
6256             l2.add( BasicSequence.createAaSequence( "13", "AAIIIIF" ) );
6257             l2.add( BasicSequence.createAaSequence( "14", "AIIIVVW" ) );
6258             l2.add( BasicSequence.createAaSequence( "15", "AAAAAAA" ) );
6259             l2.add( BasicSequence.createAaSequence( "16", "AAAIACC" ) );
6260             l2.add( BasicSequence.createAaSequence( "17", "AAIIIIF" ) );
6261             l2.add( BasicSequence.createAaSequence( "18", "AIIIVVW" ) );
6262             l2.add( BasicSequence.createAaSequence( "19", "AAAAAAA" ) );
6263             l2.add( BasicSequence.createAaSequence( "20", "AAAIACC" ) );
6264             l2.add( BasicSequence.createAaSequence( "21", "AAIIIIF" ) );
6265             l2.add( BasicSequence.createAaSequence( "22", "AIIIVVW" ) );
6266             final Msa msa2 = BasicMsa.createInstance( l2 );
6267             System.out.println();
6268             System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa2, 0 ) );
6269             System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa2, 1 ) );
6270             System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa2, 2 ) );
6271         }
6272         catch ( final Exception e ) {
6273             e.printStackTrace( System.out );
6274             return false;
6275         }
6276         return true;
6277     }
6278
6279     private static boolean testDeleteableMsa() {
6280         try {
6281             final MolecularSequence s0 = BasicSequence.createAaSequence( "a", "AAAA" );
6282             final MolecularSequence s1 = BasicSequence.createAaSequence( "b", "BAAA" );
6283             final MolecularSequence s2 = BasicSequence.createAaSequence( "c", "CAAA" );
6284             final MolecularSequence s3 = BasicSequence.createAaSequence( "d", "DAAA" );
6285             final MolecularSequence s4 = BasicSequence.createAaSequence( "e", "EAAA" );
6286             final MolecularSequence s5 = BasicSequence.createAaSequence( "f", "FAAA" );
6287             final List<MolecularSequence> l0 = new ArrayList<MolecularSequence>();
6288             l0.add( s0 );
6289             l0.add( s1 );
6290             l0.add( s2 );
6291             l0.add( s3 );
6292             l0.add( s4 );
6293             l0.add( s5 );
6294             final DeleteableMsa dmsa0 = DeleteableMsa.createInstance( l0 );
6295             dmsa0.deleteRow( "b", false );
6296             if ( !dmsa0.getIdentifier( 1 ).equals( "c" ) ) {
6297                 return false;
6298             }
6299             dmsa0.deleteRow( "e", false );
6300             dmsa0.deleteRow( "a", false );
6301             dmsa0.deleteRow( "f", false );
6302             if ( dmsa0.getLength() != 4 ) {
6303                 return false;
6304             }
6305             if ( dmsa0.getNumberOfSequences() != 2 ) {
6306                 return false;
6307             }
6308             if ( !dmsa0.getIdentifier( 0 ).equals( "c" ) ) {
6309                 return false;
6310             }
6311             if ( !dmsa0.getIdentifier( 1 ).equals( "d" ) ) {
6312                 return false;
6313             }
6314             if ( dmsa0.getResidueAt( 0, 0 ) != 'C' ) {
6315                 return false;
6316             }
6317             if ( !dmsa0.getSequenceAsString( 0 ).toString().equals( "CAAA" ) ) {
6318                 return false;
6319             }
6320             if ( dmsa0.getColumnAt( 0 ).size() != 2 ) {
6321                 return false;
6322             }
6323             dmsa0.deleteRow( "c", false );
6324             dmsa0.deleteRow( "d", false );
6325             if ( dmsa0.getNumberOfSequences() != 0 ) {
6326                 return false;
6327             }
6328             //
6329             final MolecularSequence s_0 = BasicSequence.createAaSequence( "a", "--A---B-C--X----" );
6330             final MolecularSequence s_1 = BasicSequence.createAaSequence( "b", "--B-----C-------" );
6331             final MolecularSequence s_2 = BasicSequence.createAaSequence( "c", "--C--AB-C------Z" );
6332             final MolecularSequence s_3 = BasicSequence.createAaSequence( "d", "--D--AA-C-------" );
6333             final MolecularSequence s_4 = BasicSequence.createAaSequence( "e", "--E--AA-C-------" );
6334             final MolecularSequence s_5 = BasicSequence.createAaSequence( "f", "--F--AB-CD--Y---" );
6335             final List<MolecularSequence> l1 = new ArrayList<MolecularSequence>();
6336             l1.add( s_0 );
6337             l1.add( s_1 );
6338             l1.add( s_2 );
6339             l1.add( s_3 );
6340             l1.add( s_4 );
6341             l1.add( s_5 );
6342             final DeleteableMsa dmsa1 = DeleteableMsa.createInstance( l1 );
6343             dmsa1.deleteGapOnlyColumns();
6344             dmsa1.deleteRow( "a", false );
6345             dmsa1.deleteRow( "f", false );
6346             dmsa1.deleteRow( "d", false );
6347             dmsa1.deleteGapOnlyColumns();
6348             if ( !dmsa1.getSequenceAsString( 0 ).toString().equals( "B--C-" ) ) {
6349                 return false;
6350             }
6351             if ( !dmsa1.getSequenceAsString( 1 ).toString().equals( "CABCZ" ) ) {
6352                 return false;
6353             }
6354             if ( !dmsa1.getSequenceAsString( 2 ).toString().equals( "EAAC-" ) ) {
6355                 return false;
6356             }
6357             dmsa1.deleteRow( "c", false );
6358             dmsa1.deleteGapOnlyColumns();
6359             final Writer w0 = new StringWriter();
6360             dmsa1.write( w0, MSA_FORMAT.FASTA );
6361             final Writer w1 = new StringWriter();
6362             dmsa1.write( w1, MSA_FORMAT.PHYLIP );
6363             if ( !dmsa1.getSequenceAsString( 0 ).toString().equals( "B--C" ) ) {
6364                 return false;
6365             }
6366             if ( !dmsa1.getSequenceAsString( 1 ).toString().equals( "EAAC" ) ) {
6367                 return false;
6368             }
6369             final MolecularSequence s__0 = BasicSequence.createAaSequence( "a", "A------" );
6370             final MolecularSequence s__1 = BasicSequence.createAaSequence( "b", "BB-----" );
6371             final MolecularSequence s__2 = BasicSequence.createAaSequence( "c", "CCC----" );
6372             final MolecularSequence s__3 = BasicSequence.createAaSequence( "d", "DDDD---" );
6373             final MolecularSequence s__4 = BasicSequence.createAaSequence( "e", "EEEEE--" );
6374             final MolecularSequence s__5 = BasicSequence.createAaSequence( "f", "FFFFFF-" );
6375             final List<MolecularSequence> l2 = new ArrayList<MolecularSequence>();
6376             l2.add( s__0 );
6377             l2.add( s__1 );
6378             l2.add( s__2 );
6379             l2.add( s__3 );
6380             l2.add( s__4 );
6381             l2.add( s__5 );
6382             final DeleteableMsa dmsa2 = DeleteableMsa.createInstance( l2 );
6383             dmsa2.deleteGapColumns( 0.5 );
6384             if ( !dmsa2.getSequenceAsString( 0 ).toString().equals( "A---" ) ) {
6385                 return false;
6386             }
6387             if ( !dmsa2.getSequenceAsString( 1 ).toString().equals( "BB--" ) ) {
6388                 return false;
6389             }
6390             if ( !dmsa2.getSequenceAsString( 2 ).toString().equals( "CCC-" ) ) {
6391                 return false;
6392             }
6393             dmsa2.deleteGapColumns( 0.2 );
6394             if ( !dmsa2.getSequenceAsString( 0 ).toString().equals( "A-" ) ) {
6395                 return false;
6396             }
6397             if ( !dmsa2.getSequenceAsString( 1 ).toString().equals( "BB" ) ) {
6398                 return false;
6399             }
6400             if ( !dmsa2.getSequenceAsString( 2 ).toString().equals( "CC" ) ) {
6401                 return false;
6402             }
6403             dmsa2.deleteGapColumns( 0 );
6404             dmsa2.deleteRow( "a", false );
6405             dmsa2.deleteRow( "b", false );
6406             dmsa2.deleteRow( "f", false );
6407             dmsa2.deleteRow( "e", false );
6408             dmsa2.setIdentifier( 0, "new_c" );
6409             dmsa2.setIdentifier( 1, "new_d" );
6410             dmsa2.setResidueAt( 0, 0, 'x' );
6411             final MolecularSequence s = dmsa2.deleteRow( "new_d", true );
6412             if ( !s.getMolecularSequenceAsString().equals( "D" ) ) {
6413                 return false;
6414             }
6415             final Writer w = new StringWriter();
6416             dmsa2.write( w, MSA_FORMAT.PHYLIP );
6417             final String phylip = w.toString();
6418             if ( !phylip.equals( "1 1" + ForesterUtil.LINE_SEPARATOR + "new_c x" + ForesterUtil.LINE_SEPARATOR ) ) {
6419                 System.out.println( phylip );
6420                 return false;
6421             }
6422             final Writer w2 = new StringWriter();
6423             dmsa2.write( w2, MSA_FORMAT.FASTA );
6424             final String fasta = w2.toString();
6425             if ( !fasta.equals( ">new_c" + ForesterUtil.LINE_SEPARATOR + "x" + ForesterUtil.LINE_SEPARATOR ) ) {
6426                 System.out.println( fasta );
6427                 return false;
6428             }
6429         }
6430         catch ( final Exception e ) {
6431             e.printStackTrace( System.out );
6432             return false;
6433         }
6434         return true;
6435     }
6436
6437     private static boolean testNextNodeWithCollapsing() {
6438         try {
6439             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
6440             PhylogenyNode n;
6441             List<PhylogenyNode> ext = new ArrayList<PhylogenyNode>();
6442             final StringBuffer sb0 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h))fgh)cdefgh)abcdefgh" );
6443             final Phylogeny t0 = factory.create( sb0, new NHXParser() )[ 0 ];
6444             t0.getNode( "cd" ).setCollapse( true );
6445             t0.getNode( "cde" ).setCollapse( true );
6446             n = t0.getFirstExternalNode();
6447             while ( n != null ) {
6448                 ext.add( n );
6449                 n = n.getNextExternalNodeWhileTakingIntoAccountCollapsedNodes();
6450             }
6451             if ( !ext.get( 0 ).getName().equals( "a" ) ) {
6452                 return false;
6453             }
6454             if ( !ext.get( 1 ).getName().equals( "b" ) ) {
6455                 return false;
6456             }
6457             if ( !ext.get( 2 ).getName().equals( "cde" ) ) {
6458                 return false;
6459             }
6460             if ( !ext.get( 3 ).getName().equals( "f" ) ) {
6461                 return false;
6462             }
6463             if ( !ext.get( 4 ).getName().equals( "g" ) ) {
6464                 return false;
6465             }
6466             if ( !ext.get( 5 ).getName().equals( "h" ) ) {
6467                 return false;
6468             }
6469             ext.clear();
6470             final StringBuffer sb1 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h))fgh)cdefgh)abcdefgh" );
6471             final Phylogeny t1 = factory.create( sb1, new NHXParser() )[ 0 ];
6472             t1.getNode( "ab" ).setCollapse( true );
6473             t1.getNode( "cd" ).setCollapse( true );
6474             t1.getNode( "cde" ).setCollapse( true );
6475             n = t1.getNode( "ab" );
6476             ext = new ArrayList<PhylogenyNode>();
6477             while ( n != null ) {
6478                 ext.add( n );
6479                 n = n.getNextExternalNodeWhileTakingIntoAccountCollapsedNodes();
6480             }
6481             if ( !ext.get( 0 ).getName().equals( "ab" ) ) {
6482                 return false;
6483             }
6484             if ( !ext.get( 1 ).getName().equals( "cde" ) ) {
6485                 return false;
6486             }
6487             if ( !ext.get( 2 ).getName().equals( "f" ) ) {
6488                 return false;
6489             }
6490             if ( !ext.get( 3 ).getName().equals( "g" ) ) {
6491                 return false;
6492             }
6493             if ( !ext.get( 4 ).getName().equals( "h" ) ) {
6494                 return false;
6495             }
6496             ext.clear();
6497             final StringBuffer sb2 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h)gh)fgh)cdefgh)abcdefgh" );
6498             final Phylogeny t2 = factory.create( sb2, new NHXParser() )[ 0 ];
6499             t2.getNode( "ab" ).setCollapse( true );
6500             t2.getNode( "cd" ).setCollapse( true );
6501             t2.getNode( "cde" ).setCollapse( true );
6502             t2.getNode( "c" ).setCollapse( true );
6503             t2.getNode( "d" ).setCollapse( true );
6504             t2.getNode( "e" ).setCollapse( true );
6505             t2.getNode( "gh" ).setCollapse( true );
6506             n = t2.getNode( "ab" );
6507             ext = new ArrayList<PhylogenyNode>();
6508             while ( n != null ) {
6509                 ext.add( n );
6510                 n = n.getNextExternalNodeWhileTakingIntoAccountCollapsedNodes();
6511             }
6512             if ( !ext.get( 0 ).getName().equals( "ab" ) ) {
6513                 return false;
6514             }
6515             if ( !ext.get( 1 ).getName().equals( "cde" ) ) {
6516                 return false;
6517             }
6518             if ( !ext.get( 2 ).getName().equals( "f" ) ) {
6519                 return false;
6520             }
6521             if ( !ext.get( 3 ).getName().equals( "gh" ) ) {
6522                 return false;
6523             }
6524             ext.clear();
6525             final StringBuffer sb3 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h)gh)fgh)cdefgh)abcdefgh" );
6526             final Phylogeny t3 = factory.create( sb3, new NHXParser() )[ 0 ];
6527             t3.getNode( "ab" ).setCollapse( true );
6528             t3.getNode( "cd" ).setCollapse( true );
6529             t3.getNode( "cde" ).setCollapse( true );
6530             t3.getNode( "c" ).setCollapse( true );
6531             t3.getNode( "d" ).setCollapse( true );
6532             t3.getNode( "e" ).setCollapse( true );
6533             t3.getNode( "gh" ).setCollapse( true );
6534             t3.getNode( "fgh" ).setCollapse( true );
6535             n = t3.getNode( "ab" );
6536             ext = new ArrayList<PhylogenyNode>();
6537             while ( n != null ) {
6538                 ext.add( n );
6539                 n = n.getNextExternalNodeWhileTakingIntoAccountCollapsedNodes();
6540             }
6541             if ( !ext.get( 0 ).getName().equals( "ab" ) ) {
6542                 return false;
6543             }
6544             if ( !ext.get( 1 ).getName().equals( "cde" ) ) {
6545                 return false;
6546             }
6547             if ( !ext.get( 2 ).getName().equals( "fgh" ) ) {
6548                 return false;
6549             }
6550             ext.clear();
6551             final StringBuffer sb4 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h)gh)fgh)cdefgh)abcdefgh" );
6552             final Phylogeny t4 = factory.create( sb4, new NHXParser() )[ 0 ];
6553             t4.getNode( "ab" ).setCollapse( true );
6554             t4.getNode( "cd" ).setCollapse( true );
6555             t4.getNode( "cde" ).setCollapse( true );
6556             t4.getNode( "c" ).setCollapse( true );
6557             t4.getNode( "d" ).setCollapse( true );
6558             t4.getNode( "e" ).setCollapse( true );
6559             t4.getNode( "gh" ).setCollapse( true );
6560             t4.getNode( "fgh" ).setCollapse( true );
6561             t4.getNode( "abcdefgh" ).setCollapse( true );
6562             n = t4.getNode( "abcdefgh" );
6563             if ( n.getNextExternalNodeWhileTakingIntoAccountCollapsedNodes() != null ) {
6564                 return false;
6565             }
6566             final StringBuffer sb5 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h))fgh)cdefgh)abcdefgh" );
6567             final Phylogeny t5 = factory.create( sb5, new NHXParser() )[ 0 ];
6568             ext.clear();
6569             n = t5.getFirstExternalNode();
6570             while ( n != null ) {
6571                 ext.add( n );
6572                 n = n.getNextExternalNodeWhileTakingIntoAccountCollapsedNodes();
6573             }
6574             if ( ext.size() != 8 ) {
6575                 return false;
6576             }
6577             if ( !ext.get( 0 ).getName().equals( "a" ) ) {
6578                 return false;
6579             }
6580             if ( !ext.get( 1 ).getName().equals( "b" ) ) {
6581                 return false;
6582             }
6583             if ( !ext.get( 2 ).getName().equals( "c" ) ) {
6584                 return false;
6585             }
6586             if ( !ext.get( 3 ).getName().equals( "d" ) ) {
6587                 return false;
6588             }
6589             if ( !ext.get( 4 ).getName().equals( "e" ) ) {
6590                 return false;
6591             }
6592             if ( !ext.get( 5 ).getName().equals( "f" ) ) {
6593                 return false;
6594             }
6595             if ( !ext.get( 6 ).getName().equals( "g" ) ) {
6596                 return false;
6597             }
6598             if ( !ext.get( 7 ).getName().equals( "h" ) ) {
6599                 return false;
6600             }
6601             final StringBuffer sb6 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h))fgh)cdefgh)abcdefgh" );
6602             final Phylogeny t6 = factory.create( sb6, new NHXParser() )[ 0 ];
6603             ext.clear();
6604             t6.getNode( "ab" ).setCollapse( true );
6605             n = t6.getNode( "ab" );
6606             while ( n != null ) {
6607                 ext.add( n );
6608                 n = n.getNextExternalNodeWhileTakingIntoAccountCollapsedNodes();
6609             }
6610             if ( ext.size() != 7 ) {
6611                 return false;
6612             }
6613             if ( !ext.get( 0 ).getName().equals( "ab" ) ) {
6614                 return false;
6615             }
6616             if ( !ext.get( 1 ).getName().equals( "c" ) ) {
6617                 return false;
6618             }
6619             if ( !ext.get( 2 ).getName().equals( "d" ) ) {
6620                 return false;
6621             }
6622             if ( !ext.get( 3 ).getName().equals( "e" ) ) {
6623                 return false;
6624             }
6625             if ( !ext.get( 4 ).getName().equals( "f" ) ) {
6626                 return false;
6627             }
6628             if ( !ext.get( 5 ).getName().equals( "g" ) ) {
6629                 return false;
6630             }
6631             if ( !ext.get( 6 ).getName().equals( "h" ) ) {
6632                 return false;
6633             }
6634             final StringBuffer sb7 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h))fgh)cdefgh)abcdefgh" );
6635             final Phylogeny t7 = factory.create( sb7, new NHXParser() )[ 0 ];
6636             ext.clear();
6637             t7.getNode( "cd" ).setCollapse( true );
6638             n = t7.getNode( "a" );
6639             while ( n != null ) {
6640                 ext.add( n );
6641                 n = n.getNextExternalNodeWhileTakingIntoAccountCollapsedNodes();
6642             }
6643             if ( ext.size() != 7 ) {
6644                 return false;
6645             }
6646             if ( !ext.get( 0 ).getName().equals( "a" ) ) {
6647                 return false;
6648             }
6649             if ( !ext.get( 1 ).getName().equals( "b" ) ) {
6650                 return false;
6651             }
6652             if ( !ext.get( 2 ).getName().equals( "cd" ) ) {
6653                 return false;
6654             }
6655             if ( !ext.get( 3 ).getName().equals( "e" ) ) {
6656                 return false;
6657             }
6658             if ( !ext.get( 4 ).getName().equals( "f" ) ) {
6659                 return false;
6660             }
6661             if ( !ext.get( 5 ).getName().equals( "g" ) ) {
6662                 return false;
6663             }
6664             if ( !ext.get( 6 ).getName().equals( "h" ) ) {
6665                 return false;
6666             }
6667             final StringBuffer sb8 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h))fgh)cdefgh)abcdefgh" );
6668             final Phylogeny t8 = factory.create( sb8, new NHXParser() )[ 0 ];
6669             ext.clear();
6670             t8.getNode( "cd" ).setCollapse( true );
6671             t8.getNode( "c" ).setCollapse( true );
6672             t8.getNode( "d" ).setCollapse( true );
6673             n = t8.getNode( "a" );
6674             while ( n != null ) {
6675                 ext.add( n );
6676                 n = n.getNextExternalNodeWhileTakingIntoAccountCollapsedNodes();
6677             }
6678             if ( ext.size() != 7 ) {
6679                 return false;
6680             }
6681             if ( !ext.get( 0 ).getName().equals( "a" ) ) {
6682                 return false;
6683             }
6684             if ( !ext.get( 1 ).getName().equals( "b" ) ) {
6685                 return false;
6686             }
6687             if ( !ext.get( 2 ).getName().equals( "cd" ) ) {
6688                 System.out.println( "2 fail" );
6689                 return false;
6690             }
6691             if ( !ext.get( 3 ).getName().equals( "e" ) ) {
6692                 return false;
6693             }
6694             if ( !ext.get( 4 ).getName().equals( "f" ) ) {
6695                 return false;
6696             }
6697             if ( !ext.get( 5 ).getName().equals( "g" ) ) {
6698                 return false;
6699             }
6700             if ( !ext.get( 6 ).getName().equals( "h" ) ) {
6701                 return false;
6702             }
6703             final StringBuffer sb9 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h)gh)fgh)cdefgh)abcdefgh" );
6704             final Phylogeny t9 = factory.create( sb9, new NHXParser() )[ 0 ];
6705             ext.clear();
6706             t9.getNode( "gh" ).setCollapse( true );
6707             n = t9.getNode( "a" );
6708             while ( n != null ) {
6709                 ext.add( n );
6710                 n = n.getNextExternalNodeWhileTakingIntoAccountCollapsedNodes();
6711             }
6712             if ( ext.size() != 7 ) {
6713                 return false;
6714             }
6715             if ( !ext.get( 0 ).getName().equals( "a" ) ) {
6716                 return false;
6717             }
6718             if ( !ext.get( 1 ).getName().equals( "b" ) ) {
6719                 return false;
6720             }
6721             if ( !ext.get( 2 ).getName().equals( "c" ) ) {
6722                 return false;
6723             }
6724             if ( !ext.get( 3 ).getName().equals( "d" ) ) {
6725                 return false;
6726             }
6727             if ( !ext.get( 4 ).getName().equals( "e" ) ) {
6728                 return false;
6729             }
6730             if ( !ext.get( 5 ).getName().equals( "f" ) ) {
6731                 return false;
6732             }
6733             if ( !ext.get( 6 ).getName().equals( "gh" ) ) {
6734                 return false;
6735             }
6736             final StringBuffer sb10 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h)gh)fgh)cdefgh)abcdefgh" );
6737             final Phylogeny t10 = factory.create( sb10, new NHXParser() )[ 0 ];
6738             ext.clear();
6739             t10.getNode( "gh" ).setCollapse( true );
6740             t10.getNode( "g" ).setCollapse( true );
6741             t10.getNode( "h" ).setCollapse( true );
6742             n = t10.getNode( "a" );
6743             while ( n != null ) {
6744                 ext.add( n );
6745                 n = n.getNextExternalNodeWhileTakingIntoAccountCollapsedNodes();
6746             }
6747             if ( ext.size() != 7 ) {
6748                 return false;
6749             }
6750             if ( !ext.get( 0 ).getName().equals( "a" ) ) {
6751                 return false;
6752             }
6753             if ( !ext.get( 1 ).getName().equals( "b" ) ) {
6754                 return false;
6755             }
6756             if ( !ext.get( 2 ).getName().equals( "c" ) ) {
6757                 return false;
6758             }
6759             if ( !ext.get( 3 ).getName().equals( "d" ) ) {
6760                 return false;
6761             }
6762             if ( !ext.get( 4 ).getName().equals( "e" ) ) {
6763                 return false;
6764             }
6765             if ( !ext.get( 5 ).getName().equals( "f" ) ) {
6766                 return false;
6767             }
6768             if ( !ext.get( 6 ).getName().equals( "gh" ) ) {
6769                 return false;
6770             }
6771             final StringBuffer sb11 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h)gh)fgh)cdefgh)abcdefgh" );
6772             final Phylogeny t11 = factory.create( sb11, new NHXParser() )[ 0 ];
6773             ext.clear();
6774             t11.getNode( "gh" ).setCollapse( true );
6775             t11.getNode( "fgh" ).setCollapse( true );
6776             n = t11.getNode( "a" );
6777             while ( n != null ) {
6778                 ext.add( n );
6779                 n = n.getNextExternalNodeWhileTakingIntoAccountCollapsedNodes();
6780             }
6781             if ( ext.size() != 6 ) {
6782                 return false;
6783             }
6784             if ( !ext.get( 0 ).getName().equals( "a" ) ) {
6785                 return false;
6786             }
6787             if ( !ext.get( 1 ).getName().equals( "b" ) ) {
6788                 return false;
6789             }
6790             if ( !ext.get( 2 ).getName().equals( "c" ) ) {
6791                 return false;
6792             }
6793             if ( !ext.get( 3 ).getName().equals( "d" ) ) {
6794                 return false;
6795             }
6796             if ( !ext.get( 4 ).getName().equals( "e" ) ) {
6797                 return false;
6798             }
6799             if ( !ext.get( 5 ).getName().equals( "fgh" ) ) {
6800                 return false;
6801             }
6802             final StringBuffer sb12 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h)gh)fgh)cdefgh)abcdefgh" );
6803             final Phylogeny t12 = factory.create( sb12, new NHXParser() )[ 0 ];
6804             ext.clear();
6805             t12.getNode( "gh" ).setCollapse( true );
6806             t12.getNode( "fgh" ).setCollapse( true );
6807             t12.getNode( "g" ).setCollapse( true );
6808             t12.getNode( "h" ).setCollapse( true );
6809             t12.getNode( "f" ).setCollapse( true );
6810             n = t12.getNode( "a" );
6811             while ( n != null ) {
6812                 ext.add( n );
6813                 n = n.getNextExternalNodeWhileTakingIntoAccountCollapsedNodes();
6814             }
6815             if ( ext.size() != 6 ) {
6816                 return false;
6817             }
6818             if ( !ext.get( 0 ).getName().equals( "a" ) ) {
6819                 return false;
6820             }
6821             if ( !ext.get( 1 ).getName().equals( "b" ) ) {
6822                 return false;
6823             }
6824             if ( !ext.get( 2 ).getName().equals( "c" ) ) {
6825                 return false;
6826             }
6827             if ( !ext.get( 3 ).getName().equals( "d" ) ) {
6828                 return false;
6829             }
6830             if ( !ext.get( 4 ).getName().equals( "e" ) ) {
6831                 return false;
6832             }
6833             if ( !ext.get( 5 ).getName().equals( "fgh" ) ) {
6834                 return false;
6835             }
6836             final StringBuffer sb13 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h)gh)fgh)cdefgh)abcdefgh" );
6837             final Phylogeny t13 = factory.create( sb13, new NHXParser() )[ 0 ];
6838             ext.clear();
6839             t13.getNode( "ab" ).setCollapse( true );
6840             t13.getNode( "b" ).setCollapse( true );
6841             t13.getNode( "fgh" ).setCollapse( true );
6842             t13.getNode( "gh" ).setCollapse( true );
6843             n = t13.getNode( "ab" );
6844             while ( n != null ) {
6845                 ext.add( n );
6846                 n = n.getNextExternalNodeWhileTakingIntoAccountCollapsedNodes();
6847             }
6848             if ( ext.size() != 5 ) {
6849                 return false;
6850             }
6851             if ( !ext.get( 0 ).getName().equals( "ab" ) ) {
6852                 return false;
6853             }
6854             if ( !ext.get( 1 ).getName().equals( "c" ) ) {
6855                 return false;
6856             }
6857             if ( !ext.get( 2 ).getName().equals( "d" ) ) {
6858                 return false;
6859             }
6860             if ( !ext.get( 3 ).getName().equals( "e" ) ) {
6861                 return false;
6862             }
6863             if ( !ext.get( 4 ).getName().equals( "fgh" ) ) {
6864                 return false;
6865             }
6866             final StringBuffer sb14 = new StringBuffer( "((a,b,0)ab,(((c,d)cd,e)cde,(f,(g,h,1,2)gh,0)fgh)cdefgh)abcdefgh" );
6867             final Phylogeny t14 = factory.create( sb14, new NHXParser() )[ 0 ];
6868             ext.clear();
6869             t14.getNode( "ab" ).setCollapse( true );
6870             t14.getNode( "a" ).setCollapse( true );
6871             t14.getNode( "fgh" ).setCollapse( true );
6872             t14.getNode( "gh" ).setCollapse( true );
6873             n = t14.getNode( "ab" );
6874             while ( n != null ) {
6875                 ext.add( n );
6876                 n = n.getNextExternalNodeWhileTakingIntoAccountCollapsedNodes();
6877             }
6878             if ( ext.size() != 5 ) {
6879                 return false;
6880             }
6881             if ( !ext.get( 0 ).getName().equals( "ab" ) ) {
6882                 return false;
6883             }
6884             if ( !ext.get( 1 ).getName().equals( "c" ) ) {
6885                 return false;
6886             }
6887             if ( !ext.get( 2 ).getName().equals( "d" ) ) {
6888                 return false;
6889             }
6890             if ( !ext.get( 3 ).getName().equals( "e" ) ) {
6891                 return false;
6892             }
6893             if ( !ext.get( 4 ).getName().equals( "fgh" ) ) {
6894                 return false;
6895             }
6896             final StringBuffer sb15 = new StringBuffer( "((a,b,0)ab,(((c,d)cd,e)cde,x,(f,(g,h,1,2)gh,0)fgh)cdefgh)abcdefgh" );
6897             final Phylogeny t15 = factory.create( sb15, new NHXParser() )[ 0 ];
6898             ext.clear();
6899             t15.getNode( "ab" ).setCollapse( true );
6900             t15.getNode( "a" ).setCollapse( true );
6901             t15.getNode( "fgh" ).setCollapse( true );
6902             t15.getNode( "gh" ).setCollapse( true );
6903             n = t15.getNode( "ab" );
6904             while ( n != null ) {
6905                 ext.add( n );
6906                 n = n.getNextExternalNodeWhileTakingIntoAccountCollapsedNodes();
6907             }
6908             if ( ext.size() != 6 ) {
6909                 return false;
6910             }
6911             if ( !ext.get( 0 ).getName().equals( "ab" ) ) {
6912                 return false;
6913             }
6914             if ( !ext.get( 1 ).getName().equals( "c" ) ) {
6915                 return false;
6916             }
6917             if ( !ext.get( 2 ).getName().equals( "d" ) ) {
6918                 return false;
6919             }
6920             if ( !ext.get( 3 ).getName().equals( "e" ) ) {
6921                 return false;
6922             }
6923             if ( !ext.get( 4 ).getName().equals( "x" ) ) {
6924                 return false;
6925             }
6926             if ( !ext.get( 5 ).getName().equals( "fgh" ) ) {
6927                 return false;
6928             }
6929             //
6930             //
6931             final StringBuffer sb16 = new StringBuffer( "((a,b,0)ab,(((c,d)cd,e)cde,x,(f,(g,h,1,2)gh,0)fgh)cdefgh)abcdefgh" );
6932             final Phylogeny t16 = factory.create( sb16, new NHXParser() )[ 0 ];
6933             ext.clear();
6934             t16.getNode( "ab" ).setCollapse( true );
6935             t16.getNode( "a" ).setCollapse( true );
6936             t16.getNode( "fgh" ).setCollapse( true );
6937             t16.getNode( "gh" ).setCollapse( true );
6938             t16.getNode( "cd" ).setCollapse( true );
6939             t16.getNode( "cde" ).setCollapse( true );
6940             t16.getNode( "d" ).setCollapse( true );
6941             t16.getNode( "x" ).setCollapse( true );
6942             n = t16.getNode( "ab" );
6943             while ( n != null ) {
6944                 ext.add( n );
6945                 n = n.getNextExternalNodeWhileTakingIntoAccountCollapsedNodes();
6946             }
6947             if ( ext.size() != 4 ) {
6948                 return false;
6949             }
6950             if ( !ext.get( 0 ).getName().equals( "ab" ) ) {
6951                 return false;
6952             }
6953             if ( !ext.get( 1 ).getName().equals( "cde" ) ) {
6954                 return false;
6955             }
6956             if ( !ext.get( 2 ).getName().equals( "x" ) ) {
6957                 return false;
6958             }
6959             if ( !ext.get( 3 ).getName().equals( "fgh" ) ) {
6960                 return false;
6961             }
6962         }
6963         catch ( final Exception e ) {
6964             e.printStackTrace( System.out );
6965             return false;
6966         }
6967         return true;
6968     }
6969
6970     private static boolean testNexusCharactersParsing() {
6971         try {
6972             final NexusCharactersParser parser = new NexusCharactersParser();
6973             parser.setSource( new File( Test.PATH_TO_TEST_DATA + "nexus_test_7.nex" ) );
6974             parser.parse();
6975             String[] labels = parser.getCharStateLabels();
6976             if ( labels.length != 7 ) {
6977                 return false;
6978             }
6979             if ( !labels[ 0 ].equals( "14-3-3" ) ) {
6980                 return false;
6981             }
6982             if ( !labels[ 1 ].equals( "2-Hacid_dh" ) ) {
6983                 return false;
6984             }
6985             if ( !labels[ 2 ].equals( "2-Hacid_dh_C" ) ) {
6986                 return false;
6987             }
6988             if ( !labels[ 3 ].equals( "2-oxoacid_dh" ) ) {
6989                 return false;
6990             }
6991             if ( !labels[ 4 ].equals( "2OG-FeII_Oxy" ) ) {
6992                 return false;
6993             }
6994             if ( !labels[ 5 ].equals( "3-HAO" ) ) {
6995                 return false;
6996             }
6997             if ( !labels[ 6 ].equals( "3_5_exonuc" ) ) {
6998                 return false;
6999             }
7000             parser.setSource( new File( Test.PATH_TO_TEST_DATA + "nexus_test_8.nex" ) );
7001             parser.parse();
7002             labels = parser.getCharStateLabels();
7003             if ( labels.length != 7 ) {
7004                 return false;
7005             }
7006             if ( !labels[ 0 ].equals( "14-3-3" ) ) {
7007                 return false;
7008             }
7009             if ( !labels[ 1 ].equals( "2-Hacid_dh" ) ) {
7010                 return false;
7011             }
7012             if ( !labels[ 2 ].equals( "2-Hacid_dh_C" ) ) {
7013                 return false;
7014             }
7015             if ( !labels[ 3 ].equals( "2-oxoacid_dh" ) ) {
7016                 return false;
7017             }
7018             if ( !labels[ 4 ].equals( "2OG-FeII_Oxy" ) ) {
7019                 return false;
7020             }
7021             if ( !labels[ 5 ].equals( "3-HAO" ) ) {
7022                 return false;
7023             }
7024             if ( !labels[ 6 ].equals( "3_5_exonuc" ) ) {
7025                 return false;
7026             }
7027         }
7028         catch ( final Exception e ) {
7029             e.printStackTrace( System.out );
7030             return false;
7031         }
7032         return true;
7033     }
7034
7035     private static boolean testNexusMatrixParsing() {
7036         try {
7037             final NexusBinaryStatesMatrixParser parser = new NexusBinaryStatesMatrixParser();
7038             parser.setSource( new File( Test.PATH_TO_TEST_DATA + "nexus_test_9.nex" ) );
7039             parser.parse();
7040             final CharacterStateMatrix<BinaryStates> m = parser.getMatrix();
7041             if ( m.getNumberOfCharacters() != 9 ) {
7042                 return false;
7043             }
7044             if ( m.getNumberOfIdentifiers() != 5 ) {
7045                 return false;
7046             }
7047             if ( m.getState( 0, 0 ) != BinaryStates.PRESENT ) {
7048                 return false;
7049             }
7050             if ( m.getState( 0, 1 ) != BinaryStates.ABSENT ) {
7051                 return false;
7052             }
7053             if ( m.getState( 1, 0 ) != BinaryStates.PRESENT ) {
7054                 return false;
7055             }
7056             if ( m.getState( 2, 0 ) != BinaryStates.ABSENT ) {
7057                 return false;
7058             }
7059             if ( m.getState( 4, 8 ) != BinaryStates.PRESENT ) {
7060                 return false;
7061             }
7062             if ( !m.getIdentifier( 0 ).equals( "MOUSE" ) ) {
7063                 return false;
7064             }
7065             if ( !m.getIdentifier( 4 ).equals( "ARATH" ) ) {
7066                 return false;
7067             }
7068             //            if ( labels.length != 7 ) {
7069             //                return false;
7070             //            }
7071             //            if ( !labels[ 0 ].equals( "14-3-3" ) ) {
7072             //                return false;
7073             //            }
7074             //            if ( !labels[ 1 ].equals( "2-Hacid_dh" ) ) {
7075             //                return false;
7076             //            }
7077             //            if ( !labels[ 2 ].equals( "2-Hacid_dh_C" ) ) {
7078             //                return false;
7079             //            }
7080             //            if ( !labels[ 3 ].equals( "2-oxoacid_dh" ) ) {
7081             //                return false;
7082             //            }
7083             //            if ( !labels[ 4 ].equals( "2OG-FeII_Oxy" ) ) {
7084             //                return false;
7085             //            }
7086             //            if ( !labels[ 5 ].equals( "3-HAO" ) ) {
7087             //                return false;
7088             //            }
7089             //            if ( !labels[ 6 ].equals( "3_5_exonuc" ) ) {
7090             //                return false;
7091             //            }
7092             //            parser.setSource( new File( Test.PATH_TO_TEST_DATA + "nexus_test_8.nex" ) );
7093             //            parser.parse();
7094             //            labels = parser.getCharStateLabels();
7095             //            if ( labels.length != 7 ) {
7096             //                return false;
7097             //            }
7098             //            if ( !labels[ 0 ].equals( "14-3-3" ) ) {
7099             //                return false;
7100             //            }
7101             //            if ( !labels[ 1 ].equals( "2-Hacid_dh" ) ) {
7102             //                return false;
7103             //            }
7104             //            if ( !labels[ 2 ].equals( "2-Hacid_dh_C" ) ) {
7105             //                return false;
7106             //            }
7107             //            if ( !labels[ 3 ].equals( "2-oxoacid_dh" ) ) {
7108             //                return false;
7109             //            }
7110             //            if ( !labels[ 4 ].equals( "2OG-FeII_Oxy" ) ) {
7111             //                return false;
7112             //            }
7113             //            if ( !labels[ 5 ].equals( "3-HAO" ) ) {
7114             //                return false;
7115             //            }
7116             //            if ( !labels[ 6 ].equals( "3_5_exonuc" ) ) {
7117             //                return false;
7118             //            }
7119         }
7120         catch ( final Exception e ) {
7121             e.printStackTrace( System.out );
7122             return false;
7123         }
7124         return true;
7125     }
7126
7127     private static boolean testNexusTreeParsing() {
7128         try {
7129             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
7130             final NexusPhylogeniesParser parser = new NexusPhylogeniesParser();
7131             Phylogeny[] phylogenies = factory.create( Test.PATH_TO_TEST_DATA + "nexus_test_1.nex", parser );
7132             if ( phylogenies.length != 1 ) {
7133                 return false;
7134             }
7135             if ( phylogenies[ 0 ].getNumberOfExternalNodes() != 25 ) {
7136                 return false;
7137             }
7138             if ( !phylogenies[ 0 ].getName().equals( "" ) ) {
7139                 return false;
7140             }
7141             phylogenies = null;
7142             phylogenies = factory.create( Test.PATH_TO_TEST_DATA + "nexus_test_2.nex", parser );
7143             if ( phylogenies.length != 1 ) {
7144                 return false;
7145             }
7146             if ( phylogenies[ 0 ].getNumberOfExternalNodes() != 10 ) {
7147                 return false;
7148             }
7149             if ( !phylogenies[ 0 ].getName().equals( "name" ) ) {
7150                 return false;
7151             }
7152             phylogenies = null;
7153             phylogenies = factory.create( Test.PATH_TO_TEST_DATA + "nexus_test_3.nex", parser );
7154             if ( phylogenies.length != 1 ) {
7155                 return false;
7156             }
7157             if ( phylogenies[ 0 ].getNumberOfExternalNodes() != 3 ) {
7158                 return false;
7159             }
7160             if ( !phylogenies[ 0 ].getName().equals( "" ) ) {
7161                 return false;
7162             }
7163             if ( phylogenies[ 0 ].isRooted() ) {
7164                 return false;
7165             }
7166             phylogenies = null;
7167             phylogenies = factory.create( Test.PATH_TO_TEST_DATA + "nexus_test_4.nex", parser );
7168             if ( phylogenies.length != 18 ) {
7169                 return false;
7170             }
7171             if ( phylogenies[ 0 ].getNumberOfExternalNodes() != 10 ) {
7172                 return false;
7173             }
7174             if ( !phylogenies[ 0 ].getName().equals( "tree 0" ) ) {
7175                 return false;
7176             }
7177             if ( !phylogenies[ 1 ].getName().equals( "tree 1" ) ) {
7178                 return false;
7179             }
7180             if ( phylogenies[ 1 ].getNumberOfExternalNodes() != 10 ) {
7181                 return false;
7182             }
7183             if ( phylogenies[ 2 ].getNumberOfExternalNodes() != 3 ) {
7184                 return false;
7185             }
7186             if ( phylogenies[ 3 ].getNumberOfExternalNodes() != 3 ) {
7187                 return false;
7188             }
7189             if ( phylogenies[ 4 ].getNumberOfExternalNodes() != 3 ) {
7190                 return false;
7191             }
7192             if ( phylogenies[ 5 ].getNumberOfExternalNodes() != 3 ) {
7193                 return false;
7194             }
7195             if ( phylogenies[ 6 ].getNumberOfExternalNodes() != 3 ) {
7196                 return false;
7197             }
7198             if ( phylogenies[ 7 ].getNumberOfExternalNodes() != 3 ) {
7199                 return false;
7200             }
7201             if ( !phylogenies[ 8 ].getName().equals( "tree 8" ) ) {
7202                 return false;
7203             }
7204             if ( phylogenies[ 8 ].isRooted() ) {
7205                 return false;
7206             }
7207             if ( phylogenies[ 8 ].getNumberOfExternalNodes() != 3 ) {
7208                 return false;
7209             }
7210             if ( !phylogenies[ 9 ].getName().equals( "tree 9" ) ) {
7211                 return false;
7212             }
7213             if ( !phylogenies[ 9 ].isRooted() ) {
7214                 return false;
7215             }
7216             if ( phylogenies[ 9 ].getNumberOfExternalNodes() != 3 ) {
7217                 return false;
7218             }
7219             if ( !phylogenies[ 10 ].getName().equals( "tree 10" ) ) {
7220                 return false;
7221             }
7222             if ( !phylogenies[ 10 ].isRooted() ) {
7223                 return false;
7224             }
7225             if ( phylogenies[ 10 ].getNumberOfExternalNodes() != 3 ) {
7226                 return false;
7227             }
7228             if ( !phylogenies[ 11 ].getName().equals( "tree 11" ) ) {
7229                 return false;
7230             }
7231             if ( phylogenies[ 11 ].isRooted() ) {
7232                 return false;
7233             }
7234             if ( phylogenies[ 11 ].getNumberOfExternalNodes() != 3 ) {
7235                 return false;
7236             }
7237             if ( !phylogenies[ 12 ].getName().equals( "tree 12" ) ) {
7238                 return false;
7239             }
7240             if ( !phylogenies[ 12 ].isRooted() ) {
7241                 return false;
7242             }
7243             if ( phylogenies[ 12 ].getNumberOfExternalNodes() != 3 ) {
7244                 return false;
7245             }
7246             if ( !phylogenies[ 13 ].getName().equals( "tree 13" ) ) {
7247                 return false;
7248             }
7249             if ( !phylogenies[ 13 ].isRooted() ) {
7250                 return false;
7251             }
7252             if ( phylogenies[ 13 ].getNumberOfExternalNodes() != 3 ) {
7253                 return false;
7254             }
7255             if ( !phylogenies[ 14 ].getName().equals( "tree 14" ) ) {
7256                 return false;
7257             }
7258             if ( !phylogenies[ 14 ].isRooted() ) {
7259                 return false;
7260             }
7261             if ( phylogenies[ 14 ].getNumberOfExternalNodes() != 10 ) {
7262                 return false;
7263             }
7264             if ( !phylogenies[ 15 ].getName().equals( "tree 15" ) ) {
7265                 return false;
7266             }
7267             if ( phylogenies[ 15 ].isRooted() ) {
7268                 return false;
7269             }
7270             if ( phylogenies[ 15 ].getNumberOfExternalNodes() != 10 ) {
7271                 return false;
7272             }
7273             if ( !phylogenies[ 16 ].getName().equals( "tree 16" ) ) {
7274                 return false;
7275             }
7276             if ( !phylogenies[ 16 ].isRooted() ) {
7277                 return false;
7278             }
7279             if ( phylogenies[ 16 ].getNumberOfExternalNodes() != 10 ) {
7280                 return false;
7281             }
7282             if ( !phylogenies[ 17 ].getName().equals( "tree 17" ) ) {
7283                 return false;
7284             }
7285             if ( phylogenies[ 17 ].isRooted() ) {
7286                 return false;
7287             }
7288             if ( phylogenies[ 17 ].getNumberOfExternalNodes() != 10 ) {
7289                 return false;
7290             }
7291             final NexusPhylogeniesParser p2 = new NexusPhylogeniesParser();
7292             phylogenies = null;
7293             phylogenies = factory.create( Test.PATH_TO_TEST_DATA + "S15613.nex", p2 );
7294             if ( phylogenies.length != 9 ) {
7295                 return false;
7296             }
7297             if ( !isEqual( 0.48039661496919533, phylogenies[ 0 ].getNode( "Diadocidia_spinosula" )
7298                            .getDistanceToParent() ) ) {
7299                 return false;
7300             }
7301             if ( !isEqual( 0.3959796191512233, phylogenies[ 0 ].getNode( "Diadocidia_stanfordensis" )
7302                            .getDistanceToParent() ) ) {
7303                 return false;
7304             }
7305             if ( !phylogenies[ 0 ].getName().equals( "Family Diadocidiidae MLT (Imported_tree_0)" ) ) {
7306                 return false;
7307             }
7308             if ( !phylogenies[ 1 ].getName().equals( "Family Diadocidiidae BAT (con_50_majrule)" ) ) {
7309                 return false;
7310             }
7311             if ( !phylogenies[ 2 ].getName().equals( "Family Diadocidiidae BAT (con_50_majrule)" ) ) {
7312                 return false;
7313             }
7314             if ( !isEqual( 0.065284, phylogenies[ 7 ].getNode( "Bradysia_amoena" ).getDistanceToParent() ) ) {
7315                 return false;
7316             }
7317             if ( !isEqual( 0.065284, phylogenies[ 8 ].getNode( "Bradysia_amoena" ).getDistanceToParent() ) ) {
7318                 return false;
7319             }
7320         }
7321         catch ( final Exception e ) {
7322             e.printStackTrace( System.out );
7323             return false;
7324         }
7325         return true;
7326     }
7327
7328     private static boolean testNexusTreeParsingIterating() {
7329         try {
7330             final NexusPhylogeniesParser p = new NexusPhylogeniesParser();
7331             p.setSource( Test.PATH_TO_TEST_DATA + "nexus_test_1.nex" );
7332             if ( !p.hasNext() ) {
7333                 return false;
7334             }
7335             Phylogeny phy = p.next();
7336             if ( phy == null ) {
7337                 return false;
7338             }
7339             if ( phy.getNumberOfExternalNodes() != 25 ) {
7340                 return false;
7341             }
7342             if ( !phy.getName().equals( "" ) ) {
7343                 return false;
7344             }
7345             if ( p.hasNext() ) {
7346                 return false;
7347             }
7348             phy = p.next();
7349             if ( phy != null ) {
7350                 return false;
7351             }
7352             p.reset();
7353             if ( !p.hasNext() ) {
7354                 return false;
7355             }
7356             phy = p.next();
7357             if ( phy == null ) {
7358                 return false;
7359             }
7360             if ( phy.getNumberOfExternalNodes() != 25 ) {
7361                 return false;
7362             }
7363             if ( !phy.getName().equals( "" ) ) {
7364                 return false;
7365             }
7366             if ( p.hasNext() ) {
7367                 return false;
7368             }
7369             phy = p.next();
7370             if ( phy != null ) {
7371                 return false;
7372             }
7373             p.setSource( Test.PATH_TO_TEST_DATA + "nexus_test_2.nex" );
7374             if ( !p.hasNext() ) {
7375                 return false;
7376             }
7377             phy = p.next();
7378             if ( phy == null ) {
7379                 return false;
7380             }
7381             if ( phy.getNumberOfExternalNodes() != 10 ) {
7382                 return false;
7383             }
7384             if ( !phy.getName().equals( "name" ) ) {
7385                 return false;
7386             }
7387             if ( p.hasNext() ) {
7388                 return false;
7389             }
7390             phy = p.next();
7391             if ( phy != null ) {
7392                 return false;
7393             }
7394             p.reset();
7395             if ( !p.hasNext() ) {
7396                 return false;
7397             }
7398             phy = p.next();
7399             if ( phy == null ) {
7400                 return false;
7401             }
7402             if ( phy.getNumberOfExternalNodes() != 10 ) {
7403                 return false;
7404             }
7405             if ( !phy.getName().equals( "name" ) ) {
7406                 return false;
7407             }
7408             if ( p.hasNext() ) {
7409                 return false;
7410             }
7411             phy = p.next();
7412             if ( phy != null ) {
7413                 return false;
7414             }
7415             p.setSource( Test.PATH_TO_TEST_DATA + "nexus_test_3.nex" );
7416             if ( !p.hasNext() ) {
7417                 return false;
7418             }
7419             phy = p.next();
7420             if ( phy == null ) {
7421                 return false;
7422             }
7423             if ( phy.getNumberOfExternalNodes() != 3 ) {
7424                 return false;
7425             }
7426             if ( !phy.getName().equals( "" ) ) {
7427                 return false;
7428             }
7429             if ( phy.isRooted() ) {
7430                 return false;
7431             }
7432             if ( p.hasNext() ) {
7433                 return false;
7434             }
7435             phy = p.next();
7436             if ( phy != null ) {
7437                 return false;
7438             }
7439             //
7440             p.reset();
7441             if ( !p.hasNext() ) {
7442                 return false;
7443             }
7444             phy = p.next();
7445             if ( phy == null ) {
7446                 return false;
7447             }
7448             if ( phy.getNumberOfExternalNodes() != 3 ) {
7449                 return false;
7450             }
7451             if ( !phy.getName().equals( "" ) ) {
7452                 return false;
7453             }
7454             if ( p.hasNext() ) {
7455                 return false;
7456             }
7457             phy = p.next();
7458             if ( phy != null ) {
7459                 return false;
7460             }
7461             //
7462             p.setSource( Test.PATH_TO_TEST_DATA + "nexus_test_4_1.nex" );
7463             if ( !p.hasNext() ) {
7464                 return false;
7465             }
7466             //0
7467             phy = p.next();
7468             if ( phy == null ) {
7469                 return false;
7470             }
7471             if ( phy.getNumberOfExternalNodes() != 10 ) {
7472                 return false;
7473             }
7474             if ( !phy.getName().equals( "tree 0" ) ) {
7475                 return false;
7476             }
7477             //1
7478             if ( !p.hasNext() ) {
7479                 return false;
7480             }
7481             phy = p.next();
7482             if ( phy == null ) {
7483                 return false;
7484             }
7485             if ( phy.getNumberOfExternalNodes() != 10 ) {
7486                 return false;
7487             }
7488             if ( !phy.getName().equals( "tree 1" ) ) {
7489                 return false;
7490             }
7491             //2
7492             if ( !p.hasNext() ) {
7493                 return false;
7494             }
7495             phy = p.next();
7496             if ( phy == null ) {
7497                 return false;
7498             }
7499             if ( phy.getNumberOfExternalNodes() != 3 ) {
7500                 System.out.println( phy.toString() );
7501                 return false;
7502             }
7503             if ( !phy.getName().equals( "" ) ) {
7504                 return false;
7505             }
7506             if ( phy.isRooted() ) {
7507                 return false;
7508             }
7509             //3
7510             if ( !p.hasNext() ) {
7511                 return false;
7512             }
7513             phy = p.next();
7514             if ( phy == null ) {
7515                 return false;
7516             }
7517             if ( phy.getNumberOfExternalNodes() != 4 ) {
7518                 return false;
7519             }
7520             if ( !phy.getName().equals( "" ) ) {
7521                 return false;
7522             }
7523             if ( !phy.isRooted() ) {
7524                 return false;
7525             }
7526             //4
7527             if ( !p.hasNext() ) {
7528                 return false;
7529             }
7530             phy = p.next();
7531             if ( phy == null ) {
7532                 return false;
7533             }
7534             if ( phy.getNumberOfExternalNodes() != 5 ) {
7535                 System.out.println( phy.getNumberOfExternalNodes() );
7536                 return false;
7537             }
7538             if ( !phy.getName().equals( "" ) ) {
7539                 return false;
7540             }
7541             if ( !phy.isRooted() ) {
7542                 return false;
7543             }
7544             //5
7545             if ( !p.hasNext() ) {
7546                 return false;
7547             }
7548             phy = p.next();
7549             if ( phy == null ) {
7550                 return false;
7551             }
7552             if ( phy.getNumberOfExternalNodes() != 3 ) {
7553                 return false;
7554             }
7555             if ( !phy.getName().equals( "" ) ) {
7556                 return false;
7557             }
7558             if ( phy.isRooted() ) {
7559                 return false;
7560             }
7561             //6
7562             if ( !p.hasNext() ) {
7563                 return false;
7564             }
7565             phy = p.next();
7566             if ( phy == null ) {
7567                 return false;
7568             }
7569             if ( phy.getNumberOfExternalNodes() != 2 ) {
7570                 return false;
7571             }
7572             if ( !phy.getName().equals( "" ) ) {
7573                 return false;
7574             }
7575             if ( !phy.isRooted() ) {
7576                 return false;
7577             }
7578             //7
7579             if ( !p.hasNext() ) {
7580                 return false;
7581             }
7582             phy = p.next();
7583             if ( phy.getNumberOfExternalNodes() != 3 ) {
7584                 return false;
7585             }
7586             if ( !phy.toNewHampshire().equals( "((a,b),c);" ) ) {
7587                 return false;
7588             }
7589             if ( !phy.isRooted() ) {
7590                 return false;
7591             }
7592             //8
7593             if ( !p.hasNext() ) {
7594                 return false;
7595             }
7596             phy = p.next();
7597             if ( phy.getNumberOfExternalNodes() != 3 ) {
7598                 return false;
7599             }
7600             if ( !phy.toNewHampshire().equals( "((AA,BB),CC);" ) ) {
7601                 return false;
7602             }
7603             if ( !phy.getName().equals( "tree 8" ) ) {
7604                 return false;
7605             }
7606             //9
7607             if ( !p.hasNext() ) {
7608                 return false;
7609             }
7610             phy = p.next();
7611             if ( phy.getNumberOfExternalNodes() != 3 ) {
7612                 return false;
7613             }
7614             if ( !phy.toNewHampshire().equals( "((a,b),cc);" ) ) {
7615                 return false;
7616             }
7617             if ( !phy.getName().equals( "tree 9" ) ) {
7618                 return false;
7619             }
7620             //10
7621             if ( !p.hasNext() ) {
7622                 return false;
7623             }
7624             phy = p.next();
7625             if ( phy.getNumberOfExternalNodes() != 3 ) {
7626                 return false;
7627             }
7628             if ( !phy.toNewHampshire().equals( "((a,b),c);" ) ) {
7629                 return false;
7630             }
7631             if ( !phy.getName().equals( "tree 10" ) ) {
7632                 return false;
7633             }
7634             if ( !phy.isRooted() ) {
7635                 return false;
7636             }
7637             //11
7638             if ( !p.hasNext() ) {
7639                 return false;
7640             }
7641             phy = p.next();
7642             if ( phy.getNumberOfExternalNodes() != 3 ) {
7643                 return false;
7644             }
7645             if ( !phy.toNewHampshire().equals( "((1,2),3);" ) ) {
7646                 return false;
7647             }
7648             if ( !phy.getName().equals( "tree 11" ) ) {
7649                 return false;
7650             }
7651             if ( phy.isRooted() ) {
7652                 return false;
7653             }
7654             //12
7655             if ( !p.hasNext() ) {
7656                 return false;
7657             }
7658             phy = p.next();
7659             if ( phy.getNumberOfExternalNodes() != 3 ) {
7660                 return false;
7661             }
7662             if ( !phy.toNewHampshire().equals( "((aa,bb),cc);" ) ) {
7663                 return false;
7664             }
7665             if ( !phy.getName().equals( "tree 12" ) ) {
7666                 return false;
7667             }
7668             if ( !phy.isRooted() ) {
7669                 return false;
7670             }
7671             //13
7672             if ( !p.hasNext() ) {
7673                 return false;
7674             }
7675             phy = p.next();
7676             if ( phy.getNumberOfExternalNodes() != 3 ) {
7677                 return false;
7678             }
7679             if ( !phy.toNewHampshire().equals( "((a,b),c);" ) ) {
7680                 return false;
7681             }
7682             if ( !phy.getName().equals( "tree 13" ) ) {
7683                 return false;
7684             }
7685             if ( !phy.isRooted() ) {
7686                 return false;
7687             }
7688             //14
7689             if ( !p.hasNext() ) {
7690                 return false;
7691             }
7692             phy = p.next();
7693             if ( phy.getNumberOfExternalNodes() != 10 ) {
7694                 System.out.println( phy.getNumberOfExternalNodes() );
7695                 return false;
7696             }
7697             if ( !phy
7698                     .toNewHampshire()
7699                     .equals( "(1:0.212481,8:0.297838,(9:0.222729,((6:0.201563,7:0.194547):0.282035,(4:1.146091,(3:1.008881,(10:0.384105,(2:0.235682,5:0.353432):0.32368):0.103875):0.41354):0.254687):0.095341):0.079254):0.0;" ) ) {
7700                 System.out.println( phy.toNewHampshire() );
7701                 return false;
7702             }
7703             if ( !phy.getName().equals( "tree 14" ) ) {
7704                 return false;
7705             }
7706             if ( !phy.isRooted() ) {
7707                 return false;
7708             }
7709             //15
7710             if ( !p.hasNext() ) {
7711                 return false;
7712             }
7713             phy = p.next();
7714             if ( phy.getNumberOfExternalNodes() != 10 ) {
7715                 System.out.println( phy.getNumberOfExternalNodes() );
7716                 return false;
7717             }
7718             if ( !phy
7719                     .toNewHampshire()
7720                     .equals( "(1:0.212481,8:0.297838,(9:0.222729,((6:0.201563,7:0.194547):0.282035,(4:1.146091,(3:1.008881,(10:0.384105,(2:0.235682,5:0.353432):0.32368):0.103875):0.41354):0.254687):0.095341):0.079254):0.0;" ) ) {
7721                 System.out.println( phy.toNewHampshire() );
7722                 return false;
7723             }
7724             if ( !phy.getName().equals( "tree 15" ) ) {
7725                 return false;
7726             }
7727             if ( phy.isRooted() ) {
7728                 return false;
7729             }
7730             //16
7731             if ( !p.hasNext() ) {
7732                 return false;
7733             }
7734             phy = p.next();
7735             if ( phy.getNumberOfExternalNodes() != 10 ) {
7736                 System.out.println( phy.getNumberOfExternalNodes() );
7737                 return false;
7738             }
7739             if ( !phy
7740                     .toNewHampshire()
7741                     .equals( "(1:0.212481,8:0.297838,(9:0.222729,((6:0.201563,7:0.194547):0.282035,(4:1.146091,(3:1.008881,(10:0.384105,(2:0.235682,5:0.353432):0.32368):0.103875):0.41354):0.254687):0.095341):0.079254):0.0;" ) ) {
7742                 System.out.println( phy.toNewHampshire() );
7743                 return false;
7744             }
7745             if ( !phy.getName().equals( "tree 16" ) ) {
7746                 return false;
7747             }
7748             if ( !phy.isRooted() ) {
7749                 return false;
7750             }
7751             //17
7752             if ( !p.hasNext() ) {
7753                 return false;
7754             }
7755             phy = p.next();
7756             if ( phy.getNumberOfExternalNodes() != 10 ) {
7757                 System.out.println( phy.getNumberOfExternalNodes() );
7758                 return false;
7759             }
7760             if ( !phy
7761                     .toNewHampshire()
7762                     .equals( "(1:0.212481,8:0.297838,(9:0.222729,((6:0.201563,7:0.194547):0.282035,(4:1.146091,(3:1.008881,(10:0.384105,(2:0.235682,5:0.353432):0.32368):0.103875):0.41354):0.254687):0.095341):0.079254):0.0;" ) ) {
7763                 System.out.println( phy.toNewHampshire() );
7764                 return false;
7765             }
7766             if ( !phy.getName().equals( "tree 17" ) ) {
7767                 return false;
7768             }
7769             if ( phy.isRooted() ) {
7770                 return false;
7771             }
7772             //
7773             if ( p.hasNext() ) {
7774                 return false;
7775             }
7776             phy = p.next();
7777             if ( phy != null ) {
7778                 return false;
7779             }
7780             p.reset();
7781             //0
7782             if ( !p.hasNext() ) {
7783                 return false;
7784             }
7785             phy = p.next();
7786             if ( phy == null ) {
7787                 return false;
7788             }
7789             if ( phy.getNumberOfExternalNodes() != 10 ) {
7790                 return false;
7791             }
7792             if ( !phy.getName().equals( "tree 0" ) ) {
7793                 return false;
7794             }
7795             //1
7796             if ( !p.hasNext() ) {
7797                 return false;
7798             }
7799             phy = p.next();
7800             if ( phy == null ) {
7801                 return false;
7802             }
7803             if ( phy.getNumberOfExternalNodes() != 10 ) {
7804                 return false;
7805             }
7806             if ( !phy.getName().equals( "tree 1" ) ) {
7807                 return false;
7808             }
7809             //2
7810             if ( !p.hasNext() ) {
7811                 return false;
7812             }
7813             phy = p.next();
7814             if ( phy == null ) {
7815                 return false;
7816             }
7817             if ( phy.getNumberOfExternalNodes() != 3 ) {
7818                 return false;
7819             }
7820             if ( !phy.getName().equals( "" ) ) {
7821                 return false;
7822             }
7823             if ( phy.isRooted() ) {
7824                 return false;
7825             }
7826             //3
7827             if ( !p.hasNext() ) {
7828                 return false;
7829             }
7830             phy = p.next();
7831             if ( phy == null ) {
7832                 return false;
7833             }
7834             if ( phy.getNumberOfExternalNodes() != 4 ) {
7835                 return false;
7836             }
7837             if ( !phy.getName().equals( "" ) ) {
7838                 return false;
7839             }
7840             if ( !phy.isRooted() ) {
7841                 return false;
7842             }
7843             //4
7844             if ( !p.hasNext() ) {
7845                 return false;
7846             }
7847             phy = p.next();
7848             if ( phy == null ) {
7849                 return false;
7850             }
7851             if ( phy.getNumberOfExternalNodes() != 5 ) {
7852                 System.out.println( phy.getNumberOfExternalNodes() );
7853                 return false;
7854             }
7855             if ( !phy.getName().equals( "" ) ) {
7856                 return false;
7857             }
7858             if ( !phy.isRooted() ) {
7859                 return false;
7860             }
7861             //5
7862             if ( !p.hasNext() ) {
7863                 return false;
7864             }
7865             phy = p.next();
7866             if ( phy == null ) {
7867                 return false;
7868             }
7869             if ( phy.getNumberOfExternalNodes() != 3 ) {
7870                 return false;
7871             }
7872             if ( !phy.getName().equals( "" ) ) {
7873                 return false;
7874             }
7875             if ( phy.isRooted() ) {
7876                 return false;
7877             }
7878             //
7879             final NexusPhylogeniesParser p2 = new NexusPhylogeniesParser();
7880             p2.setSource( Test.PATH_TO_TEST_DATA + "S15613.nex" );
7881             // 0
7882             if ( !p2.hasNext() ) {
7883                 return false;
7884             }
7885             phy = p2.next();
7886             if ( !isEqual( 0.48039661496919533, phy.getNode( "Diadocidia_spinosula" ).getDistanceToParent() ) ) {
7887                 return false;
7888             }
7889             if ( !isEqual( 0.3959796191512233, phy.getNode( "Diadocidia_stanfordensis" ).getDistanceToParent() ) ) {
7890                 return false;
7891             }
7892             // 1
7893             if ( !p2.hasNext() ) {
7894                 return false;
7895             }
7896             phy = p2.next();
7897             // 2
7898             if ( !p2.hasNext() ) {
7899                 return false;
7900             }
7901             phy = p2.next();
7902             // 3
7903             if ( !p2.hasNext() ) {
7904                 return false;
7905             }
7906             phy = p2.next();
7907             // 4
7908             if ( !p2.hasNext() ) {
7909                 return false;
7910             }
7911             phy = p2.next();
7912             // 5
7913             if ( !p2.hasNext() ) {
7914                 return false;
7915             }
7916             phy = p2.next();
7917             // 6
7918             if ( !p2.hasNext() ) {
7919                 return false;
7920             }
7921             phy = p2.next();
7922             // 7
7923             if ( !p2.hasNext() ) {
7924                 return false;
7925             }
7926             phy = p2.next();
7927             // 8
7928             if ( !p2.hasNext() ) {
7929                 return false;
7930             }
7931             phy = p2.next();
7932             if ( !isEqual( 0.065284, phy.getNode( "Bradysia_amoena" ).getDistanceToParent() ) ) {
7933                 return false;
7934             }
7935             if ( p2.hasNext() ) {
7936                 return false;
7937             }
7938             phy = p2.next();
7939             if ( phy != null ) {
7940                 return false;
7941             }
7942             // 0
7943             p2.reset();
7944             if ( !p2.hasNext() ) {
7945                 return false;
7946             }
7947             phy = p2.next();
7948             if ( !isEqual( 0.48039661496919533, phy.getNode( "Diadocidia_spinosula" ).getDistanceToParent() ) ) {
7949                 return false;
7950             }
7951             if ( !isEqual( 0.3959796191512233, phy.getNode( "Diadocidia_stanfordensis" ).getDistanceToParent() ) ) {
7952                 return false;
7953             }
7954         }
7955         catch ( final Exception e ) {
7956             e.printStackTrace( System.out );
7957             return false;
7958         }
7959         return true;
7960     }
7961
7962     private static boolean testNexusTreeParsingTranslating() {
7963         try {
7964             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
7965             final NexusPhylogeniesParser parser = new NexusPhylogeniesParser();
7966             Phylogeny[] phylogenies = factory.create( Test.PATH_TO_TEST_DATA + "nexus_test_5.nex", parser );
7967             if ( phylogenies.length != 1 ) {
7968                 return false;
7969             }
7970             if ( phylogenies[ 0 ].getNumberOfExternalNodes() != 3 ) {
7971                 return false;
7972             }
7973             if ( !phylogenies[ 0 ].getName().equals( "Tree0" ) ) {
7974                 return false;
7975             }
7976             if ( !phylogenies[ 0 ].getFirstExternalNode().getName().equals( "Scarabaeus" ) ) {
7977                 return false;
7978             }
7979             if ( !phylogenies[ 0 ].getFirstExternalNode().getNextExternalNode().getName().equals( "Drosophila" ) ) {
7980                 return false;
7981             }
7982             if ( !phylogenies[ 0 ].getFirstExternalNode().getNextExternalNode().getNextExternalNode().getName()
7983                     .equals( "Aranaeus" ) ) {
7984                 return false;
7985             }
7986             phylogenies = null;
7987             phylogenies = factory.create( Test.PATH_TO_TEST_DATA + "nexus_test_6.nex", parser );
7988             if ( phylogenies.length != 3 ) {
7989                 return false;
7990             }
7991             if ( phylogenies[ 0 ].getNumberOfExternalNodes() != 3 ) {
7992                 return false;
7993             }
7994             if ( !phylogenies[ 0 ].getName().equals( "Tree0" ) ) {
7995                 return false;
7996             }
7997             if ( phylogenies[ 0 ].isRooted() ) {
7998                 return false;
7999             }
8000             if ( !phylogenies[ 0 ].getFirstExternalNode().getName().equals( "Scarabaeus" ) ) {
8001                 return false;
8002             }
8003             if ( !phylogenies[ 0 ].getFirstExternalNode().getNextExternalNode().getName().equals( "Drosophila" ) ) {
8004                 return false;
8005             }
8006             if ( !phylogenies[ 0 ].getFirstExternalNode().getNextExternalNode().getNextExternalNode().getName()
8007                     .equals( "Aranaeus" ) ) {
8008                 return false;
8009             }
8010             if ( phylogenies[ 1 ].getNumberOfExternalNodes() != 3 ) {
8011                 return false;
8012             }
8013             if ( !phylogenies[ 1 ].getName().equals( "Tree1" ) ) {
8014                 return false;
8015             }
8016             if ( phylogenies[ 1 ].isRooted() ) {
8017                 return false;
8018             }
8019             if ( !phylogenies[ 1 ].getFirstExternalNode().getName().equals( "Scarabaeus" ) ) {
8020                 return false;
8021             }
8022             if ( !phylogenies[ 1 ].getFirstExternalNode().getNextExternalNode().getName().equals( "Drosophila" ) ) {
8023                 return false;
8024             }
8025             if ( !phylogenies[ 1 ].getFirstExternalNode().getNextExternalNode().getNextExternalNode().getName()
8026                     .equals( "Aranaeus" ) ) {
8027                 return false;
8028             }
8029             if ( phylogenies[ 2 ].getNumberOfExternalNodes() != 3 ) {
8030                 return false;
8031             }
8032             if ( !phylogenies[ 2 ].getName().equals( "Tree2" ) ) {
8033                 return false;
8034             }
8035             if ( !phylogenies[ 2 ].isRooted() ) {
8036                 return false;
8037             }
8038             if ( !phylogenies[ 2 ].getFirstExternalNode().getName().equals( "Scarabaeus" ) ) {
8039                 return false;
8040             }
8041             if ( !phylogenies[ 2 ].getFirstExternalNode().getNextExternalNode().getName().equals( "Drosophila" ) ) {
8042                 return false;
8043             }
8044             if ( !phylogenies[ 2 ].getFirstExternalNode().getNextExternalNode().getNextExternalNode().getName()
8045                     .equals( "Aranaeus" ) ) {
8046                 return false;
8047             }
8048             phylogenies = null;
8049             phylogenies = factory.create( Test.PATH_TO_TEST_DATA + "nexus_test_7.nex", parser );
8050             if ( phylogenies.length != 3 ) {
8051                 return false;
8052             }
8053             if ( phylogenies[ 0 ].getNumberOfExternalNodes() != 3 ) {
8054                 return false;
8055             }
8056             if ( !phylogenies[ 0 ].getName().equals( "Tree0" ) ) {
8057                 return false;
8058             }
8059             if ( phylogenies[ 0 ].isRooted() ) {
8060                 return false;
8061             }
8062             if ( !phylogenies[ 0 ].getFirstExternalNode().getName().equals( "Scarabaeus" ) ) {
8063                 return false;
8064             }
8065             if ( !phylogenies[ 0 ].getFirstExternalNode().getNextExternalNode().getName().equals( "Drosophila" ) ) {
8066                 return false;
8067             }
8068             if ( !phylogenies[ 0 ].getFirstExternalNode().getNextExternalNode().getNextExternalNode().getName()
8069                     .equals( "Aranaeus" ) ) {
8070                 return false;
8071             }
8072             if ( phylogenies[ 1 ].getNumberOfExternalNodes() != 3 ) {
8073                 return false;
8074             }
8075             if ( !phylogenies[ 1 ].getName().equals( "Tree1" ) ) {
8076                 return false;
8077             }
8078             if ( phylogenies[ 1 ].isRooted() ) {
8079                 return false;
8080             }
8081             if ( !phylogenies[ 1 ].getFirstExternalNode().getName().equals( "Scarabaeus" ) ) {
8082                 return false;
8083             }
8084             if ( !phylogenies[ 1 ].getFirstExternalNode().getNextExternalNode().getName().equals( "Drosophila" ) ) {
8085                 return false;
8086             }
8087             if ( !phylogenies[ 1 ].getFirstExternalNode().getNextExternalNode().getNextExternalNode().getName()
8088                     .equals( "Aranaeus" ) ) {
8089                 return false;
8090             }
8091             if ( phylogenies[ 2 ].getNumberOfExternalNodes() != 3 ) {
8092                 return false;
8093             }
8094             if ( !phylogenies[ 2 ].getName().equals( "Tree2" ) ) {
8095                 return false;
8096             }
8097             if ( !phylogenies[ 2 ].isRooted() ) {
8098                 return false;
8099             }
8100             if ( !phylogenies[ 2 ].getFirstExternalNode().getName().equals( "Scarabaeus" ) ) {
8101                 return false;
8102             }
8103             if ( !phylogenies[ 2 ].getFirstExternalNode().getNextExternalNode().getName().equals( "Drosophila" ) ) {
8104                 return false;
8105             }
8106             if ( !phylogenies[ 2 ].getFirstExternalNode().getNextExternalNode().getNextExternalNode().getName()
8107                     .equals( "Aranaeus" ) ) {
8108                 return false;
8109             }
8110             phylogenies = factory.create( Test.PATH_TO_TEST_DATA + "S14117.nex", parser );
8111             if ( phylogenies.length != 3 ) {
8112                 return false;
8113             }
8114             if ( !isEqual( phylogenies[ 2 ].getNode( "Aloysia lycioides 251-76-02169" ).getDistanceToParent(),
8115                            0.00100049 ) ) {
8116                 return false;
8117             }
8118         }
8119         catch ( final Exception e ) {
8120             e.printStackTrace( System.out );
8121             return false;
8122         }
8123         return true;
8124     }
8125
8126     private static boolean testNHParsing() {
8127         try {
8128             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
8129             final Phylogeny p1 = factory.create( "(A,B1)", new NHXParser() )[ 0 ];
8130             if ( !p1.toNewHampshireX().equals( "(A,B1)" ) ) {
8131                 return false;
8132             }
8133             final NHXParser nhxp = new NHXParser();
8134             nhxp.setTaxonomyExtraction( NHXParser.TAXONOMY_EXTRACTION.NO );
8135             nhxp.setReplaceUnderscores( true );
8136             final Phylogeny uc0 = factory.create( "(A__A_,_B_B)", nhxp )[ 0 ];
8137             if ( !uc0.getRoot().getChildNode( 0 ).getName().equals( "A A" ) ) {
8138                 return false;
8139             }
8140             if ( !uc0.getRoot().getChildNode( 1 ).getName().equals( "B B" ) ) {
8141                 return false;
8142             }
8143             final Phylogeny p1b = factory
8144                     .create( "   \n  \t  \b   \r \f   ; (  \n  \t  \b   \r \f; A ;  \n  \t  \b   \r \f,  \n  \t  \b   \r \f; B ;   \n  \t  \b   \r \f 1  \n  \t  \b   \r \f ;  \n  \t  \b   \r \f );;;;; \n  \t  \b   \r \f;;;  \n  \t  \b   \r \f ",
8145                              new NHXParser() )[ 0 ];
8146             if ( !p1b.toNewHampshireX().equals( "(';A;',';B;1;')" ) ) {
8147                 return false;
8148             }
8149             if ( !p1b.toNewHampshire().equals( "(';A;',';B;1;');" ) ) {
8150                 return false;
8151             }
8152             final Phylogeny p2 = factory.create( new StringBuffer( "(A,B2)" ), new NHXParser() )[ 0 ];
8153             final Phylogeny p3 = factory.create( new char[] { '(', 'A', ',', 'B', '3', ')' }, new NHXParser() )[ 0 ];
8154             final Phylogeny p4 = factory.create( "(A,B4);", new NHXParser() )[ 0 ];
8155             final Phylogeny p5 = factory.create( new StringBuffer( "(A,B5);" ), new NHXParser() )[ 0 ];
8156             final Phylogeny[] p7 = factory.create( "(A,B7);(C,D7)", new NHXParser() );
8157             final Phylogeny[] p8 = factory.create( "(A,B8) (C,D8)", new NHXParser() );
8158             final Phylogeny[] p9 = factory.create( "(A,B9)\n(C,D9)", new NHXParser() );
8159             final Phylogeny[] p10 = factory.create( "(A,B10);(C,D10);", new NHXParser() );
8160             final Phylogeny[] p11 = factory.create( "(A,B11);(C,D11) (E,F11)\t(G,H11)", new NHXParser() );
8161             final Phylogeny[] p12 = factory.create( "(A,B12) (C,D12) (E,F12) (G,H12)", new NHXParser() );
8162             final Phylogeny[] p13 = factory.create( " ; (;A; , ; B ; 1  3 ; \n)\t ( \n ;"
8163                     + " C ; ,; D;13;);;;;;;(;E;,;F;13 ;) ; "
8164                     + "; ; ( \t\n\r\b; G ;, ;H ;1 3; )  ;  ;   ;",
8165                     new NHXParser() );
8166             if ( !p13[ 0 ].toNewHampshireX().equals( "(';A;',';B;13;')" ) ) {
8167                 return false;
8168             }
8169             if ( !p13[ 1 ].toNewHampshireX().equals( "(';C;',';D;13;')" ) ) {
8170                 return false;
8171             }
8172             if ( !p13[ 2 ].toNewHampshireX().equals( "(';E;',';F;13;')" ) ) {
8173                 return false;
8174             }
8175             if ( !p13[ 3 ].toNewHampshireX().equals( "(';G;',';H;13;')" ) ) {
8176                 return false;
8177             }
8178             final Phylogeny[] p14 = factory.create( "(A,B14)ab", new NHXParser() );
8179             final Phylogeny[] p15 = factory.create( "(A,B15)ab;", new NHXParser() );
8180             final String p16_S = "((A,B),C)";
8181             final Phylogeny[] p16 = factory.create( p16_S, new NHXParser() );
8182             if ( p16.length != 1 ) {
8183                 return false;
8184             }
8185             if ( !p16[ 0 ].toNewHampshireX().equals( p16_S ) ) {
8186                 return false;
8187             }
8188             final String p17_S = "(C,(A,B))";
8189             final Phylogeny[] p17 = factory.create( p17_S, new NHXParser() );
8190             if ( p17.length != 1 ) {
8191                 return false;
8192             }
8193             if ( !p17[ 0 ].toNewHampshireX().equals( p17_S ) ) {
8194                 return false;
8195             }
8196             final String p18_S = "((A,B),(C,D))";
8197             final Phylogeny[] p18 = factory.create( p18_S, new NHXParser() );
8198             if ( p18.length != 1 ) {
8199                 return false;
8200             }
8201             if ( !p18[ 0 ].toNewHampshireX().equals( p18_S ) ) {
8202                 return false;
8203             }
8204             final String p19_S = "(((A,B),C),D)";
8205             final Phylogeny[] p19 = factory.create( p19_S, new NHXParser() );
8206             if ( p19.length != 1 ) {
8207                 return false;
8208             }
8209             if ( !p19[ 0 ].toNewHampshireX().equals( p19_S ) ) {
8210                 return false;
8211             }
8212             final String p20_S = "(A,(B,(C,D)))";
8213             final Phylogeny[] p20 = factory.create( p20_S, new NHXParser() );
8214             if ( p20.length != 1 ) {
8215                 return false;
8216             }
8217             if ( !p20[ 0 ].toNewHampshireX().equals( p20_S ) ) {
8218                 return false;
8219             }
8220             final String p21_S = "(A,(B,(C,(D,E))))";
8221             final Phylogeny[] p21 = factory.create( p21_S, new NHXParser() );
8222             if ( p21.length != 1 ) {
8223                 return false;
8224             }
8225             if ( !p21[ 0 ].toNewHampshireX().equals( p21_S ) ) {
8226                 return false;
8227             }
8228             final String p22_S = "((((A,B),C),D),E)";
8229             final Phylogeny[] p22 = factory.create( p22_S, new NHXParser() );
8230             if ( p22.length != 1 ) {
8231                 return false;
8232             }
8233             if ( !p22[ 0 ].toNewHampshireX().equals( p22_S ) ) {
8234                 return false;
8235             }
8236             final String p23_S = "(A,(B,(C,(D,E)de)cde)bcde)abcde";
8237             final Phylogeny[] p23 = factory.create( p23_S, new NHXParser() );
8238             if ( p23.length != 1 ) {
8239                 System.out.println( "xl=" + p23.length );
8240                 System.exit( -1 );
8241                 return false;
8242             }
8243             if ( !p23[ 0 ].toNewHampshireX().equals( p23_S ) ) {
8244                 return false;
8245             }
8246             final String p24_S = "((((A,B)ab,C)abc,D)abcd,E)abcde";
8247             final Phylogeny[] p24 = factory.create( p24_S, new NHXParser() );
8248             if ( p24.length != 1 ) {
8249                 return false;
8250             }
8251             if ( !p24[ 0 ].toNewHampshireX().equals( p24_S ) ) {
8252                 return false;
8253             }
8254             final String p241_S1 = "(A,(B,(C,(D,E)de)cde)bcde)abcde";
8255             final String p241_S2 = "((((A,B)ab,C)abc,D)abcd,E)abcde";
8256             final Phylogeny[] p241 = factory.create( p241_S1 + p241_S2, new NHXParser() );
8257             if ( p241.length != 2 ) {
8258                 return false;
8259             }
8260             if ( !p241[ 0 ].toNewHampshireX().equals( p241_S1 ) ) {
8261                 return false;
8262             }
8263             if ( !p241[ 1 ].toNewHampshireX().equals( p241_S2 ) ) {
8264                 return false;
8265             }
8266             final String p25_S = "((((((((((((((A,B)ab,C)abc,D)abcd,E)"
8267                     + "abcde,(B,(C,(D,E)de)cde)bcde)abcde,(B,((A,(B,(C,(D,"
8268                     + "E)de)cde)bcde)abcde,(D,E)de)cde)bcde)abcde,B)ab,C)"
8269                     + "abc,((((A,B)ab,C)abc,D)abcd,E)abcde)abcd,E)abcde,"
8270                     + "((((A,((((((((A,B)ab,C)abc,((((A,B)ab,C)abc,D)abcd,"
8271                     + "E)abcde)abcd,E)abcde,((((A,B)ab,C)abc,D)abcd,E)abcde)"
8272                     + "ab,C)abc,((((A,B)ab,C)abc,D)abcd,E)abcde)abcd,E)abcde"
8273                     + ")ab,C)abc,D)abcd,E)abcde)ab,C)abc,((((A,B)ab,C)abc,D)" + "abcd,E)abcde)abcd,E)abcde";
8274             final Phylogeny[] p25 = factory.create( p25_S, new NHXParser() );
8275             if ( !p25[ 0 ].toNewHampshireX().equals( p25_S ) ) {
8276                 return false;
8277             }
8278             final String p26_S = "(A,B)ab";
8279             final Phylogeny[] p26 = factory.create( p26_S, new NHXParser() );
8280             if ( !p26[ 0 ].toNewHampshireX().equals( p26_S ) ) {
8281                 return false;
8282             }
8283             final String p27_S = "((((A,B)ab,C)abc,D)abcd,E)abcde";
8284             final Phylogeny[] p27s = factory.create( p27_S, new NHXParser() );
8285             if ( p27s.length != 1 ) {
8286                 System.out.println( "xxl=" + p27s.length );
8287                 System.exit( -1 );
8288                 return false;
8289             }
8290             if ( !p27s[ 0 ].toNewHampshireX().equals( p27_S ) ) {
8291                 System.out.println( p27s[ 0 ].toNewHampshireX() );
8292                 System.exit( -1 );
8293                 return false;
8294             }
8295             final Phylogeny[] p27 = factory.create( new File( Test.PATH_TO_TEST_DATA + "phylogeny27.nhx" ),
8296                                                     new NHXParser() );
8297             if ( p27.length != 1 ) {
8298                 System.out.println( "yl=" + p27.length );
8299                 System.exit( -1 );
8300                 return false;
8301             }
8302             if ( !p27[ 0 ].toNewHampshireX().equals( p27_S ) ) {
8303                 System.out.println( p27[ 0 ].toNewHampshireX() );
8304                 System.exit( -1 );
8305                 return false;
8306             }
8307             final String p28_S1 = "((((A,B)ab,C)abc,D)abcd,E)abcde";
8308             final String p28_S2 = "(A,(B,(C,(D,E)de)cde)bcde)abcde";
8309             final String p28_S3 = "(A,B)ab";
8310             final String p28_S4 = "((((A,B),C),D),;E;)";
8311             final Phylogeny[] p28 = factory.create( new File( Test.PATH_TO_TEST_DATA + "phylogeny28.nhx" ),
8312                                                     new NHXParser() );
8313             if ( !p28[ 0 ].toNewHampshireX().equals( p28_S1 ) ) {
8314                 return false;
8315             }
8316             if ( !p28[ 1 ].toNewHampshireX().equals( p28_S2 ) ) {
8317                 return false;
8318             }
8319             if ( !p28[ 2 ].toNewHampshireX().equals( p28_S3 ) ) {
8320                 return false;
8321             }
8322             if ( !p28[ 3 ].toNewHampshireX().equals( "((((A,B),C),D),';E;')" ) ) {
8323                 return false;
8324             }
8325             if ( p28.length != 4 ) {
8326                 return false;
8327             }
8328             final String p29_S = "((((A:0.01,B:0.684)ab:0.345,C:0.3451)abc:0.3451,D:1.5)abcd:0.134,E:0.32)abcde:0.1345";
8329             final Phylogeny[] p29 = factory.create( p29_S, new NHXParser() );
8330             if ( !p29[ 0 ].toNewHampshireX().equals( p29_S ) ) {
8331                 return false;
8332             }
8333             final String p30_S = "((((A:0.01,B:0.02):0.93,C:0.04):0.05,D:1.4):0.06,E):0.72";
8334             final Phylogeny[] p30 = factory.create( p30_S, new NHXParser() );
8335             if ( !p30[ 0 ].toNewHampshireX().equals( p30_S ) ) {
8336                 return false;
8337             }
8338             final String p32_S = " ;   ;        \n  \t  \b   \f  \r  ;;;;;; ";
8339             final Phylogeny[] p32 = factory.create( p32_S, new NHXParser() );
8340             if ( ( p32.length != 0 ) ) {
8341                 return false;
8342             }
8343             final String p33_S = "A";
8344             final Phylogeny[] p33 = factory.create( p33_S, new NHXParser() );
8345             if ( !p33[ 0 ].toNewHampshireX().equals( p33_S ) ) {
8346                 return false;
8347             }
8348             final String p34_S = "B;";
8349             final Phylogeny[] p34 = factory.create( p34_S, new NHXParser() );
8350             if ( !p34[ 0 ].toNewHampshireX().equals( "B" ) ) {
8351                 return false;
8352             }
8353             final String p35_S = "B:0.2";
8354             final Phylogeny[] p35 = factory.create( p35_S, new NHXParser() );
8355             if ( !p35[ 0 ].toNewHampshireX().equals( p35_S ) ) {
8356                 return false;
8357             }
8358             final String p36_S = "(A)";
8359             final Phylogeny[] p36 = factory.create( p36_S, new NHXParser() );
8360             if ( !p36[ 0 ].toNewHampshireX().equals( p36_S ) ) {
8361                 return false;
8362             }
8363             final String p37_S = "((A))";
8364             final Phylogeny[] p37 = factory.create( p37_S, new NHXParser() );
8365             if ( !p37[ 0 ].toNewHampshireX().equals( p37_S ) ) {
8366                 return false;
8367             }
8368             final String p38_S = "(((((((A:0.2):0.2):0.3):0.4):0.5):0.6):0.7):0.8";
8369             final Phylogeny[] p38 = factory.create( p38_S, new NHXParser() );
8370             if ( !p38[ 0 ].toNewHampshireX().equals( p38_S ) ) {
8371                 return false;
8372             }
8373             final String p39_S = "(((B,((((A:0.2):0.2):0.3):0.4):0.5):0.6):0.7):0.8";
8374             final Phylogeny[] p39 = factory.create( p39_S, new NHXParser() );
8375             if ( !p39[ 0 ].toNewHampshireX().equals( p39_S ) ) {
8376                 return false;
8377             }
8378             final String p40_S = "(A,B,C)";
8379             final Phylogeny[] p40 = factory.create( p40_S, new NHXParser() );
8380             if ( !p40[ 0 ].toNewHampshireX().equals( p40_S ) ) {
8381                 return false;
8382             }
8383             final String p41_S = "(A,B,C,D,E,F,G,H,I,J,K)";
8384             final Phylogeny[] p41 = factory.create( p41_S, new NHXParser() );
8385             if ( !p41[ 0 ].toNewHampshireX().equals( p41_S ) ) {
8386                 return false;
8387             }
8388             final String p42_S = "(A,B,(X,Y,Z),D,E,F,G,H,I,J,K)";
8389             final Phylogeny[] p42 = factory.create( p42_S, new NHXParser() );
8390             if ( !p42[ 0 ].toNewHampshireX().equals( p42_S ) ) {
8391                 return false;
8392             }
8393             final String p43_S = "(A,B,C,(AA,BB,CC,(CCC,DDD,EEE,(FFFF,GGGG)x)y,DD,EE,FF,GG,HH),D,E,(EE,FF),F,G,H,(((((5)4)3)2)1),I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,(XX,(YY)),Y,Z)";
8394             final Phylogeny[] p43 = factory.create( p43_S, new NHXParser() );
8395             if ( !p43[ 0 ].toNewHampshireX().equals( p43_S ) ) {
8396                 return false;
8397             }
8398             final String p44_S = "(((A,B,C,D),(A,B,C,D),(A,B,C,D),(A,B,C,D)),((A,B,C,D),(A,B,C,D),(A,B,C,D),(A,B,C,D)),((A,B,C,D),(A,B,C,D),(A,B,C,D),(A,B,C,D)),((A,B,C,D),(A,B,C,D),(A,B,C,D),(A,B,C,D)))";
8399             final Phylogeny[] p44 = factory.create( p44_S, new NHXParser() );
8400             if ( !p44[ 0 ].toNewHampshireX().equals( p44_S ) ) {
8401                 return false;
8402             }
8403             final String p45_S = "((((((((((A))))))))),(((((((((B))))))))),(((((((((C))))))))))";
8404             final Phylogeny[] p45 = factory.create( p45_S, new NHXParser() );
8405             if ( !p45[ 0 ].toNewHampshireX().equals( p45_S ) ) {
8406                 return false;
8407             }
8408             final String p46_S = "";
8409             final Phylogeny[] p46 = factory.create( p46_S, new NHXParser() );
8410             if ( p46.length != 0 ) {
8411                 return false;
8412             }
8413             final Phylogeny p47 = factory.create( new StringBuffer( "((A,B)ab:2[0.44],C)" ), new NHXParser() )[ 0 ];
8414             if ( !isEqual( 0.44, p47.getNode( "ab" ).getBranchData().getConfidence( 0 ).getValue() ) ) {
8415                 return false;
8416             }
8417             final Phylogeny p48 = factory.create( new StringBuffer( "((A,B)ab:2[88],C)" ), new NHXParser() )[ 0 ];
8418             if ( !isEqual( 88, p48.getNode( "ab" ).getBranchData().getConfidence( 0 ).getValue() ) ) {
8419                 return false;
8420             }
8421             final Phylogeny p49 = factory
8422                     .create( new StringBuffer( "((A,B)a[comment:a,b;(a)]b:2[0.44][comment(a,b,b);],C)" ),
8423                              new NHXParser() )[ 0 ];
8424             if ( !isEqual( 0.44, p49.getNode( "ab" ).getBranchData().getConfidence( 0 ).getValue() ) ) {
8425                 return false;
8426             }
8427             final Phylogeny p50 = factory.create( new StringBuffer( "((\"A\",B)ab:2[88],C)" ), new NHXParser() )[ 0 ];
8428             if ( p50.getNode( "A" ) == null ) {
8429                 return false;
8430             }
8431             if ( !p50.toNewHampshire( NH_CONVERSION_SUPPORT_VALUE_STYLE.IN_SQUARE_BRACKETS )
8432                     .equals( "((A,B)ab:2.0[88],C);" ) ) {
8433                 return false;
8434             }
8435             if ( !p50.toNewHampshire( NH_CONVERSION_SUPPORT_VALUE_STYLE.NONE ).equals( "((A,B)ab:2.0,C);" ) ) {
8436                 return false;
8437             }
8438             if ( !p50.toNewHampshire( NH_CONVERSION_SUPPORT_VALUE_STYLE.AS_INTERNAL_NODE_NAMES )
8439                     .equals( "((A,B)88:2.0,C);" ) ) {
8440                 return false;
8441             }
8442             final Phylogeny p51 = factory.create( new StringBuffer( "((\"A(A\",B)ab:2[88],C)" ), new NHXParser() )[ 0 ];
8443             if ( p51.getNode( "A(A" ) == null ) {
8444                 return false;
8445             }
8446             final Phylogeny p52 = factory.create( new StringBuffer( "(('A(A',B)ab:2[88],C)" ), new NHXParser() )[ 0 ];
8447             if ( p52.getNode( "A(A" ) == null ) {
8448                 return false;
8449             }
8450             final Phylogeny p53 = factory
8451                     .create( new StringBuffer( "(('A(A',\"B (x (a' ,b) f(x);\"[com])[ment]ab:2[88],C)" ),
8452                              new NHXParser() )[ 0 ];
8453             if ( p53.getNode( "B (x (a' ,b) f(x);" ) == null ) {
8454                 return false;
8455             }
8456             final Phylogeny p54 = factory.create( new StringBuffer( "((A,B):[88],C)" ), new NHXParser() )[ 0 ];
8457             if ( p54.getNode( "A" ) == null ) {
8458                 return false;
8459             }
8460             if ( !p54.toNewHampshire( NH_CONVERSION_SUPPORT_VALUE_STYLE.IN_SQUARE_BRACKETS ).equals( "((A,B)[88],C);" ) ) {
8461                 return false;
8462             }
8463             final Phylogeny p55 = factory
8464                     .create( new StringBuffer( "((\"lcl|HPV32_L1.:1  s\":0.195593,\"lcl|HPV30_L1.1|;a\":0.114237):0.0359322,\"lcl|HPV56_L1.1|,d\":0.0727412,\"lcl|HPV66_L1.1x\":0.0798012);" ),
8465                              new NHXParser() )[ 0 ];
8466             if ( !p55
8467                     .toNewHampshire()
8468                     .equals( "(('lcl|HPV32_L1.:1 s':0.195593,'lcl|HPV30_L1.1|;a':0.114237):0.0359322,'lcl|HPV56_L1.1|,d':0.0727412,lcl|HPV66_L1.1x:0.0798012);" ) ) {
8469                 System.out.println( p55.toNewHampshire() );
8470                 return false;
8471             }
8472             final Phylogeny p56 = factory
8473                     .create( new StringBuffer( "((\"lcl|HPV32_L1.:1      s\":0.195593,\"lcl|HPV30_L1.1|;a\":0.114\n237):0.0359322,\"lcl|HPV56_L1.1|,d\":0.0727412,\"lcl|HPV66_L1.1:x\":0.0798012);" ),
8474                              new NHXParser() )[ 0 ];
8475             if ( !p56
8476                     .toNewHampshire()
8477                     .equals( "(('lcl|HPV32_L1.:1 s':0.195593,'lcl|HPV30_L1.1|;a':0.114237):0.0359322,'lcl|HPV56_L1.1|,d':0.0727412,'lcl|HPV66_L1.1:x':0.0798012);" ) ) {
8478                 System.out.println( p56.toNewHampshire() );
8479                 return false;
8480             }
8481             final Phylogeny p57 = factory
8482                     .create( new StringBuffer( "((\"lcl|HPV32_L1.:1      s\":0.195593,\"lcl|HPV30_L1.1|;a\":0.114\n237):0.0359322,\"lcl|HPV56_L1.1|,d\":0.0727412,\"lcl|HPV66_L1.1:x\":0.0798012);" ),
8483                              new NHXParser() )[ 0 ];
8484             if ( !p57
8485                     .toNewHampshire()
8486                     .equals( "(('lcl|HPV32_L1.:1 s':0.195593,'lcl|HPV30_L1.1|;a':0.114237):0.0359322,'lcl|HPV56_L1.1|,d':0.0727412,'lcl|HPV66_L1.1:x':0.0798012);" ) ) {
8487                 System.out.println( p56.toNewHampshire() );
8488                 return false;
8489             }
8490             final String s58 = "('Homo \"man\" sapiens:1',\"Homo 'man' sapiens;\")';root \"1_ )';";
8491             final Phylogeny p58 = factory.create( new StringBuffer( s58 ), new NHXParser() )[ 0 ];
8492             if ( !p58.toNewHampshire().equals( s58 ) ) {
8493                 System.out.println( p58.toNewHampshire() );
8494                 return false;
8495             }
8496             final String s59 = "('Homo \"man sapiens:1',\"Homo 'man sapiens\")\"root; '1_ )\";";
8497             final Phylogeny p59 = factory.create( new StringBuffer( s59 ), new NHXParser() )[ 0 ];
8498             if ( !p59.toNewHampshire().equals( s59 ) ) {
8499                 System.out.println( p59.toNewHampshire() );
8500                 return false;
8501             }
8502             final String s60 = "('\" ;,:\":\"',\"'abc def' g's_\",'=:0.45+,.:%~`!@#$%^&*()_-+={} | ;,');";
8503             final Phylogeny p60 = factory.create( new StringBuffer( s60 ), new NHXParser() )[ 0 ];
8504             if ( !p60.toNewHampshire().equals( s60 ) ) {
8505                 System.out.println( p60.toNewHampshire() );
8506                 return false;
8507             }
8508             final String s61 = "('H[omo] \"man\" sapiens:1',\"H[omo] 'man' sapiens;\",H[omo] sapiens)';root \"1_ )';";
8509             final Phylogeny p61 = factory.create( new StringBuffer( s61 ), new NHXParser() )[ 0 ];
8510             if ( !p61.toNewHampshire()
8511                     .equals( "('H{omo} \"man\" sapiens:1',\"H{omo} 'man' sapiens;\",Hsapiens)';root \"1_ )';" ) ) {
8512                 System.out.println( p61.toNewHampshire() );
8513                 return false;
8514             }
8515         }
8516         catch ( final Exception e ) {
8517             e.printStackTrace( System.out );
8518             return false;
8519         }
8520         return true;
8521     }
8522
8523     private static boolean testNHParsingIter() {
8524         try {
8525             final String p0_str = "(A,B);";
8526             final NHXParser p = new NHXParser();
8527             p.setSource( p0_str );
8528             if ( !p.hasNext() ) {
8529                 return false;
8530             }
8531             final Phylogeny p0 = p.next();
8532             if ( !p0.toNewHampshire().equals( p0_str ) ) {
8533                 System.out.println( p0.toNewHampshire() );
8534                 return false;
8535             }
8536             if ( p.hasNext() ) {
8537                 return false;
8538             }
8539             if ( p.next() != null ) {
8540                 return false;
8541             }
8542             //
8543             final String p00_str = "(A,B)root;";
8544             p.setSource( p00_str );
8545             final Phylogeny p00 = p.next();
8546             if ( !p00.toNewHampshire().equals( p00_str ) ) {
8547                 System.out.println( p00.toNewHampshire() );
8548                 return false;
8549             }
8550             //
8551             final String p000_str = "A;";
8552             p.setSource( p000_str );
8553             final Phylogeny p000 = p.next();
8554             if ( !p000.toNewHampshire().equals( p000_str ) ) {
8555                 System.out.println( p000.toNewHampshire() );
8556                 return false;
8557             }
8558             //
8559             final String p0000_str = "A";
8560             p.setSource( p0000_str );
8561             final Phylogeny p0000 = p.next();
8562             if ( !p0000.toNewHampshire().equals( "A;" ) ) {
8563                 System.out.println( p0000.toNewHampshire() );
8564                 return false;
8565             }
8566             //
8567             p.setSource( "(A)" );
8568             final Phylogeny p00000 = p.next();
8569             if ( !p00000.toNewHampshire().equals( "(A);" ) ) {
8570                 System.out.println( p00000.toNewHampshire() );
8571                 return false;
8572             }
8573             //
8574             final String p1_str = "(A,B)(C,D)(E,F)(G,H)";
8575             p.setSource( p1_str );
8576             if ( !p.hasNext() ) {
8577                 return false;
8578             }
8579             final Phylogeny p1_0 = p.next();
8580             if ( !p1_0.toNewHampshire().equals( "(A,B);" ) ) {
8581                 System.out.println( p1_0.toNewHampshire() );
8582                 return false;
8583             }
8584             if ( !p.hasNext() ) {
8585                 return false;
8586             }
8587             final Phylogeny p1_1 = p.next();
8588             if ( !p1_1.toNewHampshire().equals( "(C,D);" ) ) {
8589                 System.out.println( "(C,D) != " + p1_1.toNewHampshire() );
8590                 return false;
8591             }
8592             if ( !p.hasNext() ) {
8593                 return false;
8594             }
8595             final Phylogeny p1_2 = p.next();
8596             if ( !p1_2.toNewHampshire().equals( "(E,F);" ) ) {
8597                 System.out.println( "(E,F) != " + p1_2.toNewHampshire() );
8598                 return false;
8599             }
8600             if ( !p.hasNext() ) {
8601                 return false;
8602             }
8603             final Phylogeny p1_3 = p.next();
8604             if ( !p1_3.toNewHampshire().equals( "(G,H);" ) ) {
8605                 System.out.println( "(G,H) != " + p1_3.toNewHampshire() );
8606                 return false;
8607             }
8608             if ( p.hasNext() ) {
8609                 return false;
8610             }
8611             if ( p.next() != null ) {
8612                 return false;
8613             }
8614             //
8615             final String p2_str = "((1,2,3),B);(C,D) (E,F)root;(G,H); ;(X)";
8616             p.setSource( p2_str );
8617             if ( !p.hasNext() ) {
8618                 return false;
8619             }
8620             Phylogeny p2_0 = p.next();
8621             if ( !p2_0.toNewHampshire().equals( "((1,2,3),B);" ) ) {
8622                 System.out.println( p2_0.toNewHampshire() );
8623                 return false;
8624             }
8625             if ( !p.hasNext() ) {
8626                 return false;
8627             }
8628             Phylogeny p2_1 = p.next();
8629             if ( !p2_1.toNewHampshire().equals( "(C,D);" ) ) {
8630                 System.out.println( "(C,D) != " + p2_1.toNewHampshire() );
8631                 return false;
8632             }
8633             if ( !p.hasNext() ) {
8634                 return false;
8635             }
8636             Phylogeny p2_2 = p.next();
8637             if ( !p2_2.toNewHampshire().equals( "(E,F)root;" ) ) {
8638                 System.out.println( "(E,F)root != " + p2_2.toNewHampshire() );
8639                 return false;
8640             }
8641             if ( !p.hasNext() ) {
8642                 return false;
8643             }
8644             Phylogeny p2_3 = p.next();
8645             if ( !p2_3.toNewHampshire().equals( "(G,H);" ) ) {
8646                 System.out.println( "(G,H) != " + p2_3.toNewHampshire() );
8647                 return false;
8648             }
8649             if ( !p.hasNext() ) {
8650                 return false;
8651             }
8652             Phylogeny p2_4 = p.next();
8653             if ( !p2_4.toNewHampshire().equals( "(X);" ) ) {
8654                 System.out.println( "(X) != " + p2_4.toNewHampshire() );
8655                 return false;
8656             }
8657             if ( p.hasNext() ) {
8658                 return false;
8659             }
8660             if ( p.next() != null ) {
8661                 return false;
8662             }
8663             ////
8664             p.reset();
8665             if ( !p.hasNext() ) {
8666                 return false;
8667             }
8668             p2_0 = p.next();
8669             if ( !p2_0.toNewHampshire().equals( "((1,2,3),B);" ) ) {
8670                 System.out.println( p2_0.toNewHampshire() );
8671                 return false;
8672             }
8673             if ( !p.hasNext() ) {
8674                 return false;
8675             }
8676             p2_1 = p.next();
8677             if ( !p2_1.toNewHampshire().equals( "(C,D);" ) ) {
8678                 System.out.println( "(C,D) != " + p2_1.toNewHampshire() );
8679                 return false;
8680             }
8681             if ( !p.hasNext() ) {
8682                 return false;
8683             }
8684             p2_2 = p.next();
8685             if ( !p2_2.toNewHampshire().equals( "(E,F)root;" ) ) {
8686                 System.out.println( "(E,F)root != " + p2_2.toNewHampshire() );
8687                 return false;
8688             }
8689             if ( !p.hasNext() ) {
8690                 return false;
8691             }
8692             p2_3 = p.next();
8693             if ( !p2_3.toNewHampshire().equals( "(G,H);" ) ) {
8694                 System.out.println( "(G,H) != " + p2_3.toNewHampshire() );
8695                 return false;
8696             }
8697             if ( !p.hasNext() ) {
8698                 return false;
8699             }
8700             p2_4 = p.next();
8701             if ( !p2_4.toNewHampshire().equals( "(X);" ) ) {
8702                 System.out.println( "(X) != " + p2_4.toNewHampshire() );
8703                 return false;
8704             }
8705             if ( p.hasNext() ) {
8706                 return false;
8707             }
8708             if ( p.next() != null ) {
8709                 return false;
8710             }
8711             //
8712             final String p3_str = "((A,B),C)abc";
8713             p.setSource( p3_str );
8714             if ( !p.hasNext() ) {
8715                 return false;
8716             }
8717             final Phylogeny p3_0 = p.next();
8718             if ( !p3_0.toNewHampshire().equals( "((A,B),C)abc;" ) ) {
8719                 return false;
8720             }
8721             if ( p.hasNext() ) {
8722                 return false;
8723             }
8724             if ( p.next() != null ) {
8725                 return false;
8726             }
8727             //
8728             final String p4_str = "((A,B)ab,C)abc";
8729             p.setSource( p4_str );
8730             if ( !p.hasNext() ) {
8731                 return false;
8732             }
8733             final Phylogeny p4_0 = p.next();
8734             if ( !p4_0.toNewHampshire().equals( "((A,B)ab,C)abc;" ) ) {
8735                 return false;
8736             }
8737             if ( p.hasNext() ) {
8738                 return false;
8739             }
8740             if ( p.next() != null ) {
8741                 return false;
8742             }
8743             //
8744             final String p5_str = "(((A,B)ab,C)abc,D)abcd";
8745             p.setSource( p5_str );
8746             if ( !p.hasNext() ) {
8747                 return false;
8748             }
8749             final Phylogeny p5_0 = p.next();
8750             if ( !p5_0.toNewHampshire().equals( "(((A,B)ab,C)abc,D)abcd;" ) ) {
8751                 return false;
8752             }
8753             if ( p.hasNext() ) {
8754                 return false;
8755             }
8756             if ( p.next() != null ) {
8757                 return false;
8758             }
8759             //
8760             final String p6_str = "(A,(B,(C,(D,E)de)cde)bcde)abcde";
8761             p.setSource( p6_str );
8762             if ( !p.hasNext() ) {
8763                 return false;
8764             }
8765             Phylogeny p6_0 = p.next();
8766             if ( !p6_0.toNewHampshire().equals( "(A,(B,(C,(D,E)de)cde)bcde)abcde;" ) ) {
8767                 return false;
8768             }
8769             if ( p.hasNext() ) {
8770                 return false;
8771             }
8772             if ( p.next() != null ) {
8773                 return false;
8774             }
8775             p.reset();
8776             if ( !p.hasNext() ) {
8777                 return false;
8778             }
8779             p6_0 = p.next();
8780             if ( !p6_0.toNewHampshire().equals( "(A,(B,(C,(D,E)de)cde)bcde)abcde;" ) ) {
8781                 return false;
8782             }
8783             if ( p.hasNext() ) {
8784                 return false;
8785             }
8786             if ( p.next() != null ) {
8787                 return false;
8788             }
8789             //
8790             final String p7_str = "((((A,B)ab,C)abc,D)abcd,E)abcde";
8791             p.setSource( p7_str );
8792             if ( !p.hasNext() ) {
8793                 return false;
8794             }
8795             Phylogeny p7_0 = p.next();
8796             if ( !p7_0.toNewHampshire().equals( "((((A,B)ab,C)abc,D)abcd,E)abcde;" ) ) {
8797                 return false;
8798             }
8799             if ( p.hasNext() ) {
8800                 return false;
8801             }
8802             if ( p.next() != null ) {
8803                 return false;
8804             }
8805             p.reset();
8806             if ( !p.hasNext() ) {
8807                 return false;
8808             }
8809             p7_0 = p.next();
8810             if ( !p7_0.toNewHampshire().equals( "((((A,B)ab,C)abc,D)abcd,E)abcde;" ) ) {
8811                 return false;
8812             }
8813             if ( p.hasNext() ) {
8814                 return false;
8815             }
8816             if ( p.next() != null ) {
8817                 return false;
8818             }
8819             //
8820             final String p8_str = "((((A,B)ab,C)abc,D)abcd,E)abcde ((((a,b)ab,c)abc,d)abcd,e)abcde";
8821             p.setSource( p8_str );
8822             if ( !p.hasNext() ) {
8823                 return false;
8824             }
8825             Phylogeny p8_0 = p.next();
8826             if ( !p8_0.toNewHampshire().equals( "((((A,B)ab,C)abc,D)abcd,E)abcde;" ) ) {
8827                 return false;
8828             }
8829             if ( !p.hasNext() ) {
8830                 return false;
8831             }
8832             if ( !p.hasNext() ) {
8833                 return false;
8834             }
8835             Phylogeny p8_1 = p.next();
8836             if ( !p8_1.toNewHampshire().equals( "((((a,b)ab,c)abc,d)abcd,e)abcde;" ) ) {
8837                 return false;
8838             }
8839             if ( p.hasNext() ) {
8840                 return false;
8841             }
8842             if ( p.next() != null ) {
8843                 return false;
8844             }
8845             p.reset();
8846             if ( !p.hasNext() ) {
8847                 return false;
8848             }
8849             p8_0 = p.next();
8850             if ( !p8_0.toNewHampshire().equals( "((((A,B)ab,C)abc,D)abcd,E)abcde;" ) ) {
8851                 return false;
8852             }
8853             if ( !p.hasNext() ) {
8854                 return false;
8855             }
8856             p8_1 = p.next();
8857             if ( !p8_1.toNewHampshire().equals( "((((a,b)ab,c)abc,d)abcd,e)abcde;" ) ) {
8858                 return false;
8859             }
8860             if ( p.hasNext() ) {
8861                 return false;
8862             }
8863             if ( p.next() != null ) {
8864                 return false;
8865             }
8866             p.reset();
8867             //
8868             p.setSource( "" );
8869             if ( p.hasNext() ) {
8870                 return false;
8871             }
8872             //
8873             p.setSource( new File( Test.PATH_TO_TEST_DATA + "phylogeny27.nhx" ) );
8874             if ( !p.hasNext() ) {
8875                 return false;
8876             }
8877             Phylogeny p_27 = p.next();
8878             if ( !p_27.toNewHampshireX().equals( "((((A,B)ab,C)abc,D)abcd,E)abcde" ) ) {
8879                 System.out.println( p_27.toNewHampshireX() );
8880                 System.exit( -1 );
8881                 return false;
8882             }
8883             if ( p.hasNext() ) {
8884                 return false;
8885             }
8886             if ( p.next() != null ) {
8887                 return false;
8888             }
8889             p.reset();
8890             if ( !p.hasNext() ) {
8891                 return false;
8892             }
8893             p_27 = p.next();
8894             if ( !p_27.toNewHampshireX().equals( "((((A,B)ab,C)abc,D)abcd,E)abcde" ) ) {
8895                 System.out.println( p_27.toNewHampshireX() );
8896                 System.exit( -1 );
8897                 return false;
8898             }
8899             if ( p.hasNext() ) {
8900                 return false;
8901             }
8902             if ( p.next() != null ) {
8903                 return false;
8904             }
8905             //
8906             final String p30_str = "(A,B);(C,D)";
8907             final NHXParser p30 = new NHXParser();
8908             p30.setSource( p30_str );
8909             if ( !p30.hasNext() ) {
8910                 return false;
8911             }
8912             Phylogeny phy30 = p30.next();
8913             if ( !phy30.toNewHampshire().equals( "(A,B);" ) ) {
8914                 System.out.println( phy30.toNewHampshire() );
8915                 return false;
8916             }
8917             if ( !p30.hasNext() ) {
8918                 return false;
8919             }
8920             Phylogeny phy301 = p30.next();
8921             if ( !phy301.toNewHampshire().equals( "(C,D);" ) ) {
8922                 System.out.println( phy301.toNewHampshire() );
8923                 return false;
8924             }
8925             if ( p30.hasNext() ) {
8926                 return false;
8927             }
8928             if ( p30.hasNext() ) {
8929                 return false;
8930             }
8931             if ( p30.next() != null ) {
8932                 return false;
8933             }
8934             if ( p30.next() != null ) {
8935                 return false;
8936             }
8937             p30.reset();
8938             if ( !p30.hasNext() ) {
8939                 return false;
8940             }
8941             phy30 = p30.next();
8942             if ( !phy30.toNewHampshire().equals( "(A,B);" ) ) {
8943                 System.out.println( phy30.toNewHampshire() );
8944                 return false;
8945             }
8946             if ( !p30.hasNext() ) {
8947                 return false;
8948             }
8949             phy301 = p30.next();
8950             if ( !phy301.toNewHampshire().equals( "(C,D);" ) ) {
8951                 System.out.println( phy301.toNewHampshire() );
8952                 return false;
8953             }
8954             if ( p30.hasNext() ) {
8955                 return false;
8956             }
8957             if ( p30.hasNext() ) {
8958                 return false;
8959             }
8960             if ( p30.next() != null ) {
8961                 return false;
8962             }
8963             if ( p30.next() != null ) {
8964                 return false;
8965             }
8966         }
8967         catch ( final Exception e ) {
8968             e.printStackTrace( System.out );
8969             return false;
8970         }
8971         return true;
8972     }
8973
8974     private static boolean testNHXconversion() {
8975         try {
8976             final PhylogenyNode n1 = new PhylogenyNode();
8977             final PhylogenyNode n2 = PhylogenyNode.createInstanceFromNhxString( "" );
8978             final PhylogenyNode n3 = PhylogenyNode.createInstanceFromNhxString( "n3" );
8979             final PhylogenyNode n4 = PhylogenyNode.createInstanceFromNhxString( "n4:0.01" );
8980             final PhylogenyNode n5 = PhylogenyNode
8981                     .createInstanceFromNhxString( "n5:0.1[&&NHX:S=Ecoli:E=1.1.1.1:D=Y:Co=Y:B=56:T=1]" );
8982             final PhylogenyNode n6 = PhylogenyNode
8983                     .createInstanceFromNhxString( "n6:0.000001[&&NHX:S=Ecoli:E=1.1.1.1:D=N:Co=N:B=100:T=1]" );
8984             if ( !n1.toNewHampshireX().equals( "" ) ) {
8985                 return false;
8986             }
8987             if ( !n2.toNewHampshireX().equals( "" ) ) {
8988                 return false;
8989             }
8990             if ( !n3.toNewHampshireX().equals( "n3" ) ) {
8991                 return false;
8992             }
8993             if ( !n4.toNewHampshireX().equals( "n4:0.01" ) ) {
8994                 return false;
8995             }
8996             if ( !n5.toNewHampshireX().equals( "n5:0.1[&&NHX:T=1:S=Ecoli:D=Y:B=56]" ) ) {
8997                 return false;
8998             }
8999             if ( !n6.toNewHampshireX().equals( "n6:1.0E-6[&&NHX:T=1:S=Ecoli:D=N:B=100]" ) ) {
9000                 System.out.println( n6.toNewHampshireX() );
9001                 return false;
9002             }
9003             final PhylogenyNode n7 = new PhylogenyNode();
9004             n7.setName( "   gks:dr-m4 \"    '    `@:[]sadq04 " );
9005             if ( !n7.toNewHampshire( true, PhylogenyNode.NH_CONVERSION_SUPPORT_VALUE_STYLE.IN_SQUARE_BRACKETS )
9006                     .equals( "'gks:dr-m4 \" ` `@:[]sadq04'" ) ) {
9007                 System.out.println( n7
9008                                     .toNewHampshire( true, PhylogenyNode.NH_CONVERSION_SUPPORT_VALUE_STYLE.IN_SQUARE_BRACKETS ) );
9009                 return false;
9010             }
9011         }
9012         catch ( final Exception e ) {
9013             e.printStackTrace( System.out );
9014             return false;
9015         }
9016         return true;
9017     }
9018
9019     private static boolean testNHXNodeParsing() {
9020         try {
9021             final PhylogenyNode n1 = new PhylogenyNode();
9022             final PhylogenyNode n2 = PhylogenyNode.createInstanceFromNhxString( "" );
9023             final PhylogenyNode n3 = PhylogenyNode.createInstanceFromNhxString( "n3" );
9024             final PhylogenyNode n4 = PhylogenyNode.createInstanceFromNhxString( "n4:0.01" );
9025             final PhylogenyNode n5 = PhylogenyNode
9026                     .createInstanceFromNhxString( "n5:0.1[&&NHX:S=Ecoli:E=1.1.1.1:D=Y:B=56:T=1:On=22:SOn=33:SNn=44:W=2:C=10.20.30:XN=S=tag1=value1=unit1:XN=S=tag3=value3=unit3]" );
9027             if ( !n3.getName().equals( "n3" ) ) {
9028                 return false;
9029             }
9030             if ( n3.getDistanceToParent() != PhylogenyDataUtil.BRANCH_LENGTH_DEFAULT ) {
9031                 return false;
9032             }
9033             if ( n3.isDuplication() ) {
9034                 return false;
9035             }
9036             if ( n3.isHasAssignedEvent() ) {
9037                 return false;
9038             }
9039             if ( PhylogenyMethods.getBranchWidthValue( n3 ) != BranchWidth.BRANCH_WIDTH_DEFAULT_VALUE ) {
9040                 return false;
9041             }
9042             if ( !n4.getName().equals( "n4" ) ) {
9043                 return false;
9044             }
9045             if ( n4.getDistanceToParent() != 0.01 ) {
9046                 return false;
9047             }
9048             if ( !n5.getName().equals( "n5" ) ) {
9049                 return false;
9050             }
9051             if ( PhylogenyMethods.getConfidenceValue( n5 ) != 56 ) {
9052                 return false;
9053             }
9054             if ( n5.getDistanceToParent() != 0.1 ) {
9055                 return false;
9056             }
9057             if ( !PhylogenyMethods.getSpecies( n5 ).equals( "Ecoli" ) ) {
9058                 return false;
9059             }
9060             if ( !n5.isDuplication() ) {
9061                 return false;
9062             }
9063             if ( !n5.isHasAssignedEvent() ) {
9064                 return false;
9065             }
9066             final PhylogenyNode n8 = PhylogenyNode
9067                     .createInstanceFromNhxString( "ABCD_ECOLI/1-2:0.01",
9068                                                   NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
9069             if ( !n8.getName().equals( "ABCD_ECOLI/1-2" ) ) {
9070                 return false;
9071             }
9072             if ( !PhylogenyMethods.getSpecies( n8 ).equals( "ECOLI" ) ) {
9073                 return false;
9074             }
9075             final PhylogenyNode n9 = PhylogenyNode
9076                     .createInstanceFromNhxString( "ABCD_ECOLI/1-12:0.01",
9077                                                   NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
9078             if ( !n9.getName().equals( "ABCD_ECOLI/1-12" ) ) {
9079                 return false;
9080             }
9081             if ( !PhylogenyMethods.getSpecies( n9 ).equals( "ECOLI" ) ) {
9082                 return false;
9083             }
9084             final PhylogenyNode n10 = PhylogenyNode
9085                     .createInstanceFromNhxString( "n10.ECOLI", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
9086             if ( !n10.getName().equals( "n10.ECOLI" ) ) {
9087                 return false;
9088             }
9089             final PhylogenyNode n20 = PhylogenyNode
9090                     .createInstanceFromNhxString( "ABCD_ECOLI/1-2", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
9091             if ( !n20.getName().equals( "ABCD_ECOLI/1-2" ) ) {
9092                 return false;
9093             }
9094             if ( !PhylogenyMethods.getSpecies( n20 ).equals( "ECOLI" ) ) {
9095                 return false;
9096             }
9097             final PhylogenyNode n20x = PhylogenyNode
9098                     .createInstanceFromNhxString( "N20_ECOL1/1-2", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
9099             if ( !n20x.getName().equals( "N20_ECOL1/1-2" ) ) {
9100                 return false;
9101             }
9102             if ( !PhylogenyMethods.getSpecies( n20x ).equals( "ECOL1" ) ) {
9103                 return false;
9104             }
9105             final PhylogenyNode n20xx = PhylogenyNode
9106                     .createInstanceFromNhxString( "N20_eCOL1/1-2", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
9107             if ( !n20xx.getName().equals( "N20_eCOL1/1-2" ) ) {
9108                 return false;
9109             }
9110             if ( PhylogenyMethods.getSpecies( n20xx ).length() > 0 ) {
9111                 return false;
9112             }
9113             final PhylogenyNode n20xxx = PhylogenyNode
9114                     .createInstanceFromNhxString( "n20_ecoli/1-2", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
9115             if ( !n20xxx.getName().equals( "n20_ecoli/1-2" ) ) {
9116                 return false;
9117             }
9118             if ( PhylogenyMethods.getSpecies( n20xxx ).length() > 0 ) {
9119                 return false;
9120             }
9121             final PhylogenyNode n20xxxx = PhylogenyNode
9122                     .createInstanceFromNhxString( "n20_Ecoli/1-2", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
9123             if ( !n20xxxx.getName().equals( "n20_Ecoli/1-2" ) ) {
9124                 return false;
9125             }
9126             if ( PhylogenyMethods.getSpecies( n20xxxx ).length() > 0 ) {
9127                 return false;
9128             }
9129             final PhylogenyNode n21 = PhylogenyNode
9130                     .createInstanceFromNhxString( "N21_PIG", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
9131             if ( !n21.getName().equals( "N21_PIG" ) ) {
9132                 return false;
9133             }
9134             if ( !PhylogenyMethods.getSpecies( n21 ).equals( "PIG" ) ) {
9135                 return false;
9136             }
9137             final PhylogenyNode n21x = PhylogenyNode
9138                     .createInstanceFromNhxString( "n21_PIG", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
9139             if ( !n21x.getName().equals( "n21_PIG" ) ) {
9140                 return false;
9141             }
9142             if ( PhylogenyMethods.getSpecies( n21x ).length() > 0 ) {
9143                 return false;
9144             }
9145             final PhylogenyNode n22 = PhylogenyNode
9146                     .createInstanceFromNhxString( "n22/PIG", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
9147             if ( !n22.getName().equals( "n22/PIG" ) ) {
9148                 return false;
9149             }
9150             if ( PhylogenyMethods.getSpecies( n22 ).length() > 0 ) {
9151                 return false;
9152             }
9153             final PhylogenyNode n23 = PhylogenyNode
9154                     .createInstanceFromNhxString( "n23/PIG_1", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
9155             if ( !n23.getName().equals( "n23/PIG_1" ) ) {
9156                 return false;
9157             }
9158             if ( PhylogenyMethods.getSpecies( n23 ).length() > 0 ) {
9159                 return false;
9160             }
9161             final PhylogenyNode a = PhylogenyNode
9162                     .createInstanceFromNhxString( "ABCD_ECOLI/1-2", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
9163             if ( !a.getName().equals( "ABCD_ECOLI/1-2" ) ) {
9164                 return false;
9165             }
9166             if ( !PhylogenyMethods.getSpecies( a ).equals( "ECOLI" ) ) {
9167                 return false;
9168             }
9169             final PhylogenyNode c1 = PhylogenyNode
9170                     .createInstanceFromNhxString( "n10_BOVIN/1000-2000",
9171                                                   NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
9172             if ( !c1.getName().equals( "n10_BOVIN/1000-2000" ) ) {
9173                 return false;
9174             }
9175             if ( !PhylogenyMethods.getSpecies( c1 ).equals( "BOVIN" ) ) {
9176                 return false;
9177             }
9178             final PhylogenyNode c2 = PhylogenyNode
9179                     .createInstanceFromNhxString( "N10_Bovin_1/1000-2000",
9180                                                   NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
9181             if ( !c2.getName().equals( "N10_Bovin_1/1000-2000" ) ) {
9182                 return false;
9183             }
9184             if ( PhylogenyMethods.getSpecies( c2 ).length() > 0 ) {
9185                 return false;
9186             }
9187             final PhylogenyNode e3 = PhylogenyNode
9188                     .createInstanceFromNhxString( "n10_RAT~", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
9189             if ( !e3.getName().equals( "n10_RAT~" ) ) {
9190                 return false;
9191             }
9192             if ( !PhylogenyMethods.getSpecies( e3 ).equals( "RAT" ) ) {
9193                 return false;
9194             }
9195             final PhylogenyNode n11 = PhylogenyNode
9196                     .createInstanceFromNhxString( "N111111_ECOLI/1-2:0.4",
9197                                                   NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
9198             if ( !n11.getName().equals( "N111111_ECOLI/1-2" ) ) {
9199                 return false;
9200             }
9201             if ( n11.getDistanceToParent() != 0.4 ) {
9202                 return false;
9203             }
9204             if ( !PhylogenyMethods.getSpecies( n11 ).equals( "ECOLI" ) ) {
9205                 return false;
9206             }
9207             final PhylogenyNode n12 = PhylogenyNode
9208                     .createInstanceFromNhxString( "N111111-ECOLI---/jdj:0.4",
9209                                                   NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
9210             if ( !n12.getName().equals( "N111111-ECOLI---/jdj" ) ) {
9211                 return false;
9212             }
9213             if ( n12.getDistanceToParent() != 0.4 ) {
9214                 return false;
9215             }
9216             if ( PhylogenyMethods.getSpecies( n12 ).length() > 0 ) {
9217                 return false;
9218             }
9219             final PhylogenyNode o = PhylogenyNode
9220                     .createInstanceFromNhxString( "ABCD_MOUSE", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
9221             if ( !o.getName().equals( "ABCD_MOUSE" ) ) {
9222                 return false;
9223             }
9224             if ( !PhylogenyMethods.getSpecies( o ).equals( "MOUSE" ) ) {
9225                 return false;
9226             }
9227             if ( n1.getName().compareTo( "" ) != 0 ) {
9228                 return false;
9229             }
9230             if ( PhylogenyMethods.getConfidenceValue( n1 ) != Confidence.CONFIDENCE_DEFAULT_VALUE ) {
9231                 return false;
9232             }
9233             if ( n1.getDistanceToParent() != PhylogenyDataUtil.BRANCH_LENGTH_DEFAULT ) {
9234                 return false;
9235             }
9236             if ( n2.getName().compareTo( "" ) != 0 ) {
9237                 return false;
9238             }
9239             if ( PhylogenyMethods.getConfidenceValue( n2 ) != Confidence.CONFIDENCE_DEFAULT_VALUE ) {
9240                 return false;
9241             }
9242             if ( n2.getDistanceToParent() != PhylogenyDataUtil.BRANCH_LENGTH_DEFAULT ) {
9243                 return false;
9244             }
9245             final PhylogenyNode n00 = PhylogenyNode
9246                     .createInstanceFromNhxString( "n7:0.000001[&&NHX:GN=gene_name:AC=accession123:S=Ecoli:D=N:Co=N:B=100:T=1]" );
9247             if ( !n00.getNodeData().getSequence().getName().equals( "gene_name" ) ) {
9248                 return false;
9249             }
9250             if ( !n00.getNodeData().getSequence().getAccession().getValue().equals( "accession123" ) ) {
9251                 return false;
9252             }
9253             final PhylogenyNode nx = PhylogenyNode.createInstanceFromNhxString( "n5:0.1[&&NHX:S=Ecoli:GN=gene_1]" );
9254             if ( !nx.getNodeData().getSequence().getName().equals( "gene_1" ) ) {
9255                 return false;
9256             }
9257             final PhylogenyNode n13 = PhylogenyNode
9258                     .createInstanceFromNhxString( "BLAH_12345/1-2", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
9259             if ( !n13.getName().equals( "BLAH_12345/1-2" ) ) {
9260                 return false;
9261             }
9262             if ( PhylogenyMethods.getSpecies( n13 ).equals( "12345" ) ) {
9263                 return false;
9264             }
9265             if ( !n13.getNodeData().getTaxonomy().getIdentifier().getValue().equals( "12345" ) ) {
9266                 return false;
9267             }
9268             if ( !n13.getNodeData().getTaxonomy().getIdentifier().getProvider().equals( "uniprot" ) ) {
9269                 return false;
9270             }
9271             final PhylogenyNode n14 = PhylogenyNode
9272                     .createInstanceFromNhxString( "BLA1_9QX45/1-2", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
9273             if ( !n14.getName().equals( "BLA1_9QX45/1-2" ) ) {
9274                 return false;
9275             }
9276             if ( !PhylogenyMethods.getSpecies( n14 ).equals( "9QX45" ) ) {
9277                 return false;
9278             }
9279             final PhylogenyNode n15 = PhylogenyNode
9280                     .createInstanceFromNhxString( "something_wicked[123]",
9281                                                   NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
9282             if ( !n15.getName().equals( "something_wicked" ) ) {
9283                 return false;
9284             }
9285             if ( n15.getBranchData().getNumberOfConfidences() != 1 ) {
9286                 return false;
9287             }
9288             if ( !isEqual( n15.getBranchData().getConfidence( 0 ).getValue(), 123 ) ) {
9289                 return false;
9290             }
9291             final PhylogenyNode n16 = PhylogenyNode
9292                     .createInstanceFromNhxString( "something_wicked2[9]",
9293                                                   NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
9294             if ( !n16.getName().equals( "something_wicked2" ) ) {
9295                 return false;
9296             }
9297             if ( n16.getBranchData().getNumberOfConfidences() != 1 ) {
9298                 return false;
9299             }
9300             if ( !isEqual( n16.getBranchData().getConfidence( 0 ).getValue(), 9 ) ) {
9301                 return false;
9302             }
9303             final PhylogenyNode n17 = PhylogenyNode
9304                     .createInstanceFromNhxString( "something_wicked3[a]",
9305                                                   NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
9306             if ( !n17.getName().equals( "something_wicked3" ) ) {
9307                 return false;
9308             }
9309             if ( n17.getBranchData().getNumberOfConfidences() != 0 ) {
9310                 return false;
9311             }
9312             final PhylogenyNode n18 = PhylogenyNode
9313                     .createInstanceFromNhxString( ":0.5[91]", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
9314             if ( !isEqual( n18.getDistanceToParent(), 0.5 ) ) {
9315                 return false;
9316             }
9317             if ( n18.getBranchData().getNumberOfConfidences() != 1 ) {
9318                 return false;
9319             }
9320             if ( !isEqual( n18.getBranchData().getConfidence( 0 ).getValue(), 91 ) ) {
9321                 return false;
9322             }
9323             final PhylogenyNode n19 = PhylogenyNode
9324                     .createInstanceFromNhxString( "BLAH_1-roejojoej", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
9325             if ( !n19.getNodeData().getTaxonomy().getIdentifier().getValue().equals( "1" ) ) {
9326                 return false;
9327             }
9328             if ( !n19.getNodeData().getTaxonomy().getIdentifier().getProvider().equals( "uniprot" ) ) {
9329                 return false;
9330             }
9331             final PhylogenyNode n30 = PhylogenyNode
9332                     .createInstanceFromNhxString( "BLAH_1234567-roejojoej",
9333                                                   NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
9334             if ( !n30.getNodeData().getTaxonomy().getIdentifier().getValue().equals( "1234567" ) ) {
9335                 return false;
9336             }
9337             if ( !n30.getNodeData().getTaxonomy().getIdentifier().getProvider().equals( "uniprot" ) ) {
9338                 return false;
9339             }
9340             final PhylogenyNode n31 = PhylogenyNode
9341                     .createInstanceFromNhxString( "BLAH_12345678-roejojoej",
9342                                                   NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
9343             if ( n31.getNodeData().isHasTaxonomy() ) {
9344                 return false;
9345             }
9346             final PhylogenyNode n32 = PhylogenyNode
9347                     .createInstanceFromNhxString( "sd_12345678", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
9348             if ( n32.getNodeData().isHasTaxonomy() ) {
9349                 return false;
9350             }
9351             final PhylogenyNode n40 = PhylogenyNode
9352                     .createInstanceFromNhxString( "BCL2_12345", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
9353             if ( !n40.getNodeData().getTaxonomy().getIdentifier().getValue().equals( "12345" ) ) {
9354                 return false;
9355             }
9356             final PhylogenyNode n41 = PhylogenyNode
9357                     .createInstanceFromNhxString( "12345", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
9358             if ( n41.getNodeData().isHasTaxonomy() ) {
9359                 return false;
9360             }
9361             final PhylogenyNode n42 = PhylogenyNode
9362                     .createInstanceFromNhxString( "12345", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
9363             if ( n42.getNodeData().isHasTaxonomy() ) {
9364                 return false;
9365             }
9366             final PhylogenyNode n43 = PhylogenyNode.createInstanceFromNhxString( "12345",
9367                                                                                  NHXParser.TAXONOMY_EXTRACTION.NO );
9368             if ( n43.getNodeData().isHasTaxonomy() ) {
9369                 return false;
9370             }
9371             final PhylogenyNode n44 = PhylogenyNode
9372                     .createInstanceFromNhxString( "12345~1-2", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
9373             if ( n44.getNodeData().isHasTaxonomy() ) {
9374                 return false;
9375             }
9376         }
9377         catch ( final Exception e ) {
9378             e.printStackTrace( System.out );
9379             return false;
9380         }
9381         return true;
9382     }
9383
9384     private static boolean testNHXParsing() {
9385         try {
9386             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
9387             final Phylogeny p1 = factory.create( "(A     [&&NHX:S=a_species],B1[&&NHX:S=b_species])", new NHXParser() )[ 0 ];
9388             if ( !p1.toNewHampshireX().equals( "(A[&&NHX:S=a_species],B1[&&NHX:S=b_species])" ) ) {
9389                 return false;
9390             }
9391             final String p2_S = "(((((((A:0.2[&&NHX:S=qwerty]):0.2[&&NHX:S=uiop]):0.3[&&NHX:S=asdf]):0.4[&&NHX:S=zxc]):0.5[&&NHX:S=a]):0.6[&&NHX:S=asd]):0.7[&&NHX:S=za]):0.8[&&NHX:S=zaq]";
9392             final Phylogeny[] p2 = factory.create( p2_S, new NHXParser() );
9393             if ( !p2[ 0 ].toNewHampshireX().equals( p2_S ) ) {
9394                 return false;
9395             }
9396             final String p2b_S = "(((((((A:0.2[&NHX:S=qw,erty]):0.2[&:S=u(io)p]):0.3[&NHX:S=asdf]):0.4[S=zxc]):0.5[]):0.6[&&NH:S=asd]):0.7[&&HX:S=za]):0.8[&&:S=zaq]";
9397             final Phylogeny[] p2b = factory.create( p2b_S, new NHXParser() );
9398             if ( !p2b[ 0 ].toNewHampshireX().equals( "(((((((A:0.2):0.2):0.3):0.4):0.5):0.6):0.7):0.8" ) ) {
9399                 return false;
9400             }
9401             final Phylogeny[] p3 = factory
9402                     .create( "[  comment&&NHX,())))](((((((A:0.2[&&NHX:S=qwerty]):0.2[&&NHX:S=uiop]):0.3[&&NHX:S=asdf]):0.4[&&NHX:S=zxc]):0.5[&&NHX:S=a]):0.6[&&NHX:S=asd]):0.7[&&NHX:S=za]):0.8[&&NHX:S=zaq]",
9403                              new NHXParser() );
9404             if ( !p3[ 0 ].toNewHampshireX().equals( p2_S ) ) {
9405                 return false;
9406             }
9407             final Phylogeny[] p4 = factory
9408                     .create( "(((((((A:0.2[&&NHX:S=qwerty]):0.2[&&NHX:S=uiop]):0.3[&&NHX:S=asdf]):0.4[&&NHX:S=zxc]):0.5[&&NHX:S=a]):0.6[&&NHX:S=asd]):0.7[&&NHX:S=za]):0.8[&&NHX:S=zaq][comment(]",
9409                              new NHXParser() );
9410             if ( !p4[ 0 ].toNewHampshireX().equals( p2_S ) ) {
9411                 return false;
9412             }
9413             final Phylogeny[] p5 = factory
9414                     .create( "[]  (  [][ ][   ]  ([((( &&NHXcomment only![[[[[[]([]((((A:0.2[&&NHX:S=q[comment )))]werty][,,,,))]):0.2[&&NHX:S=uiop]):0.3[&&NHX:S=a[comment,,))]sdf])[comment(((]:0.4[&&NHX:S=zxc][comment(((][comment(((]):0.5[&&NHX:S=a]):0.6[&&NHX:S=a[comment(((]sd]):0.7[&&NHX:S=za]):0.8[&&NHX:S=zaq][comment(((]",
9415                              new NHXParser() );
9416             if ( !p5[ 0 ].toNewHampshireX().equals( p2_S ) ) {
9417                 return false;
9418             }
9419             final String p6_S_C = "(A[][][][1][22][333][4444][55555][666666][&&NHX:S=Aspecies],B[))],C,(AA,BB,CC,(CCC,DDD,EEE,[comment](FFFF,GGGG)x)y,D[comment]D,EE,FF,GG,HH),D,E,(EE,FF),F,G,H,(((((5)4)3)2)1),I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,(XX,(YY)),Y,Z)";
9420             final String p6_S_WO_C = "(A[&&NHX:S=Aspecies],B,C,(AA,BB,CC,(CCC,DDD,EEE,(FFFF,GGGG)x)y,DD,EE,FF,GG,HH),D,E,(EE,FF),F,G,H,(((((5)4)3)2)1),I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,(XX,(YY)),Y,Z)";
9421             final Phylogeny[] p6 = factory.create( p6_S_C, new NHXParser() );
9422             if ( !p6[ 0 ].toNewHampshireX().equals( p6_S_WO_C ) ) {
9423                 return false;
9424             }
9425             final String p7_S_C = "(((A [&&NHX:S=species_a], B [&&NHX:S=Vstorri] , C   , D),(A,B,C,D[comment])[],[c][]([xxx]A[comment],[comment]B[comment][comment],[comment][comment]C[comment][comment],[comment][comment]D[comment][comment])[comment][comment],[comment]   [comment](A,B,C,D)),((A,B,C,D),(A,B,C,D),(A,B,C,D),(A,B,C,D)),((A,B,C[comment][comment][comment][comment][comment]    [comment],D),(A,B,C,D),(A,B,C,D),(A,B,C,D)),[comment][comment]((A,B,C,D),(A,B,C,D),(A,B,C,D),(A,B,C,D)))";
9426             final String p7_S_WO_C = "(((A[&&NHX:S=species_a],B[&&NHX:S=Vstorri],C,D),(A,B,C,D),(A,B,C,D),(A,B,C,D)),((A,B,C,D),(A,B,C,D),(A,B,C,D),(A,B,C,D)),((A,B,C,D),(A,B,C,D),(A,B,C,D),(A,B,C,D)),((A,B,C,D),(A,B,C,D),(A,B,C,D),(A,B,C,D)))";
9427             final Phylogeny[] p7 = factory.create( p7_S_C, new NHXParser() );
9428             if ( !p7[ 0 ].toNewHampshireX().equals( p7_S_WO_C ) ) {
9429                 return false;
9430             }
9431             final String p8_S_C = "[cmt](((([]([))))))](((((A[&&NHX:S= [a comment] a])))))))[too many comments!:)])),(((((((((B[&&NHX[ a comment in a bad place]:S   =b])))))[] []   )))),(((((((((C[&&NHX:S=c])   ))[,,, ])))))))";
9432             final String p8_S_WO_C = "((((((((((A[&&NHX:S=a]))))))))),(((((((((B[&&NHX:S=b]))))))))),(((((((((C[&&NHX:S=c]))))))))))";
9433             final Phylogeny[] p8 = factory.create( p8_S_C, new NHXParser() );
9434             if ( !p8[ 0 ].toNewHampshireX().equals( p8_S_WO_C ) ) {
9435                 return false;
9436             }
9437             final Phylogeny p9 = factory.create( "((A:0.2,B:0.3):0.5[91],C:0.1)root:0.1[100]", new NHXParser() )[ 0 ];
9438             if ( !p9.toNewHampshireX().equals( "((A:0.2,B:0.3):0.5[&&NHX:B=91],C:0.1)root:0.1[&&NHX:B=100]" ) ) {
9439                 return false;
9440             }
9441             final Phylogeny p10 = factory
9442                     .create( " [79]   ( (A [co mment] :0 .2[comment],B:0.3[com])[com ment]: 0. 5 \t[ 9 1 ][ comment],C: 0.1)[comment]root:0.1[100] [comment]",
9443                              new NHXParser() )[ 0 ];
9444             if ( !p10.toNewHampshireX().equals( "((A:0.2,B:0.3):0.5[&&NHX:B=91],C:0.1)root:0.1[&&NHX:B=100]" ) ) {
9445                 return false;
9446             }
9447             final Phylogeny p11 = factory
9448                     .create( " [79]   ( ('A: \" ' [co mment] :0 .2[comment],B:0.3[com])[com ment]: 0. 5 \t[ 9 1 ][ comment],C: 0.1)[comment]root:0.1[100] [comment]",
9449                              new NHXParser() )[ 0 ];
9450             if ( !p11.toNewHampshireX().equals( "(('A: \"':0.2,B:0.3):0.5[&&NHX:B=91],C:0.1)root:0.1[&&NHX:B=100]" ) ) {
9451                 return false;
9452             }
9453             final Phylogeny p12 = factory
9454                     .create( "((A:0.2,B:0.3):0.5[&&NHX:B=91],C:0.1)root:0.1[&&NHX:B=100]",
9455                              new NHXParser() )[ 0 ];
9456             if ( !p12.toNewHampshireX().equals( "((A:0.2,B:0.3):0.5[&&NHX:B=91],C:0.1)root:0.1[&&NHX:B=100]" ) ) {
9457                 return false;
9458             }
9459
9460
9461         }
9462         catch ( final Exception e ) {
9463             e.printStackTrace( System.out );
9464             return false;
9465         }
9466         return true;
9467     }
9468
9469     private static boolean testNHXParsingMB() {
9470         try {
9471             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
9472             final Phylogeny p1 = factory.create( "(1[&prob=0.9500000000000000e+00,prob_stddev=0.1100000000000000e+00,"
9473                     + "prob_range={1.000000000000000e+00,1.000000000000000e+00},prob(percent)=\"100\","
9474                     + "prob+-sd=\"100+-0\"]:4.129000000000000e-02[&length_mean=4.153987461671767e-02,"
9475                     + "length_median=4.129000000000000e-02,length_95%HPD={3.217800000000000e-02,"
9476                     + "5.026800000000000e-02}],2[&prob=0.810000000000000e+00,prob_stddev=0.000000000000000e+00,"
9477                     + "prob_range={1.000000000000000e+00,1.000000000000000e+00},prob(percent)=\"100\","
9478                     + "prob+-sd=\"100+-0\"]:6.375699999999999e-02[&length_mean=6.395210411945065e-02,"
9479                     + "length_median=6.375699999999999e-02,length_95%HPD={5.388600000000000e-02,"
9480                     + "7.369400000000000e-02}])", new NHXParser() )[ 0 ];
9481             if ( !isEqual( p1.getNode( "1" ).getDistanceToParent(), 4.129e-02 ) ) {
9482                 return false;
9483             }
9484             if ( !isEqual( p1.getNode( "1" ).getBranchData().getConfidence( 0 ).getValue(), 0.9500000000000000e+00 ) ) {
9485                 return false;
9486             }
9487             if ( !isEqual( p1.getNode( "1" ).getBranchData().getConfidence( 0 ).getStandardDeviation(),
9488                            0.1100000000000000e+00 ) ) {
9489                 return false;
9490             }
9491             if ( !isEqual( p1.getNode( "2" ).getDistanceToParent(), 6.375699999999999e-02 ) ) {
9492                 return false;
9493             }
9494             if ( !isEqual( p1.getNode( "2" ).getBranchData().getConfidence( 0 ).getValue(), 0.810000000000000e+00 ) ) {
9495                 return false;
9496             }
9497             final Phylogeny p2 = factory
9498                     .create( "(1[something_else(?)s,prob=0.9500000000000000e+00{}(((,p)rob_stddev=0.110000000000e+00,"
9499                             + "prob_range={1.000000000000000e+00,1.000000000000000e+00},prob(percent)=\"100\","
9500                             + "prob+-sd=\"100+-0\"]:4.129000000000000e-02[&length_mean=4.153987461671767e-02,"
9501                             + "length_median=4.129000000000000e-02,length_95%HPD={3.217800000000000e-02,"
9502                             + "5.026800000000000e-02}],2[&prob=0.810000000000000e+00,prob_stddev=0.000000000000000e+00,"
9503                             + "prob_range={1.000000000000000e+00,1.000000000000000e+00},prob(percent)=\"100\","
9504                             + "prob+-sd=\"100+-0\"]:6.375699999999999e-02[&length_mean=6.395210411945065e-02,"
9505                             + "length_median=6.375699999999999e-02,length_95%HPD={5.388600000000000e-02,"
9506                             + "7.369400000000000e-02}])",
9507                             new NHXParser() )[ 0 ];
9508             if ( p2.getNode( "1" ) == null ) {
9509                 return false;
9510             }
9511             if ( p2.getNode( "2" ) == null ) {
9512                 return false;
9513             }
9514         }
9515         catch ( final Exception e ) {
9516             e.printStackTrace( System.out );
9517             System.exit( -1 );
9518             return false;
9519         }
9520         return true;
9521     }
9522
9523     private static boolean testNHXParsingQuotes() {
9524         try {
9525             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
9526             final NHXParser p = new NHXParser();
9527             final Phylogeny[] phylogenies_0 = factory.create( new File( Test.PATH_TO_TEST_DATA + "quotes.nhx" ), p );
9528             if ( phylogenies_0.length != 5 ) {
9529                 return false;
9530             }
9531             final Phylogeny phy = phylogenies_0[ 4 ];
9532             if ( phy.getNumberOfExternalNodes() != 7 ) {
9533                 return false;
9534             }
9535             if ( phy.getNodes( "a name in double quotes from tree ((a,b),c)" ).size() != 1 ) {
9536                 return false;
9537             }
9538             if ( phy.getNodes( "charles darwin 'origin of species'" ).size() != 1 ) {
9539                 return false;
9540             }
9541             if ( !phy.getNodes( "charles darwin 'origin of species'" ).get( 0 ).getNodeData().getTaxonomy()
9542                     .getScientificName().equals( "hsapiens" ) ) {
9543                 return false;
9544             }
9545             if ( phy.getNodes( "shouldbetogether single quotes" ).size() != 1 ) {
9546                 return false;
9547             }
9548             if ( phy.getNodes( "'single quotes' inside double quotes" ).size() != 1 ) {
9549                 return false;
9550             }
9551             if ( phy.getNodes( "\"double quotes\" inside single quotes" ).size() != 1 ) {
9552                 return false;
9553             }
9554             if ( phy.getNodes( "noquotes" ).size() != 1 ) {
9555                 return false;
9556             }
9557             if ( phy.getNodes( "A ( B C '" ).size() != 1 ) {
9558                 return false;
9559             }
9560             final NHXParser p1p = new NHXParser();
9561             p1p.setIgnoreQuotes( true );
9562             final Phylogeny p1 = factory.create( "(\"A\",'B1')", p1p )[ 0 ];
9563             if ( !p1.toNewHampshire().equals( "(A,B1);" ) ) {
9564                 return false;
9565             }
9566             final NHXParser p2p = new NHXParser();
9567             p1p.setIgnoreQuotes( false );
9568             final Phylogeny p2 = factory.create( "(\"A\",'B1')", p2p )[ 0 ];
9569             if ( !p2.toNewHampshire().equals( "(A,B1);" ) ) {
9570                 return false;
9571             }
9572             final NHXParser p3p = new NHXParser();
9573             p3p.setIgnoreQuotes( false );
9574             final Phylogeny p3 = factory.create( "(\"A)\",'B1')", p3p )[ 0 ];
9575             if ( !p3.toNewHampshire().equals( "('A)',B1);" ) ) {
9576                 return false;
9577             }
9578             final NHXParser p4p = new NHXParser();
9579             p4p.setIgnoreQuotes( false );
9580             final Phylogeny p4 = factory.create( "(\"A)\",'B(),; x')", p4p )[ 0 ];
9581             if ( !p4.toNewHampshire().equals( "('A)','B(),; x');" ) ) {
9582                 return false;
9583             }
9584             final Phylogeny p10 = factory
9585                     .create( " [79]   ( (\"A \n\tB \" [co mment] :0 .2[comment],'B':0.3[com])[com ment]: 0. 5 \t[ 9 1 ][ comment],'C (or D?\\//;,))': 0.1)[comment]'\nroot is here (cool,  was! ) ':0.1[100] [comment]",
9586                              new NHXParser() )[ 0 ];
9587             final String p10_clean_str = "(('A B':0.2,B:0.3):0.5[&&NHX:B=91],'C (or D?\\//;,))':0.1)'root is here (cool, was! )':0.1[&&NHX:B=100]";
9588             if ( !p10.toNewHampshireX().equals( p10_clean_str ) ) {
9589                 return false;
9590             }
9591             final Phylogeny p11 = factory.create( p10.toNewHampshireX(), new NHXParser() )[ 0 ];
9592             if ( !p11.toNewHampshireX().equals( p10_clean_str ) ) {
9593                 return false;
9594             }
9595             final Phylogeny p12 = factory
9596                     .create( " [79]   ( (\"A \n\tB \" [[][] :0 .2[comment][\t&\t&\n N\tH\tX:S=mo\tnkey !],'\tB\t\b\t\n\f\rB B ':0.0\b3[])\t[com ment]: 0. 5 \t[ 9 1 ][ \ncomment],'C\t (or D?\\//;,))': 0.\b1)[comment]'\nroot \tis here (cool, \b\t\n\f\r was! ) ':0.1[100] [comment]",
9597                              new NHXParser() )[ 0 ];
9598             final String p12_clean_str = "(('A B':0.2[&&NHX:S=monkey!],'BB B':0.03):0.5[&&NHX:B=91],'C (or D?\\//;,))':0.1)'root is here (cool, was! )':0.1[&&NHX:B=100]";
9599             if ( !p12.toNewHampshireX().equals( p12_clean_str ) ) {
9600                 return false;
9601             }
9602             final Phylogeny p13 = factory.create( p12.toNewHampshireX(), new NHXParser() )[ 0 ];
9603             if ( !p13.toNewHampshireX().equals( p12_clean_str ) ) {
9604                 return false;
9605             }
9606             final String p12_clean_str_nh = "(('A B':0.2,'BB B':0.03):0.5,'C (or D?\\//;,))':0.1)'root is here (cool, was! )':0.1;";
9607             if ( !p13.toNewHampshire().equals( p12_clean_str_nh ) ) {
9608                 return false;
9609             }
9610             final Phylogeny p14 = factory.create( p13.toNewHampshire(), new NHXParser() )[ 0 ];
9611             if ( !p14.toNewHampshire().equals( p12_clean_str_nh ) ) {
9612                 return false;
9613             }
9614         }
9615         catch ( final Exception e ) {
9616             e.printStackTrace( System.out );
9617             return false;
9618         }
9619         return true;
9620     }
9621
9622     private static boolean testNodeRemoval() {
9623         try {
9624             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
9625             final Phylogeny t0 = factory.create( "((a)b)", new NHXParser() )[ 0 ];
9626             PhylogenyMethods.removeNode( t0.getNode( "b" ), t0 );
9627             if ( !t0.toNewHampshire().equals( "(a);" ) ) {
9628                 return false;
9629             }
9630             final Phylogeny t1 = factory.create( "((a:2)b:4)", new NHXParser() )[ 0 ];
9631             PhylogenyMethods.removeNode( t1.getNode( "b" ), t1 );
9632             if ( !t1.toNewHampshire().equals( "(a:6.0);" ) ) {
9633                 return false;
9634             }
9635             final Phylogeny t2 = factory.create( "((a,b),c)", new NHXParser() )[ 0 ];
9636             PhylogenyMethods.removeNode( t2.getNode( "b" ), t2 );
9637             if ( !t2.toNewHampshire().equals( "((a),c);" ) ) {
9638                 return false;
9639             }
9640         }
9641         catch ( final Exception e ) {
9642             e.printStackTrace( System.out );
9643             return false;
9644         }
9645         return true;
9646     }
9647
9648     private static boolean testPhylogenyBranch() {
9649         try {
9650             final PhylogenyNode a1 = PhylogenyNode.createInstanceFromNhxString( "a" );
9651             final PhylogenyNode b1 = PhylogenyNode.createInstanceFromNhxString( "b" );
9652             final PhylogenyBranch a1b1 = new PhylogenyBranch( a1, b1 );
9653             final PhylogenyBranch b1a1 = new PhylogenyBranch( b1, a1 );
9654             if ( !a1b1.equals( a1b1 ) ) {
9655                 return false;
9656             }
9657             if ( !a1b1.equals( b1a1 ) ) {
9658                 return false;
9659             }
9660             if ( !b1a1.equals( a1b1 ) ) {
9661                 return false;
9662             }
9663             final PhylogenyBranch a1_b1 = new PhylogenyBranch( a1, b1, true );
9664             final PhylogenyBranch b1_a1 = new PhylogenyBranch( b1, a1, true );
9665             final PhylogenyBranch a1_b1_ = new PhylogenyBranch( a1, b1, false );
9666             if ( a1_b1.equals( b1_a1 ) ) {
9667                 return false;
9668             }
9669             if ( a1_b1.equals( a1_b1_ ) ) {
9670                 return false;
9671             }
9672             final PhylogenyBranch b1_a1_ = new PhylogenyBranch( b1, a1, false );
9673             if ( !a1_b1.equals( b1_a1_ ) ) {
9674                 return false;
9675             }
9676             if ( a1_b1_.equals( b1_a1_ ) ) {
9677                 return false;
9678             }
9679             if ( !a1_b1_.equals( b1_a1 ) ) {
9680                 return false;
9681             }
9682         }
9683         catch ( final Exception e ) {
9684             e.printStackTrace( System.out );
9685             return false;
9686         }
9687         return true;
9688     }
9689
9690     private static boolean testPhyloXMLparsingOfDistributionElement() {
9691         try {
9692             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
9693             PhyloXmlParser xml_parser = null;
9694             try {
9695                 xml_parser = PhyloXmlParser.createPhyloXmlParserXsdValidating();
9696             }
9697             catch ( final Exception e ) {
9698                 // Do nothing -- means were not running from jar.
9699             }
9700             if ( xml_parser == null ) {
9701                 xml_parser = PhyloXmlParser.createPhyloXmlParser();
9702                 if ( USE_LOCAL_PHYLOXML_SCHEMA ) {
9703                     xml_parser.setValidateAgainstSchema( PHYLOXML_LOCAL_XSD );
9704                 }
9705                 else {
9706                     xml_parser.setValidateAgainstSchema( PHYLOXML_REMOTE_XSD );
9707                 }
9708             }
9709             final Phylogeny[] phylogenies_0 = factory.create( Test.PATH_TO_TEST_DATA + "phyloxml_distribution.xml",
9710                                                               xml_parser );
9711             if ( xml_parser.getErrorCount() > 0 ) {
9712                 System.out.println( xml_parser.getErrorMessages().toString() );
9713                 return false;
9714             }
9715             if ( phylogenies_0.length != 1 ) {
9716                 return false;
9717             }
9718             final Phylogeny t1 = phylogenies_0[ 0 ];
9719             PhylogenyNode n = null;
9720             Distribution d = null;
9721             n = t1.getNode( "root node" );
9722             if ( !n.getNodeData().isHasDistribution() ) {
9723                 return false;
9724             }
9725             if ( n.getNodeData().getDistributions().size() != 1 ) {
9726                 return false;
9727             }
9728             d = n.getNodeData().getDistribution();
9729             if ( !d.getDesc().equals( "Hirschweg 38" ) ) {
9730                 return false;
9731             }
9732             if ( d.getPoints().size() != 1 ) {
9733                 return false;
9734             }
9735             if ( d.getPolygons() != null ) {
9736                 return false;
9737             }
9738             if ( !d.getPoints().get( 0 ).getAltitude().toString().equals( "472" ) ) {
9739                 return false;
9740             }
9741             if ( !d.getPoints().get( 0 ).getAltiudeUnit().equals( "m" ) ) {
9742                 return false;
9743             }
9744             if ( !d.getPoints().get( 0 ).getGeodeticDatum().equals( "WGS84" ) ) {
9745                 return false;
9746             }
9747             if ( !d.getPoints().get( 0 ).getLatitude().toString().equals( "47.48148427110029" ) ) {
9748                 return false;
9749             }
9750             if ( !d.getPoints().get( 0 ).getLongitude().toString().equals( "8.768951296806335" ) ) {
9751                 return false;
9752             }
9753             n = t1.getNode( "node a" );
9754             if ( !n.getNodeData().isHasDistribution() ) {
9755                 return false;
9756             }
9757             if ( n.getNodeData().getDistributions().size() != 2 ) {
9758                 return false;
9759             }
9760             d = n.getNodeData().getDistribution( 1 );
9761             if ( !d.getDesc().equals( "San Diego" ) ) {
9762                 return false;
9763             }
9764             if ( d.getPoints().size() != 1 ) {
9765                 return false;
9766             }
9767             if ( d.getPolygons() != null ) {
9768                 return false;
9769             }
9770             if ( !d.getPoints().get( 0 ).getAltitude().toString().equals( "104" ) ) {
9771                 return false;
9772             }
9773             if ( !d.getPoints().get( 0 ).getAltiudeUnit().equals( "m" ) ) {
9774                 return false;
9775             }
9776             if ( !d.getPoints().get( 0 ).getGeodeticDatum().equals( "WGS84" ) ) {
9777                 return false;
9778             }
9779             if ( !d.getPoints().get( 0 ).getLatitude().toString().equals( "32.880933" ) ) {
9780                 return false;
9781             }
9782             if ( !d.getPoints().get( 0 ).getLongitude().toString().equals( "-117.217543" ) ) {
9783                 return false;
9784             }
9785             n = t1.getNode( "node bb" );
9786             if ( !n.getNodeData().isHasDistribution() ) {
9787                 return false;
9788             }
9789             if ( n.getNodeData().getDistributions().size() != 1 ) {
9790                 return false;
9791             }
9792             d = n.getNodeData().getDistribution( 0 );
9793             if ( d.getPoints().size() != 3 ) {
9794                 return false;
9795             }
9796             if ( d.getPolygons().size() != 2 ) {
9797                 return false;
9798             }
9799             if ( !d.getPoints().get( 0 ).getLatitude().toString().equals( "1" ) ) {
9800                 return false;
9801             }
9802             if ( !d.getPoints().get( 0 ).getLongitude().toString().equals( "2" ) ) {
9803                 return false;
9804             }
9805             if ( !d.getPoints().get( 1 ).getLatitude().toString().equals( "3" ) ) {
9806                 return false;
9807             }
9808             if ( !d.getPoints().get( 1 ).getLongitude().toString().equals( "4" ) ) {
9809                 return false;
9810             }
9811             if ( !d.getPoints().get( 2 ).getLatitude().toString().equals( "5" ) ) {
9812                 return false;
9813             }
9814             if ( !d.getPoints().get( 2 ).getLongitude().toString().equals( "6" ) ) {
9815                 return false;
9816             }
9817             Polygon p = d.getPolygons().get( 0 );
9818             if ( p.getPoints().size() != 3 ) {
9819                 return false;
9820             }
9821             if ( !p.getPoints().get( 0 ).getLatitude().toString().equals( "0.1" ) ) {
9822                 return false;
9823             }
9824             if ( !p.getPoints().get( 0 ).getLongitude().toString().equals( "0.2" ) ) {
9825                 return false;
9826             }
9827             if ( !p.getPoints().get( 0 ).getAltitude().toString().equals( "10" ) ) {
9828                 return false;
9829             }
9830             if ( !p.getPoints().get( 2 ).getLatitude().toString().equals( "0.5" ) ) {
9831                 return false;
9832             }
9833             if ( !p.getPoints().get( 2 ).getLongitude().toString().equals( "0.6" ) ) {
9834                 return false;
9835             }
9836             if ( !p.getPoints().get( 2 ).getAltitude().toString().equals( "30" ) ) {
9837                 return false;
9838             }
9839             p = d.getPolygons().get( 1 );
9840             if ( p.getPoints().size() != 3 ) {
9841                 return false;
9842             }
9843             if ( !p.getPoints().get( 0 ).getLatitude().toString().equals( "1.49348902489947473" ) ) {
9844                 return false;
9845             }
9846             if ( !p.getPoints().get( 0 ).getLongitude().toString().equals( "2.567489393947847492" ) ) {
9847                 return false;
9848             }
9849             if ( !p.getPoints().get( 0 ).getAltitude().toString().equals( "10" ) ) {
9850                 return false;
9851             }
9852             // Roundtrip:
9853             final StringBuffer t1_sb = new StringBuffer( t1.toPhyloXML( 0 ) );
9854             final Phylogeny[] rt = factory.create( t1_sb, xml_parser );
9855             if ( rt.length != 1 ) {
9856                 return false;
9857             }
9858             final Phylogeny t1_rt = rt[ 0 ];
9859             n = t1_rt.getNode( "root node" );
9860             if ( !n.getNodeData().isHasDistribution() ) {
9861                 return false;
9862             }
9863             if ( n.getNodeData().getDistributions().size() != 1 ) {
9864                 return false;
9865             }
9866             d = n.getNodeData().getDistribution();
9867             if ( !d.getDesc().equals( "Hirschweg 38" ) ) {
9868                 return false;
9869             }
9870             if ( d.getPoints().size() != 1 ) {
9871                 return false;
9872             }
9873             if ( d.getPolygons() != null ) {
9874                 return false;
9875             }
9876             if ( !d.getPoints().get( 0 ).getAltitude().toString().equals( "472" ) ) {
9877                 return false;
9878             }
9879             if ( !d.getPoints().get( 0 ).getAltiudeUnit().equals( "m" ) ) {
9880                 return false;
9881             }
9882             if ( !d.getPoints().get( 0 ).getGeodeticDatum().equals( "WGS84" ) ) {
9883                 return false;
9884             }
9885             if ( !d.getPoints().get( 0 ).getLatitude().toString().equals( "47.48148427110029" ) ) {
9886                 return false;
9887             }
9888             if ( !d.getPoints().get( 0 ).getLongitude().toString().equals( "8.768951296806335" ) ) {
9889                 return false;
9890             }
9891             n = t1_rt.getNode( "node a" );
9892             if ( !n.getNodeData().isHasDistribution() ) {
9893                 return false;
9894             }
9895             if ( n.getNodeData().getDistributions().size() != 2 ) {
9896                 return false;
9897             }
9898             d = n.getNodeData().getDistribution( 1 );
9899             if ( !d.getDesc().equals( "San Diego" ) ) {
9900                 return false;
9901             }
9902             if ( d.getPoints().size() != 1 ) {
9903                 return false;
9904             }
9905             if ( d.getPolygons() != null ) {
9906                 return false;
9907             }
9908             if ( !d.getPoints().get( 0 ).getAltitude().toString().equals( "104" ) ) {
9909                 return false;
9910             }
9911             if ( !d.getPoints().get( 0 ).getAltiudeUnit().equals( "m" ) ) {
9912                 return false;
9913             }
9914             if ( !d.getPoints().get( 0 ).getGeodeticDatum().equals( "WGS84" ) ) {
9915                 return false;
9916             }
9917             if ( !d.getPoints().get( 0 ).getLatitude().toString().equals( "32.880933" ) ) {
9918                 return false;
9919             }
9920             if ( !d.getPoints().get( 0 ).getLongitude().toString().equals( "-117.217543" ) ) {
9921                 return false;
9922             }
9923             n = t1_rt.getNode( "node bb" );
9924             if ( !n.getNodeData().isHasDistribution() ) {
9925                 return false;
9926             }
9927             if ( n.getNodeData().getDistributions().size() != 1 ) {
9928                 return false;
9929             }
9930             d = n.getNodeData().getDistribution( 0 );
9931             if ( d.getPoints().size() != 3 ) {
9932                 return false;
9933             }
9934             if ( d.getPolygons().size() != 2 ) {
9935                 return false;
9936             }
9937             if ( !d.getPoints().get( 0 ).getLatitude().toString().equals( "1" ) ) {
9938                 return false;
9939             }
9940             if ( !d.getPoints().get( 0 ).getLongitude().toString().equals( "2" ) ) {
9941                 return false;
9942             }
9943             if ( !d.getPoints().get( 1 ).getLatitude().toString().equals( "3" ) ) {
9944                 return false;
9945             }
9946             if ( !d.getPoints().get( 1 ).getLongitude().toString().equals( "4" ) ) {
9947                 return false;
9948             }
9949             if ( !d.getPoints().get( 2 ).getLatitude().toString().equals( "5" ) ) {
9950                 return false;
9951             }
9952             if ( !d.getPoints().get( 2 ).getLongitude().toString().equals( "6" ) ) {
9953                 return false;
9954             }
9955             p = d.getPolygons().get( 0 );
9956             if ( p.getPoints().size() != 3 ) {
9957                 return false;
9958             }
9959             if ( !p.getPoints().get( 0 ).getLatitude().toString().equals( "0.1" ) ) {
9960                 return false;
9961             }
9962             if ( !p.getPoints().get( 0 ).getLongitude().toString().equals( "0.2" ) ) {
9963                 return false;
9964             }
9965             if ( !p.getPoints().get( 0 ).getAltitude().toString().equals( "10" ) ) {
9966                 return false;
9967             }
9968             if ( !p.getPoints().get( 2 ).getLatitude().toString().equals( "0.5" ) ) {
9969                 return false;
9970             }
9971             if ( !p.getPoints().get( 2 ).getLongitude().toString().equals( "0.6" ) ) {
9972                 return false;
9973             }
9974             if ( !p.getPoints().get( 2 ).getAltitude().toString().equals( "30" ) ) {
9975                 return false;
9976             }
9977             p = d.getPolygons().get( 1 );
9978             if ( p.getPoints().size() != 3 ) {
9979                 return false;
9980             }
9981             if ( !p.getPoints().get( 0 ).getLatitude().toString().equals( "1.49348902489947473" ) ) {
9982                 return false;
9983             }
9984             if ( !p.getPoints().get( 0 ).getLongitude().toString().equals( "2.567489393947847492" ) ) {
9985                 return false;
9986             }
9987             if ( !p.getPoints().get( 0 ).getAltitude().toString().equals( "10" ) ) {
9988                 return false;
9989             }
9990         }
9991         catch ( final Exception e ) {
9992             e.printStackTrace( System.out );
9993             return false;
9994         }
9995         return true;
9996     }
9997
9998     private static boolean testPostOrderIterator() {
9999         try {
10000             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
10001             final Phylogeny t0 = factory.create( "((A,B)ab,(C,D)cd)r", new NHXParser() )[ 0 ];
10002             PhylogenyNodeIterator it0;
10003             for( it0 = t0.iteratorPostorder(); it0.hasNext(); ) {
10004                 it0.next();
10005             }
10006             for( it0.reset(); it0.hasNext(); ) {
10007                 it0.next();
10008             }
10009             final Phylogeny t1 = factory.create( "(((A,B)ab,(C,D)cd)abcd,((E,F)ef,(G,H)gh)efgh)r", new NHXParser() )[ 0 ];
10010             final PhylogenyNodeIterator it = t1.iteratorPostorder();
10011             if ( !it.next().getName().equals( "A" ) ) {
10012                 return false;
10013             }
10014             if ( !it.next().getName().equals( "B" ) ) {
10015                 return false;
10016             }
10017             if ( !it.next().getName().equals( "ab" ) ) {
10018                 return false;
10019             }
10020             if ( !it.next().getName().equals( "C" ) ) {
10021                 return false;
10022             }
10023             if ( !it.next().getName().equals( "D" ) ) {
10024                 return false;
10025             }
10026             if ( !it.next().getName().equals( "cd" ) ) {
10027                 return false;
10028             }
10029             if ( !it.next().getName().equals( "abcd" ) ) {
10030                 return false;
10031             }
10032             if ( !it.next().getName().equals( "E" ) ) {
10033                 return false;
10034             }
10035             if ( !it.next().getName().equals( "F" ) ) {
10036                 return false;
10037             }
10038             if ( !it.next().getName().equals( "ef" ) ) {
10039                 return false;
10040             }
10041             if ( !it.next().getName().equals( "G" ) ) {
10042                 return false;
10043             }
10044             if ( !it.next().getName().equals( "H" ) ) {
10045                 return false;
10046             }
10047             if ( !it.next().getName().equals( "gh" ) ) {
10048                 return false;
10049             }
10050             if ( !it.next().getName().equals( "efgh" ) ) {
10051                 return false;
10052             }
10053             if ( !it.next().getName().equals( "r" ) ) {
10054                 return false;
10055             }
10056             if ( it.hasNext() ) {
10057                 return false;
10058             }
10059         }
10060         catch ( final Exception e ) {
10061             e.printStackTrace( System.out );
10062             return false;
10063         }
10064         return true;
10065     }
10066
10067     private static boolean testPreOrderIterator() {
10068         try {
10069             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
10070             final Phylogeny t0 = factory.create( "((A,B)ab,(C,D)cd)r", new NHXParser() )[ 0 ];
10071             PhylogenyNodeIterator it0;
10072             for( it0 = t0.iteratorPreorder(); it0.hasNext(); ) {
10073                 it0.next();
10074             }
10075             for( it0.reset(); it0.hasNext(); ) {
10076                 it0.next();
10077             }
10078             PhylogenyNodeIterator it = t0.iteratorPreorder();
10079             if ( !it.next().getName().equals( "r" ) ) {
10080                 return false;
10081             }
10082             if ( !it.next().getName().equals( "ab" ) ) {
10083                 return false;
10084             }
10085             if ( !it.next().getName().equals( "A" ) ) {
10086                 return false;
10087             }
10088             if ( !it.next().getName().equals( "B" ) ) {
10089                 return false;
10090             }
10091             if ( !it.next().getName().equals( "cd" ) ) {
10092                 return false;
10093             }
10094             if ( !it.next().getName().equals( "C" ) ) {
10095                 return false;
10096             }
10097             if ( !it.next().getName().equals( "D" ) ) {
10098                 return false;
10099             }
10100             if ( it.hasNext() ) {
10101                 return false;
10102             }
10103             final Phylogeny t1 = factory.create( "(((A,B)ab,(C,D)cd)abcd,((E,F)ef,(G,H)gh)efgh)r", new NHXParser() )[ 0 ];
10104             it = t1.iteratorPreorder();
10105             if ( !it.next().getName().equals( "r" ) ) {
10106                 return false;
10107             }
10108             if ( !it.next().getName().equals( "abcd" ) ) {
10109                 return false;
10110             }
10111             if ( !it.next().getName().equals( "ab" ) ) {
10112                 return false;
10113             }
10114             if ( !it.next().getName().equals( "A" ) ) {
10115                 return false;
10116             }
10117             if ( !it.next().getName().equals( "B" ) ) {
10118                 return false;
10119             }
10120             if ( !it.next().getName().equals( "cd" ) ) {
10121                 return false;
10122             }
10123             if ( !it.next().getName().equals( "C" ) ) {
10124                 return false;
10125             }
10126             if ( !it.next().getName().equals( "D" ) ) {
10127                 return false;
10128             }
10129             if ( !it.next().getName().equals( "efgh" ) ) {
10130                 return false;
10131             }
10132             if ( !it.next().getName().equals( "ef" ) ) {
10133                 return false;
10134             }
10135             if ( !it.next().getName().equals( "E" ) ) {
10136                 return false;
10137             }
10138             if ( !it.next().getName().equals( "F" ) ) {
10139                 return false;
10140             }
10141             if ( !it.next().getName().equals( "gh" ) ) {
10142                 return false;
10143             }
10144             if ( !it.next().getName().equals( "G" ) ) {
10145                 return false;
10146             }
10147             if ( !it.next().getName().equals( "H" ) ) {
10148                 return false;
10149             }
10150             if ( it.hasNext() ) {
10151                 return false;
10152             }
10153         }
10154         catch ( final Exception e ) {
10155             e.printStackTrace( System.out );
10156             return false;
10157         }
10158         return true;
10159     }
10160
10161     private static boolean testPropertiesMap() {
10162         try {
10163             final PropertiesMap pm = new PropertiesMap();
10164             final Property p0 = new Property( "dimensions:diameter", "1", "metric:mm", "xsd:decimal", AppliesTo.NODE );
10165             final Property p1 = new Property( "dimensions:length", "2", "metric:mm", "xsd:decimal", AppliesTo.NODE );
10166             final Property p2 = new Property( "something:else",
10167                                               "?",
10168                                               "improbable:research",
10169                                               "xsd:decimal",
10170                                               AppliesTo.NODE );
10171             pm.addProperty( p0 );
10172             pm.addProperty( p1 );
10173             pm.addProperty( p2 );
10174             if ( !pm.getProperty( "dimensions:diameter" ).getValue().equals( "1" ) ) {
10175                 return false;
10176             }
10177             if ( !pm.getProperty( "dimensions:length" ).getValue().equals( "2" ) ) {
10178                 return false;
10179             }
10180             if ( pm.getProperties().size() != 3 ) {
10181                 return false;
10182             }
10183             if ( pm.getPropertiesWithGivenReferencePrefix( "dimensions" ).size() != 2 ) {
10184                 return false;
10185             }
10186             if ( pm.getPropertiesWithGivenReferencePrefix( "something" ).size() != 1 ) {
10187                 return false;
10188             }
10189             if ( pm.getProperties().size() != 3 ) {
10190                 return false;
10191             }
10192             pm.removeProperty( "dimensions:diameter" );
10193             if ( pm.getProperties().size() != 2 ) {
10194                 return false;
10195             }
10196             if ( pm.getPropertiesWithGivenReferencePrefix( "dimensions" ).size() != 1 ) {
10197                 return false;
10198             }
10199             if ( pm.getPropertiesWithGivenReferencePrefix( "something" ).size() != 1 ) {
10200                 return false;
10201             }
10202         }
10203         catch ( final Exception e ) {
10204             e.printStackTrace( System.out );
10205             return false;
10206         }
10207         return true;
10208     }
10209
10210     private static boolean testProteinId() {
10211         try {
10212             final ProteinId id1 = new ProteinId( "a" );
10213             final ProteinId id2 = new ProteinId( "a" );
10214             final ProteinId id3 = new ProteinId( "A" );
10215             final ProteinId id4 = new ProteinId( "b" );
10216             if ( !id1.equals( id1 ) ) {
10217                 return false;
10218             }
10219             if ( id1.getId().equals( "x" ) ) {
10220                 return false;
10221             }
10222             if ( id1.getId().equals( null ) ) {
10223                 return false;
10224             }
10225             if ( !id1.equals( id2 ) ) {
10226                 return false;
10227             }
10228             if ( id1.equals( id3 ) ) {
10229                 return false;
10230             }
10231             if ( id1.hashCode() != id1.hashCode() ) {
10232                 return false;
10233             }
10234             if ( id1.hashCode() != id2.hashCode() ) {
10235                 return false;
10236             }
10237             if ( id1.hashCode() == id3.hashCode() ) {
10238                 return false;
10239             }
10240             if ( id1.compareTo( id1 ) != 0 ) {
10241                 return false;
10242             }
10243             if ( id1.compareTo( id2 ) != 0 ) {
10244                 return false;
10245             }
10246             if ( id1.compareTo( id3 ) != 0 ) {
10247                 return false;
10248             }
10249             if ( id1.compareTo( id4 ) >= 0 ) {
10250                 return false;
10251             }
10252             if ( id4.compareTo( id1 ) <= 0 ) {
10253                 return false;
10254             }
10255             if ( !id4.getId().equals( "b" ) ) {
10256                 return false;
10257             }
10258             final ProteinId id5 = new ProteinId( " C " );
10259             if ( !id5.getId().equals( "C" ) ) {
10260                 return false;
10261             }
10262             if ( id5.equals( id1 ) ) {
10263                 return false;
10264             }
10265         }
10266         catch ( final Exception e ) {
10267             e.printStackTrace( System.out );
10268             return false;
10269         }
10270         return true;
10271     }
10272
10273     private static boolean testReIdMethods() {
10274         try {
10275             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
10276             final Phylogeny p = factory.create( "((1,2)A,(((X,Y,Z)a,b)3)B,(4,5,6)C)r", new NHXParser() )[ 0 ];
10277             final long count = PhylogenyNode.getNodeCount();
10278             p.levelOrderReID();
10279             if ( p.getNode( "r" ).getId() != count ) {
10280                 return false;
10281             }
10282             if ( p.getNode( "A" ).getId() != ( count + 1 ) ) {
10283                 return false;
10284             }
10285             if ( p.getNode( "B" ).getId() != ( count + 1 ) ) {
10286                 return false;
10287             }
10288             if ( p.getNode( "C" ).getId() != ( count + 1 ) ) {
10289                 return false;
10290             }
10291             if ( p.getNode( "1" ).getId() != ( count + 2 ) ) {
10292                 return false;
10293             }
10294             if ( p.getNode( "2" ).getId() != ( count + 2 ) ) {
10295                 return false;
10296             }
10297             if ( p.getNode( "3" ).getId() != ( count + 2 ) ) {
10298                 return false;
10299             }
10300             if ( p.getNode( "4" ).getId() != ( count + 2 ) ) {
10301                 return false;
10302             }
10303             if ( p.getNode( "5" ).getId() != ( count + 2 ) ) {
10304                 return false;
10305             }
10306             if ( p.getNode( "6" ).getId() != ( count + 2 ) ) {
10307                 return false;
10308             }
10309             if ( p.getNode( "a" ).getId() != ( count + 3 ) ) {
10310                 return false;
10311             }
10312             if ( p.getNode( "b" ).getId() != ( count + 3 ) ) {
10313                 return false;
10314             }
10315             if ( p.getNode( "X" ).getId() != ( count + 4 ) ) {
10316                 return false;
10317             }
10318             if ( p.getNode( "Y" ).getId() != ( count + 4 ) ) {
10319                 return false;
10320             }
10321             if ( p.getNode( "Z" ).getId() != ( count + 4 ) ) {
10322                 return false;
10323             }
10324         }
10325         catch ( final Exception e ) {
10326             e.printStackTrace( System.out );
10327             return false;
10328         }
10329         return true;
10330     }
10331
10332     private static boolean testRerooting() {
10333         try {
10334             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
10335             final Phylogeny t1 = factory.create( "((A:1,B:2)AB:1[&&NHX:B=55],(C:3,D:5)CD:3[&&NHX:B=10])ABCD:0.5",
10336                                                  new NHXParser() )[ 0 ];
10337             if ( !t1.isRooted() ) {
10338                 return false;
10339             }
10340             t1.reRoot( t1.getNode( "D" ) );
10341             t1.reRoot( t1.getNode( "CD" ) );
10342             t1.reRoot( t1.getNode( "A" ) );
10343             t1.reRoot( t1.getNode( "B" ) );
10344             t1.reRoot( t1.getNode( "AB" ) );
10345             t1.reRoot( t1.getNode( "D" ) );
10346             t1.reRoot( t1.getNode( "C" ) );
10347             t1.reRoot( t1.getNode( "CD" ) );
10348             t1.reRoot( t1.getNode( "A" ) );
10349             t1.reRoot( t1.getNode( "B" ) );
10350             t1.reRoot( t1.getNode( "AB" ) );
10351             t1.reRoot( t1.getNode( "D" ) );
10352             t1.reRoot( t1.getNode( "D" ) );
10353             t1.reRoot( t1.getNode( "C" ) );
10354             t1.reRoot( t1.getNode( "A" ) );
10355             t1.reRoot( t1.getNode( "B" ) );
10356             t1.reRoot( t1.getNode( "AB" ) );
10357             t1.reRoot( t1.getNode( "C" ) );
10358             t1.reRoot( t1.getNode( "D" ) );
10359             t1.reRoot( t1.getNode( "CD" ) );
10360             t1.reRoot( t1.getNode( "D" ) );
10361             t1.reRoot( t1.getNode( "A" ) );
10362             t1.reRoot( t1.getNode( "B" ) );
10363             t1.reRoot( t1.getNode( "AB" ) );
10364             t1.reRoot( t1.getNode( "C" ) );
10365             t1.reRoot( t1.getNode( "D" ) );
10366             t1.reRoot( t1.getNode( "CD" ) );
10367             t1.reRoot( t1.getNode( "D" ) );
10368             if ( !isEqual( t1.getNode( "A" ).getDistanceToParent(), 1 ) ) {
10369                 return false;
10370             }
10371             if ( !isEqual( t1.getNode( "B" ).getDistanceToParent(), 2 ) ) {
10372                 return false;
10373             }
10374             if ( !isEqual( t1.getNode( "C" ).getDistanceToParent(), 3 ) ) {
10375                 return false;
10376             }
10377             if ( !isEqual( t1.getNode( "D" ).getDistanceToParent(), 2.5 ) ) {
10378                 return false;
10379             }
10380             if ( !isEqual( t1.getNode( "CD" ).getDistanceToParent(), 2.5 ) ) {
10381                 return false;
10382             }
10383             if ( !isEqual( t1.getNode( "AB" ).getDistanceToParent(), 4 ) ) {
10384                 return false;
10385             }
10386             final Phylogeny t2 = factory.create( "(((A:1,B:2)AB:10[&&NHX:B=55],C)ABC:3[&&NHX:B=33],D:5)ABCD:0.5",
10387                                                  new NHXParser() )[ 0 ];
10388             t2.reRoot( t2.getNode( "A" ) );
10389             t2.reRoot( t2.getNode( "D" ) );
10390             t2.reRoot( t2.getNode( "ABC" ) );
10391             t2.reRoot( t2.getNode( "A" ) );
10392             t2.reRoot( t2.getNode( "B" ) );
10393             t2.reRoot( t2.getNode( "D" ) );
10394             t2.reRoot( t2.getNode( "C" ) );
10395             t2.reRoot( t2.getNode( "ABC" ) );
10396             t2.reRoot( t2.getNode( "A" ) );
10397             t2.reRoot( t2.getNode( "B" ) );
10398             t2.reRoot( t2.getNode( "AB" ) );
10399             t2.reRoot( t2.getNode( "AB" ) );
10400             t2.reRoot( t2.getNode( "D" ) );
10401             t2.reRoot( t2.getNode( "C" ) );
10402             t2.reRoot( t2.getNode( "B" ) );
10403             t2.reRoot( t2.getNode( "AB" ) );
10404             t2.reRoot( t2.getNode( "D" ) );
10405             t2.reRoot( t2.getNode( "D" ) );
10406             t2.reRoot( t2.getNode( "ABC" ) );
10407             t2.reRoot( t2.getNode( "A" ) );
10408             t2.reRoot( t2.getNode( "B" ) );
10409             t2.reRoot( t2.getNode( "AB" ) );
10410             t2.reRoot( t2.getNode( "D" ) );
10411             t2.reRoot( t2.getNode( "C" ) );
10412             t2.reRoot( t2.getNode( "ABC" ) );
10413             t2.reRoot( t2.getNode( "A" ) );
10414             t2.reRoot( t2.getNode( "B" ) );
10415             t2.reRoot( t2.getNode( "AB" ) );
10416             t2.reRoot( t2.getNode( "D" ) );
10417             t2.reRoot( t2.getNode( "D" ) );
10418             t2.reRoot( t2.getNode( "C" ) );
10419             t2.reRoot( t2.getNode( "A" ) );
10420             t2.reRoot( t2.getNode( "B" ) );
10421             t2.reRoot( t2.getNode( "AB" ) );
10422             t2.reRoot( t2.getNode( "C" ) );
10423             t2.reRoot( t2.getNode( "D" ) );
10424             t2.reRoot( t2.getNode( "ABC" ) );
10425             t2.reRoot( t2.getNode( "D" ) );
10426             t2.reRoot( t2.getNode( "A" ) );
10427             t2.reRoot( t2.getNode( "B" ) );
10428             t2.reRoot( t2.getNode( "AB" ) );
10429             t2.reRoot( t2.getNode( "C" ) );
10430             t2.reRoot( t2.getNode( "D" ) );
10431             t2.reRoot( t2.getNode( "ABC" ) );
10432             t2.reRoot( t2.getNode( "D" ) );
10433             if ( !isEqual( t2.getNode( "AB" ).getBranchData().getConfidence( 0 ).getValue(), 55 ) ) {
10434                 return false;
10435             }
10436             if ( !isEqual( t2.getNode( "ABC" ).getBranchData().getConfidence( 0 ).getValue(), 33 ) ) {
10437                 return false;
10438             }
10439             t2.reRoot( t2.getNode( "ABC" ) );
10440             if ( !isEqual( t2.getNode( "AB" ).getBranchData().getConfidence( 0 ).getValue(), 55 ) ) {
10441                 return false;
10442             }
10443             if ( !isEqual( t2.getNode( "ABC" ).getBranchData().getConfidence( 0 ).getValue(), 33 ) ) {
10444                 return false;
10445             }
10446             t2.reRoot( t2.getNode( "AB" ) );
10447             if ( !isEqual( t2.getNode( "AB" ).getBranchData().getConfidence( 0 ).getValue(), 55 ) ) {
10448                 return false;
10449             }
10450             if ( !isEqual( t2.getNode( "ABC" ).getBranchData().getConfidence( 0 ).getValue(), 55 ) ) {
10451                 return false;
10452             }
10453             if ( !isEqual( t2.getNode( "D" ).getBranchData().getConfidence( 0 ).getValue(), 33 ) ) {
10454                 return false;
10455             }
10456             t2.reRoot( t2.getNode( "AB" ) );
10457             if ( !isEqual( t2.getNode( "AB" ).getBranchData().getConfidence( 0 ).getValue(), 55 ) ) {
10458                 return false;
10459             }
10460             if ( !isEqual( t2.getNode( "ABC" ).getBranchData().getConfidence( 0 ).getValue(), 55 ) ) {
10461                 return false;
10462             }
10463             if ( !isEqual( t2.getNode( "D" ).getBranchData().getConfidence( 0 ).getValue(), 33 ) ) {
10464                 return false;
10465             }
10466             t2.reRoot( t2.getNode( "D" ) );
10467             if ( !isEqual( t2.getNode( "AB" ).getBranchData().getConfidence( 0 ).getValue(), 55 ) ) {
10468                 return false;
10469             }
10470             if ( !isEqual( t2.getNode( "ABC" ).getBranchData().getConfidence( 0 ).getValue(), 33 ) ) {
10471                 return false;
10472             }
10473             t2.reRoot( t2.getNode( "ABC" ) );
10474             if ( !isEqual( t2.getNode( "AB" ).getBranchData().getConfidence( 0 ).getValue(), 55 ) ) {
10475                 return false;
10476             }
10477             if ( !isEqual( t2.getNode( "ABC" ).getBranchData().getConfidence( 0 ).getValue(), 33 ) ) {
10478                 return false;
10479             }
10480             final Phylogeny t3 = factory.create( "(A[&&NHX:B=10],B[&&NHX:B=20],C[&&NHX:B=30],D[&&NHX:B=40])",
10481                                                  new NHXParser() )[ 0 ];
10482             t3.reRoot( t3.getNode( "B" ) );
10483             if ( t3.getNode( "B" ).getBranchData().getConfidence( 0 ).getValue() != 20 ) {
10484                 return false;
10485             }
10486             if ( t3.getNode( "A" ).getParent().getBranchData().getConfidence( 0 ).getValue() != 20 ) {
10487                 return false;
10488             }
10489             if ( t3.getNode( "A" ).getParent().getNumberOfDescendants() != 3 ) {
10490                 return false;
10491             }
10492             t3.reRoot( t3.getNode( "B" ) );
10493             if ( t3.getNode( "B" ).getBranchData().getConfidence( 0 ).getValue() != 20 ) {
10494                 return false;
10495             }
10496             if ( t3.getNode( "A" ).getParent().getBranchData().getConfidence( 0 ).getValue() != 20 ) {
10497                 return false;
10498             }
10499             if ( t3.getNode( "A" ).getParent().getNumberOfDescendants() != 3 ) {
10500                 return false;
10501             }
10502             t3.reRoot( t3.getRoot() );
10503             if ( t3.getNode( "B" ).getBranchData().getConfidence( 0 ).getValue() != 20 ) {
10504                 return false;
10505             }
10506             if ( t3.getNode( "A" ).getParent().getBranchData().getConfidence( 0 ).getValue() != 20 ) {
10507                 return false;
10508             }
10509             if ( t3.getNode( "A" ).getParent().getNumberOfDescendants() != 3 ) {
10510                 return false;
10511             }
10512         }
10513         catch ( final Exception e ) {
10514             e.printStackTrace( System.out );
10515             return false;
10516         }
10517         return true;
10518     }
10519
10520     private static boolean testSDIse() {
10521         try {
10522             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
10523             final Phylogeny species1 = factory.create( "[&&NHX:S=yeast]", new NHXParser() )[ 0 ];
10524             final Phylogeny gene1 = factory.create( "(A1[&&NHX:S=yeast],A2[&&NHX:S=yeast])", new NHXParser() )[ 0 ];
10525             gene1.setRooted( true );
10526             species1.setRooted( true );
10527             final SDI sdi = new SDI( gene1, species1 );
10528             if ( !gene1.getRoot().isDuplication() ) {
10529                 return false;
10530             }
10531             final Phylogeny species2 = factory
10532                     .create( "(((([&&NHX:S=A],[&&NHX:S=B]),[&&NHX:S=C]),[&&NHX:S=D]),([&&NHX:S=E],[&&NHX:S=F]))",
10533                              new NHXParser() )[ 0 ];
10534             final Phylogeny gene2 = factory
10535                     .create( "(((([&&NHX:S=A],[&&NHX:S=B])ab,[&&NHX:S=C])abc,[&&NHX:S=D])abcd,([&&NHX:S=E],[&&NHX:S=F])ef)r",
10536                              new NHXParser() )[ 0 ];
10537             species2.setRooted( true );
10538             gene2.setRooted( true );
10539             final SDI sdi2 = new SDI( gene2, species2 );
10540             if ( sdi2.getDuplicationsSum() != 0 ) {
10541                 return false;
10542             }
10543             if ( !gene2.getNode( "ab" ).isSpeciation() ) {
10544                 return false;
10545             }
10546             if ( !gene2.getNode( "ab" ).isHasAssignedEvent() ) {
10547                 return false;
10548             }
10549             if ( !gene2.getNode( "abc" ).isSpeciation() ) {
10550                 return false;
10551             }
10552             if ( !gene2.getNode( "abc" ).isHasAssignedEvent() ) {
10553                 return false;
10554             }
10555             if ( !gene2.getNode( "r" ).isSpeciation() ) {
10556                 return false;
10557             }
10558             if ( !gene2.getNode( "r" ).isHasAssignedEvent() ) {
10559                 return false;
10560             }
10561             final Phylogeny species3 = factory
10562                     .create( "(((([&&NHX:S=A],[&&NHX:S=B]),[&&NHX:S=C]),[&&NHX:S=D]),([&&NHX:S=E],[&&NHX:S=F]))",
10563                              new NHXParser() )[ 0 ];
10564             final Phylogeny gene3 = factory
10565                     .create( "(((([&&NHX:S=A],[&&NHX:S=A])aa,[&&NHX:S=C])abc,[&&NHX:S=D])abcd,([&&NHX:S=E],[&&NHX:S=F])ef)r",
10566                              new NHXParser() )[ 0 ];
10567             species3.setRooted( true );
10568             gene3.setRooted( true );
10569             final SDI sdi3 = new SDI( gene3, species3 );
10570             if ( sdi3.getDuplicationsSum() != 1 ) {
10571                 return false;
10572             }
10573             if ( !gene3.getNode( "aa" ).isDuplication() ) {
10574                 return false;
10575             }
10576             if ( !gene3.getNode( "aa" ).isHasAssignedEvent() ) {
10577                 return false;
10578             }
10579             final Phylogeny species4 = factory
10580                     .create( "(((([&&NHX:S=A],[&&NHX:S=B]),[&&NHX:S=C]),[&&NHX:S=D]),([&&NHX:S=E],[&&NHX:S=F]))",
10581                              new NHXParser() )[ 0 ];
10582             final Phylogeny gene4 = factory
10583                     .create( "(((([&&NHX:S=A],[&&NHX:S=C])ac,[&&NHX:S=B])abc,[&&NHX:S=D])abcd,([&&NHX:S=E],[&&NHX:S=F])ef)r",
10584                              new NHXParser() )[ 0 ];
10585             species4.setRooted( true );
10586             gene4.setRooted( true );
10587             final SDI sdi4 = new SDI( gene4, species4 );
10588             if ( sdi4.getDuplicationsSum() != 1 ) {
10589                 return false;
10590             }
10591             if ( !gene4.getNode( "ac" ).isSpeciation() ) {
10592                 return false;
10593             }
10594             if ( !gene4.getNode( "abc" ).isDuplication() ) {
10595                 return false;
10596             }
10597             if ( gene4.getNode( "abcd" ).isDuplication() ) {
10598                 return false;
10599             }
10600             if ( species4.getNumberOfExternalNodes() != 6 ) {
10601                 return false;
10602             }
10603             if ( gene4.getNumberOfExternalNodes() != 6 ) {
10604                 return false;
10605             }
10606             final Phylogeny species5 = factory
10607                     .create( "(((([&&NHX:S=A],[&&NHX:S=B]),[&&NHX:S=C]),[&&NHX:S=D]),([&&NHX:S=E],[&&NHX:S=F]))",
10608                              new NHXParser() )[ 0 ];
10609             final Phylogeny gene5 = factory
10610                     .create( "(((([&&NHX:S=A],[&&NHX:S=D])ad,[&&NHX:S=C])adc,[&&NHX:S=B])abcd,([&&NHX:S=E],[&&NHX:S=F])ef)r",
10611                              new NHXParser() )[ 0 ];
10612             species5.setRooted( true );
10613             gene5.setRooted( true );
10614             final SDI sdi5 = new SDI( gene5, species5 );
10615             if ( sdi5.getDuplicationsSum() != 2 ) {
10616                 return false;
10617             }
10618             if ( !gene5.getNode( "ad" ).isSpeciation() ) {
10619                 return false;
10620             }
10621             if ( !gene5.getNode( "adc" ).isDuplication() ) {
10622                 return false;
10623             }
10624             if ( !gene5.getNode( "abcd" ).isDuplication() ) {
10625                 return false;
10626             }
10627             if ( species5.getNumberOfExternalNodes() != 6 ) {
10628                 return false;
10629             }
10630             if ( gene5.getNumberOfExternalNodes() != 6 ) {
10631                 return false;
10632             }
10633             // Trees from Louxin Zhang 1997 "On a Mirkin-Muchnik-Smith
10634             // Conjecture for Comparing Molecular Phylogenies"
10635             // J. of Comput Bio. Vol. 4, No 2, pp.177-187
10636             final Phylogeny species6 = factory
10637                     .create( "(((1:[&&NHX:S=1],5:[&&NHX:S=5])1-5,((4:[&&NHX:S=4],6:[&&NHX:S=6])4-6,2:[&&NHX:S=2])4-6-2)1-5-4-6-2,"
10638                             + "((9:[&&NHX:S=9],3:[&&NHX:S=3])9-3,(8:[&&NHX:S=8],7:[&&NHX:S=7])8-7)9-3-8-7)",
10639                             new NHXParser() )[ 0 ];
10640             final Phylogeny gene6 = factory
10641                     .create( "(((1:0.1[&&NHX:S=1],2:0.1[&&NHX:S=2])1-2:0.1,3:0.1[&&NHX:S=3])1-2-3:0.1,"
10642                             + "((4:0.1[&&NHX:S=4],(5:0.1[&&NHX:S=5],6:0.1[&&NHX:S=6])5-6:0.1)4-5-6:0.1,"
10643                             + "(7:0.1[&&NHX:S=7],(8:0.1[&&NHX:S=8],9:0.1[&&NHX:S=9])8-9:0.1)7-8-9:0.1)4-5-6-7-8-9:0.1)r;",
10644                             new NHXParser() )[ 0 ];
10645             species6.setRooted( true );
10646             gene6.setRooted( true );
10647             final SDI sdi6 = new SDI( gene6, species6 );
10648             if ( sdi6.getDuplicationsSum() != 3 ) {
10649                 return false;
10650             }
10651             if ( !gene6.getNode( "r" ).isDuplication() ) {
10652                 return false;
10653             }
10654             if ( !gene6.getNode( "4-5-6" ).isDuplication() ) {
10655                 return false;
10656             }
10657             if ( !gene6.getNode( "7-8-9" ).isDuplication() ) {
10658                 return false;
10659             }
10660             if ( !gene6.getNode( "1-2" ).isSpeciation() ) {
10661                 return false;
10662             }
10663             if ( !gene6.getNode( "1-2-3" ).isSpeciation() ) {
10664                 return false;
10665             }
10666             if ( !gene6.getNode( "5-6" ).isSpeciation() ) {
10667                 return false;
10668             }
10669             if ( !gene6.getNode( "8-9" ).isSpeciation() ) {
10670                 return false;
10671             }
10672             if ( !gene6.getNode( "4-5-6-7-8-9" ).isSpeciation() ) {
10673                 return false;
10674             }
10675             sdi6.computeMappingCostL();
10676             if ( sdi6.computeMappingCostL() != 17 ) {
10677                 return false;
10678             }
10679             if ( species6.getNumberOfExternalNodes() != 9 ) {
10680                 return false;
10681             }
10682             if ( gene6.getNumberOfExternalNodes() != 9 ) {
10683                 return false;
10684             }
10685             final Phylogeny species7 = Test.createPhylogeny( "(((((((" + "([&&NHX:S=a1],[&&NHX:S=a2]),"
10686                     + "([&&NHX:S=b1],[&&NHX:S=b2])" + "),[&&NHX:S=x]),(" + "([&&NHX:S=m1],[&&NHX:S=m2]),"
10687                     + "([&&NHX:S=n1],[&&NHX:S=n2])" + ")),(" + "([&&NHX:S=i1],[&&NHX:S=i2]),"
10688                     + "([&&NHX:S=j1],[&&NHX:S=j2])" + ")),(" + "([&&NHX:S=e1],[&&NHX:S=e2]),"
10689                     + "([&&NHX:S=f1],[&&NHX:S=f2])" + ")),[&&NHX:S=y]),[&&NHX:S=z])" );
10690             species7.setRooted( true );
10691             final Phylogeny gene7_1 = Test
10692                     .createPhylogeny( "((((((((a1[&&NHX:S=a1],a2[&&NHX:S=a2]),b1[&&NHX:S=b1]),x[&&NHX:S=x]),m1[&&NHX:S=m1]),i1[&&NHX:S=i1]),e1[&&NHX:S=e1]),y[&&NHX:S=y]),z[&&NHX:S=z])" );
10693             gene7_1.setRooted( true );
10694             final SDI sdi7 = new SDI( gene7_1, species7 );
10695             if ( sdi7.getDuplicationsSum() != 0 ) {
10696                 return false;
10697             }
10698             if ( !Test.getEvent( gene7_1, "a1", "a2" ).isSpeciation() ) {
10699                 return false;
10700             }
10701             if ( !Test.getEvent( gene7_1, "a1", "b1" ).isSpeciation() ) {
10702                 return false;
10703             }
10704             if ( !Test.getEvent( gene7_1, "a1", "x" ).isSpeciation() ) {
10705                 return false;
10706             }
10707             if ( !Test.getEvent( gene7_1, "a1", "m1" ).isSpeciation() ) {
10708                 return false;
10709             }
10710             if ( !Test.getEvent( gene7_1, "a1", "i1" ).isSpeciation() ) {
10711                 return false;
10712             }
10713             if ( !Test.getEvent( gene7_1, "a1", "e1" ).isSpeciation() ) {
10714                 return false;
10715             }
10716             if ( !Test.getEvent( gene7_1, "a1", "y" ).isSpeciation() ) {
10717                 return false;
10718             }
10719             if ( !Test.getEvent( gene7_1, "a1", "z" ).isSpeciation() ) {
10720                 return false;
10721             }
10722             final Phylogeny gene7_2 = Test
10723                     .createPhylogeny( "(((((((((a1[&&NHX:S=a1],a2[&&NHX:S=a2]),b1[&&NHX:S=b1]),x[&&NHX:S=x]),m1[&&NHX:S=m1]),i1[&&NHX:S=i1]),j2[&&NHX:S=j2]),e1[&&NHX:S=e1]),y[&&NHX:S=y]),z[&&NHX:S=z])" );
10724             gene7_2.setRooted( true );
10725             final SDI sdi7_2 = new SDI( gene7_2, species7 );
10726             if ( sdi7_2.getDuplicationsSum() != 1 ) {
10727                 return false;
10728             }
10729             if ( !Test.getEvent( gene7_2, "a1", "a2" ).isSpeciation() ) {
10730                 return false;
10731             }
10732             if ( !Test.getEvent( gene7_2, "a1", "b1" ).isSpeciation() ) {
10733                 return false;
10734             }
10735             if ( !Test.getEvent( gene7_2, "a1", "x" ).isSpeciation() ) {
10736                 return false;
10737             }
10738             if ( !Test.getEvent( gene7_2, "a1", "m1" ).isSpeciation() ) {
10739                 return false;
10740             }
10741             if ( !Test.getEvent( gene7_2, "a1", "i1" ).isSpeciation() ) {
10742                 return false;
10743             }
10744             if ( !Test.getEvent( gene7_2, "a1", "j2" ).isDuplication() ) {
10745                 return false;
10746             }
10747             if ( !Test.getEvent( gene7_2, "a1", "e1" ).isSpeciation() ) {
10748                 return false;
10749             }
10750             if ( !Test.getEvent( gene7_2, "a1", "y" ).isSpeciation() ) {
10751                 return false;
10752             }
10753             if ( !Test.getEvent( gene7_2, "a1", "z" ).isSpeciation() ) {
10754                 return false;
10755             }
10756         }
10757         catch ( final Exception e ) {
10758             return false;
10759         }
10760         return true;
10761     }
10762
10763     private static boolean testSDIunrooted() {
10764         try {
10765             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
10766             final Phylogeny p0 = factory.create( "((((A,B)ab,(C1,C2)cc)abc,D)abcd,(E,F)ef)abcdef", new NHXParser() )[ 0 ];
10767             final List<PhylogenyBranch> l = SDIR.getBranchesInPreorder( p0 );
10768             final Iterator<PhylogenyBranch> iter = l.iterator();
10769             PhylogenyBranch br = iter.next();
10770             if ( !br.getFirstNode().getName().equals( "abcd" ) && !br.getFirstNode().getName().equals( "ef" ) ) {
10771                 return false;
10772             }
10773             if ( !br.getSecondNode().getName().equals( "abcd" ) && !br.getSecondNode().getName().equals( "ef" ) ) {
10774                 return false;
10775             }
10776             br = iter.next();
10777             if ( !br.getFirstNode().getName().equals( "abcd" ) && !br.getFirstNode().getName().equals( "abc" ) ) {
10778                 return false;
10779             }
10780             if ( !br.getSecondNode().getName().equals( "abcd" ) && !br.getSecondNode().getName().equals( "abc" ) ) {
10781                 return false;
10782             }
10783             br = iter.next();
10784             if ( !br.getFirstNode().getName().equals( "abc" ) && !br.getFirstNode().getName().equals( "ab" ) ) {
10785                 return false;
10786             }
10787             if ( !br.getSecondNode().getName().equals( "abc" ) && !br.getSecondNode().getName().equals( "ab" ) ) {
10788                 return false;
10789             }
10790             br = iter.next();
10791             if ( !br.getFirstNode().getName().equals( "ab" ) && !br.getFirstNode().getName().equals( "A" ) ) {
10792                 return false;
10793             }
10794             if ( !br.getSecondNode().getName().equals( "ab" ) && !br.getSecondNode().getName().equals( "A" ) ) {
10795                 return false;
10796             }
10797             br = iter.next();
10798             if ( !br.getFirstNode().getName().equals( "ab" ) && !br.getFirstNode().getName().equals( "B" ) ) {
10799                 return false;
10800             }
10801             if ( !br.getSecondNode().getName().equals( "ab" ) && !br.getSecondNode().getName().equals( "B" ) ) {
10802                 return false;
10803             }
10804             br = iter.next();
10805             if ( !br.getFirstNode().getName().equals( "ab" ) && !br.getFirstNode().getName().equals( "abc" ) ) {
10806                 return false;
10807             }
10808             if ( !br.getSecondNode().getName().equals( "ab" ) && !br.getSecondNode().getName().equals( "abc" ) ) {
10809                 return false;
10810             }
10811             br = iter.next();
10812             if ( !br.getFirstNode().getName().equals( "abc" ) && !br.getFirstNode().getName().equals( "cc" ) ) {
10813                 return false;
10814             }
10815             if ( !br.getSecondNode().getName().equals( "abc" ) && !br.getSecondNode().getName().equals( "cc" ) ) {
10816                 return false;
10817             }
10818             br = iter.next();
10819             if ( !br.getFirstNode().getName().equals( "C1" ) && !br.getFirstNode().getName().equals( "cc" ) ) {
10820                 return false;
10821             }
10822             if ( !br.getSecondNode().getName().equals( "C1" ) && !br.getSecondNode().getName().equals( "cc" ) ) {
10823                 return false;
10824             }
10825             br = iter.next();
10826             if ( !br.getFirstNode().getName().equals( "C2" ) && !br.getFirstNode().getName().equals( "cc" ) ) {
10827                 return false;
10828             }
10829             if ( !br.getSecondNode().getName().equals( "C2" ) && !br.getSecondNode().getName().equals( "cc" ) ) {
10830                 return false;
10831             }
10832             br = iter.next();
10833             if ( !br.getFirstNode().getName().equals( "abc" ) && !br.getFirstNode().getName().equals( "cc" ) ) {
10834                 return false;
10835             }
10836             if ( !br.getSecondNode().getName().equals( "abc" ) && !br.getSecondNode().getName().equals( "cc" ) ) {
10837                 return false;
10838             }
10839             br = iter.next();
10840             if ( !br.getFirstNode().getName().equals( "abc" ) && !br.getFirstNode().getName().equals( "abcd" ) ) {
10841                 return false;
10842             }
10843             if ( !br.getSecondNode().getName().equals( "abc" ) && !br.getSecondNode().getName().equals( "abcd" ) ) {
10844                 return false;
10845             }
10846             br = iter.next();
10847             if ( !br.getFirstNode().getName().equals( "abcd" ) && !br.getFirstNode().getName().equals( "D" ) ) {
10848                 return false;
10849             }
10850             if ( !br.getSecondNode().getName().equals( "abcd" ) && !br.getSecondNode().getName().equals( "D" ) ) {
10851                 return false;
10852             }
10853             br = iter.next();
10854             if ( !br.getFirstNode().getName().equals( "ef" ) && !br.getFirstNode().getName().equals( "abcd" ) ) {
10855                 return false;
10856             }
10857             if ( !br.getSecondNode().getName().equals( "ef" ) && !br.getSecondNode().getName().equals( "abcd" ) ) {
10858                 return false;
10859             }
10860             br = iter.next();
10861             if ( !br.getFirstNode().getName().equals( "ef" ) && !br.getFirstNode().getName().equals( "E" ) ) {
10862                 return false;
10863             }
10864             if ( !br.getSecondNode().getName().equals( "ef" ) && !br.getSecondNode().getName().equals( "E" ) ) {
10865                 return false;
10866             }
10867             br = iter.next();
10868             if ( !br.getFirstNode().getName().equals( "ef" ) && !br.getFirstNode().getName().equals( "F" ) ) {
10869                 return false;
10870             }
10871             if ( !br.getSecondNode().getName().equals( "ef" ) && !br.getSecondNode().getName().equals( "F" ) ) {
10872                 return false;
10873             }
10874             if ( iter.hasNext() ) {
10875                 return false;
10876             }
10877             final Phylogeny p1 = factory.create( "(C,(A,B)ab)abc", new NHXParser() )[ 0 ];
10878             final List<PhylogenyBranch> l1 = SDIR.getBranchesInPreorder( p1 );
10879             final Iterator<PhylogenyBranch> iter1 = l1.iterator();
10880             br = iter1.next();
10881             if ( !br.getFirstNode().getName().equals( "ab" ) && !br.getFirstNode().getName().equals( "C" ) ) {
10882                 return false;
10883             }
10884             if ( !br.getSecondNode().getName().equals( "ab" ) && !br.getSecondNode().getName().equals( "C" ) ) {
10885                 return false;
10886             }
10887             br = iter1.next();
10888             if ( !br.getFirstNode().getName().equals( "ab" ) && !br.getFirstNode().getName().equals( "A" ) ) {
10889                 return false;
10890             }
10891             if ( !br.getSecondNode().getName().equals( "ab" ) && !br.getSecondNode().getName().equals( "A" ) ) {
10892                 return false;
10893             }
10894             br = iter1.next();
10895             if ( !br.getFirstNode().getName().equals( "ab" ) && !br.getFirstNode().getName().equals( "B" ) ) {
10896                 return false;
10897             }
10898             if ( !br.getSecondNode().getName().equals( "ab" ) && !br.getSecondNode().getName().equals( "B" ) ) {
10899                 return false;
10900             }
10901             if ( iter1.hasNext() ) {
10902                 return false;
10903             }
10904             final Phylogeny p2 = factory.create( "((A,B)ab,C)abc", new NHXParser() )[ 0 ];
10905             final List<PhylogenyBranch> l2 = SDIR.getBranchesInPreorder( p2 );
10906             final Iterator<PhylogenyBranch> iter2 = l2.iterator();
10907             br = iter2.next();
10908             if ( !br.getFirstNode().getName().equals( "ab" ) && !br.getFirstNode().getName().equals( "C" ) ) {
10909                 return false;
10910             }
10911             if ( !br.getSecondNode().getName().equals( "ab" ) && !br.getSecondNode().getName().equals( "C" ) ) {
10912                 return false;
10913             }
10914             br = iter2.next();
10915             if ( !br.getFirstNode().getName().equals( "ab" ) && !br.getFirstNode().getName().equals( "A" ) ) {
10916                 return false;
10917             }
10918             if ( !br.getSecondNode().getName().equals( "ab" ) && !br.getSecondNode().getName().equals( "A" ) ) {
10919                 return false;
10920             }
10921             br = iter2.next();
10922             if ( !br.getFirstNode().getName().equals( "ab" ) && !br.getFirstNode().getName().equals( "B" ) ) {
10923                 return false;
10924             }
10925             if ( !br.getSecondNode().getName().equals( "ab" ) && !br.getSecondNode().getName().equals( "B" ) ) {
10926                 return false;
10927             }
10928             if ( iter2.hasNext() ) {
10929                 return false;
10930             }
10931             final Phylogeny species0 = factory
10932                     .create( "(((([&&NHX:S=A],[&&NHX:S=B]),[&&NHX:S=C]),[&&NHX:S=D]),([&&NHX:S=E],[&&NHX:S=F]))",
10933                              new NHXParser() )[ 0 ];
10934             final Phylogeny gene1 = factory
10935                     .create( "(((((A:0.6[&&NHX:S=A],B:0.1[&&NHX:S=B])ab:0.1,C:0.1[&&NHX:S=C])abc:0.3,D:1.0[&&NHX:S=D])abcd:0.2,E:0.1[&&NHX:S=E])abcde:0.2,F:0.2[&&NHX:S=F])",
10936                              new NHXParser() )[ 0 ];
10937             species0.setRooted( true );
10938             gene1.setRooted( true );
10939             final SDIR sdi_unrooted = new SDIR();
10940             sdi_unrooted.infer( gene1, species0, false, true, true, true, 10 );
10941             if ( sdi_unrooted.getCount() != 1 ) {
10942                 return false;
10943             }
10944             if ( sdi_unrooted.getMinimalDuplications() != 0 ) {
10945                 return false;
10946             }
10947             if ( !Test.isEqual( sdi_unrooted.getMinimalDiffInSubTreeHeights(), 0.4 ) ) {
10948                 return false;
10949             }
10950             if ( !Test.isEqual( sdi_unrooted.getMinimalTreeHeight(), 1.0 ) ) {
10951                 return false;
10952             }
10953             if ( sdi_unrooted.getMinimalMappingCost() != Integer.MAX_VALUE ) {
10954                 return false;
10955             }
10956             final Phylogeny gene2 = factory
10957                     .create( "(((((A:2.6[&&NHX:S=A],B:0.1[&&NHX:S=B])ab:0.1,C:0.1[&&NHX:S=C])abc:0.3,D:1.0[&&NHX:S=D])abcd:0.2,E:0.1[&&NHX:S=E])abcde:0.2,F:0.2[&&NHX:S=F])",
10958                              new NHXParser() )[ 0 ];
10959             gene2.setRooted( true );
10960             sdi_unrooted.infer( gene2, species0, false, false, true, true, 10 );
10961             if ( sdi_unrooted.getCount() != 1 ) {
10962                 return false;
10963             }
10964             if ( sdi_unrooted.getMinimalDuplications() != 3 ) {
10965                 return false;
10966             }
10967             if ( !Test.isEqual( sdi_unrooted.getMinimalDiffInSubTreeHeights(), 0.0 ) ) {
10968                 return false;
10969             }
10970             if ( !Test.isEqual( sdi_unrooted.getMinimalTreeHeight(), 2.0 ) ) {
10971                 return false;
10972             }
10973             if ( sdi_unrooted.getMinimalMappingCost() != Integer.MAX_VALUE ) {
10974                 return false;
10975             }
10976             final Phylogeny species6 = factory
10977                     .create( "(((1:[&&NHX:S=1],5:[&&NHX:S=5])1-5,((4:[&&NHX:S=4],6:[&&NHX:S=6])4-6,2:[&&NHX:S=2])4-6-2)1-5-4-6-2,"
10978                             + "((9:[&&NHX:S=9],3:[&&NHX:S=3])9-3,(8:[&&NHX:S=8],7:[&&NHX:S=7])8-7)9-3-8-7)",
10979                             new NHXParser() )[ 0 ];
10980             final Phylogeny gene6 = factory
10981                     .create( "((5:0.1[&&NHX:S=5],6:0.1[&&NHX:S=6])5-6:0.05[&&NHX:S=6],(4:0.1[&&NHX:S=4],"
10982                             + "(((1:0.1[&&NHX:S=1],2:0.1[&&NHX:S=2])1-2:0.1[&&NHX:S=2],3:0.25[&&NHX:S=3])1-2-3:0.2[&&NHX:S=2],"
10983                             + "(7:0.1[&&NHX:S=7],(8:0.1[&&NHX:S=8],"
10984                             + "9:0.1[&&NHX:S=9])8-9:0.1[&&NHX:S=9])7-8-9:0.1[&&NHX:S=8])"
10985                             + "4-5-6-7-8-9:0.1[&&NHX:S=5])4-5-6:0.05[&&NHX:S=5])",
10986                             new NHXParser() )[ 0 ];
10987             species6.setRooted( true );
10988             gene6.setRooted( true );
10989             Phylogeny[] p6 = sdi_unrooted.infer( gene6, species6, false, true, true, true, 10 );
10990             if ( sdi_unrooted.getCount() != 1 ) {
10991                 return false;
10992             }
10993             if ( !Test.isEqual( sdi_unrooted.getMinimalDiffInSubTreeHeights(), 0.0 ) ) {
10994                 return false;
10995             }
10996             if ( !Test.isEqual( sdi_unrooted.getMinimalTreeHeight(), 0.375 ) ) {
10997                 return false;
10998             }
10999             if ( sdi_unrooted.getMinimalDuplications() != 3 ) {
11000                 return false;
11001             }
11002             if ( sdi_unrooted.getMinimalMappingCost() != Integer.MAX_VALUE ) {
11003                 return false;
11004             }
11005             if ( !p6[ 0 ].getRoot().isDuplication() ) {
11006                 return false;
11007             }
11008             if ( !p6[ 0 ].getNode( "4-5-6" ).isDuplication() ) {
11009                 return false;
11010             }
11011             if ( !p6[ 0 ].getNode( "7-8-9" ).isDuplication() ) {
11012                 return false;
11013             }
11014             if ( p6[ 0 ].getNode( "1-2" ).isDuplication() ) {
11015                 return false;
11016             }
11017             if ( p6[ 0 ].getNode( "1-2-3" ).isDuplication() ) {
11018                 return false;
11019             }
11020             if ( p6[ 0 ].getNode( "5-6" ).isDuplication() ) {
11021                 return false;
11022             }
11023             if ( p6[ 0 ].getNode( "8-9" ).isDuplication() ) {
11024                 return false;
11025             }
11026             if ( p6[ 0 ].getNode( "4-5-6-7-8-9" ).isDuplication() ) {
11027                 return false;
11028             }
11029             p6 = null;
11030             final Phylogeny species7 = factory
11031                     .create( "(((1:[&&NHX:S=1],5:[&&NHX:S=5])1-5,((4:[&&NHX:S=4],6:[&&NHX:S=6])4-6,2:[&&NHX:S=2])4-6-2)1-5-4-6-2,"
11032                             + "((9:[&&NHX:S=9],3:[&&NHX:S=3])9-3,(8:[&&NHX:S=8],7:[&&NHX:S=7])8-7)9-3-8-7)",
11033                             new NHXParser() )[ 0 ];
11034             final Phylogeny gene7 = factory
11035                     .create( "((5:0.1[&&NHX:S=5],6:0.1[&&NHX:S=6])5-6:0.05[&&NHX:S=6],(4:0.1[&&NHX:S=4],"
11036                             + "(((1:0.1[&&NHX:S=1],2:0.1[&&NHX:S=2])1-2:0.1[&&NHX:S=2],3:0.25[&&NHX:S=3])1-2-3:0.2[&&NHX:S=2],"
11037                             + "(7:0.1[&&NHX:S=7],(8:0.1[&&NHX:S=8],"
11038                             + "9:0.1[&&NHX:S=9])8-9:0.1[&&NHX:S=9])7-8-9:0.1[&&NHX:S=8])"
11039                             + "4-5-6-7-8-9:0.1[&&NHX:S=5])4-5-6:0.05[&&NHX:S=5])",
11040                             new NHXParser() )[ 0 ];
11041             species7.setRooted( true );
11042             gene7.setRooted( true );
11043             Phylogeny[] p7 = sdi_unrooted.infer( gene7, species7, true, true, true, true, 10 );
11044             if ( sdi_unrooted.getCount() != 1 ) {
11045                 return false;
11046             }
11047             if ( !Test.isEqual( sdi_unrooted.getMinimalDiffInSubTreeHeights(), 0.0 ) ) {
11048                 return false;
11049             }
11050             if ( !Test.isEqual( sdi_unrooted.getMinimalTreeHeight(), 0.375 ) ) {
11051                 return false;
11052             }
11053             if ( sdi_unrooted.getMinimalDuplications() != 3 ) {
11054                 return false;
11055             }
11056             if ( sdi_unrooted.getMinimalMappingCost() != 17 ) {
11057                 return false;
11058             }
11059             if ( !p7[ 0 ].getRoot().isDuplication() ) {
11060                 return false;
11061             }
11062             if ( !p7[ 0 ].getNode( "4-5-6" ).isDuplication() ) {
11063                 return false;
11064             }
11065             if ( !p7[ 0 ].getNode( "7-8-9" ).isDuplication() ) {
11066                 return false;
11067             }
11068             if ( p7[ 0 ].getNode( "1-2" ).isDuplication() ) {
11069                 return false;
11070             }
11071             if ( p7[ 0 ].getNode( "1-2-3" ).isDuplication() ) {
11072                 return false;
11073             }
11074             if ( p7[ 0 ].getNode( "5-6" ).isDuplication() ) {
11075                 return false;
11076             }
11077             if ( p7[ 0 ].getNode( "8-9" ).isDuplication() ) {
11078                 return false;
11079             }
11080             if ( p7[ 0 ].getNode( "4-5-6-7-8-9" ).isDuplication() ) {
11081                 return false;
11082             }
11083             p7 = null;
11084             final Phylogeny species8 = factory
11085                     .create( "(((1:[&&NHX:S=1],5:[&&NHX:S=5])1-5,((4:[&&NHX:S=4],6:[&&NHX:S=6])4-6,2:[&&NHX:S=2])4-6-2)1-5-4-6-2,"
11086                             + "((9:[&&NHX:S=9],3:[&&NHX:S=3])9-3,(8:[&&NHX:S=8],7:[&&NHX:S=7])8-7)9-3-8-7)",
11087                             new NHXParser() )[ 0 ];
11088             final Phylogeny gene8 = factory
11089                     .create( "((5:0.1[&&NHX:S=5],6:0.1[&&NHX:S=6])5-6:0.05[&&NHX:S=6],(4:0.1[&&NHX:S=4],"
11090                             + "(((1:0.1[&&NHX:S=1],2:0.1[&&NHX:S=2])1-2:0.1[&&NHX:S=2],3:0.25[&&NHX:S=3])1-2-3:0.2[&&NHX:S=2],"
11091                             + "(7:0.1[&&NHX:S=7],(8:0.1[&&NHX:S=8],"
11092                             + "9:0.1[&&NHX:S=9])8-9:0.1[&&NHX:S=9])7-8-9:0.1[&&NHX:S=8])"
11093                             + "4-5-6-7-8-9:0.1[&&NHX:S=5])4-5-6:0.05[&&NHX:S=5])",
11094                             new NHXParser() )[ 0 ];
11095             species8.setRooted( true );
11096             gene8.setRooted( true );
11097             Phylogeny[] p8 = sdi_unrooted.infer( gene8, species8, false, false, true, true, 10 );
11098             if ( sdi_unrooted.getCount() != 1 ) {
11099                 return false;
11100             }
11101             if ( !Test.isEqual( sdi_unrooted.getMinimalDiffInSubTreeHeights(), 0.0 ) ) {
11102                 return false;
11103             }
11104             if ( !Test.isEqual( sdi_unrooted.getMinimalTreeHeight(), 0.375 ) ) {
11105                 return false;
11106             }
11107             if ( sdi_unrooted.getMinimalDuplications() != 3 ) {
11108                 return false;
11109             }
11110             if ( sdi_unrooted.getMinimalMappingCost() != Integer.MAX_VALUE ) {
11111                 return false;
11112             }
11113             if ( !p8[ 0 ].getRoot().isDuplication() ) {
11114                 return false;
11115             }
11116             if ( !p8[ 0 ].getNode( "4-5-6" ).isDuplication() ) {
11117                 return false;
11118             }
11119             if ( !p8[ 0 ].getNode( "7-8-9" ).isDuplication() ) {
11120                 return false;
11121             }
11122             if ( p8[ 0 ].getNode( "1-2" ).isDuplication() ) {
11123                 return false;
11124             }
11125             if ( p8[ 0 ].getNode( "1-2-3" ).isDuplication() ) {
11126                 return false;
11127             }
11128             if ( p8[ 0 ].getNode( "5-6" ).isDuplication() ) {
11129                 return false;
11130             }
11131             if ( p8[ 0 ].getNode( "8-9" ).isDuplication() ) {
11132                 return false;
11133             }
11134             if ( p8[ 0 ].getNode( "4-5-6-7-8-9" ).isDuplication() ) {
11135                 return false;
11136             }
11137             p8 = null;
11138         }
11139         catch ( final Exception e ) {
11140             e.printStackTrace( System.out );
11141             return false;
11142         }
11143         return true;
11144     }
11145
11146     private static boolean testSequenceDbWsTools1() {
11147         try {
11148             final PhylogenyNode n = new PhylogenyNode();
11149             n.setName( "NP_001025424" );
11150             Accession acc = SequenceDbWsTools.obtainSeqAccession( n );
11151             if ( ( acc == null ) || !acc.getSource().equals( Source.REFSEQ.toString() )
11152                     || !acc.getValue().equals( "NP_001025424" ) ) {
11153                 return false;
11154             }
11155             n.setName( "340 0559 -- _NP_001025424_dsfdg15 05" );
11156             acc = SequenceDbWsTools.obtainSeqAccession( n );
11157             if ( ( acc == null ) || !acc.getSource().equals( Source.REFSEQ.toString() )
11158                     || !acc.getValue().equals( "NP_001025424" ) ) {
11159                 return false;
11160             }
11161             n.setName( "NP_001025424.1" );
11162             acc = SequenceDbWsTools.obtainSeqAccession( n );
11163             if ( ( acc == null ) || !acc.getSource().equals( Source.REFSEQ.toString() )
11164                     || !acc.getValue().equals( "NP_001025424" ) ) {
11165                 return false;
11166             }
11167             n.setName( "NM_001030253" );
11168             acc = SequenceDbWsTools.obtainSeqAccession( n );
11169             if ( ( acc == null ) || !acc.getSource().equals( Source.REFSEQ.toString() )
11170                     || !acc.getValue().equals( "NM_001030253" ) ) {
11171                 return false;
11172             }
11173             n.setName( "BCL2_HUMAN" );
11174             acc = SequenceDbWsTools.obtainSeqAccession( n );
11175             if ( ( acc == null ) || !acc.getSource().equals( Source.UNIPROT.toString() )
11176                     || !acc.getValue().equals( "BCL2_HUMAN" ) ) {
11177                 System.out.println( acc.toString() );
11178                 return false;
11179             }
11180             n.setName( "P10415" );
11181             acc = SequenceDbWsTools.obtainSeqAccession( n );
11182             if ( ( acc == null ) || !acc.getSource().equals( Source.UNIPROT.toString() )
11183                     || !acc.getValue().equals( "P10415" ) ) {
11184                 System.out.println( acc.toString() );
11185                 return false;
11186             }
11187             n.setName( " P10415 " );
11188             acc = SequenceDbWsTools.obtainSeqAccession( n );
11189             if ( ( acc == null ) || !acc.getSource().equals( Source.UNIPROT.toString() )
11190                     || !acc.getValue().equals( "P10415" ) ) {
11191                 System.out.println( acc.toString() );
11192                 return false;
11193             }
11194             n.setName( "_P10415|" );
11195             acc = SequenceDbWsTools.obtainSeqAccession( n );
11196             if ( ( acc == null ) || !acc.getSource().equals( Source.UNIPROT.toString() )
11197                     || !acc.getValue().equals( "P10415" ) ) {
11198                 System.out.println( acc.toString() );
11199                 return false;
11200             }
11201             n.setName( "AY695820" );
11202             acc = SequenceDbWsTools.obtainSeqAccession( n );
11203             if ( ( acc == null ) || !acc.getSource().equals( Source.NCBI.toString() )
11204                     || !acc.getValue().equals( "AY695820" ) ) {
11205                 System.out.println( acc.toString() );
11206                 return false;
11207             }
11208             n.setName( "_AY695820_" );
11209             acc = SequenceDbWsTools.obtainSeqAccession( n );
11210             if ( ( acc == null ) || !acc.getSource().equals( Source.NCBI.toString() )
11211                     || !acc.getValue().equals( "AY695820" ) ) {
11212                 System.out.println( acc.toString() );
11213                 return false;
11214             }
11215             n.setName( "AAA59452" );
11216             acc = SequenceDbWsTools.obtainSeqAccession( n );
11217             if ( ( acc == null ) || !acc.getSource().equals( Source.NCBI.toString() )
11218                     || !acc.getValue().equals( "AAA59452" ) ) {
11219                 System.out.println( acc.toString() );
11220                 return false;
11221             }
11222             n.setName( "_AAA59452_" );
11223             acc = SequenceDbWsTools.obtainSeqAccession( n );
11224             if ( ( acc == null ) || !acc.getSource().equals( Source.NCBI.toString() )
11225                     || !acc.getValue().equals( "AAA59452" ) ) {
11226                 System.out.println( acc.toString() );
11227                 return false;
11228             }
11229             n.setName( "AAA59452.1" );
11230             acc = SequenceDbWsTools.obtainSeqAccession( n );
11231             if ( ( acc == null ) || !acc.getSource().equals( Source.NCBI.toString() )
11232                     || !acc.getValue().equals( "AAA59452.1" ) ) {
11233                 System.out.println( acc.toString() );
11234                 return false;
11235             }
11236             n.setName( "_AAA59452.1_" );
11237             acc = SequenceDbWsTools.obtainSeqAccession( n );
11238             if ( ( acc == null ) || !acc.getSource().equals( Source.NCBI.toString() )
11239                     || !acc.getValue().equals( "AAA59452.1" ) ) {
11240                 System.out.println( acc.toString() );
11241                 return false;
11242             }
11243             n.setName( "GI:94894583" );
11244             acc = SequenceDbWsTools.obtainSeqAccession( n );
11245             if ( ( acc == null ) || !acc.getSource().equals( Source.GI.toString() )
11246                     || !acc.getValue().equals( "94894583" ) ) {
11247                 System.out.println( acc.toString() );
11248                 return false;
11249             }
11250             n.setName( "gi|71845847|1,4-alpha-glucan branching enzyme [Dechloromonas aromatica RCB]" );
11251             acc = SequenceDbWsTools.obtainSeqAccession( n );
11252             if ( ( acc == null ) || !acc.getSource().equals( Source.GI.toString() )
11253                     || !acc.getValue().equals( "71845847" ) ) {
11254                 System.out.println( acc.toString() );
11255                 return false;
11256             }
11257             n.setName( "gi|71845847|gb|AAZ45343.1| 1,4-alpha-glucan branching enzyme [Dechloromonas aromatica RCB]" );
11258             acc = SequenceDbWsTools.obtainSeqAccession( n );
11259             if ( ( acc == null ) || !acc.getSource().equals( Source.NCBI.toString() )
11260                     || !acc.getValue().equals( "AAZ45343.1" ) ) {
11261                 System.out.println( acc.toString() );
11262                 return false;
11263             }
11264         }
11265         catch ( final Exception e ) {
11266             return false;
11267         }
11268         return true;
11269     }
11270
11271     private static boolean testSequenceDbWsTools2() {
11272         try {
11273             final PhylogenyNode n1 = new PhylogenyNode( "NP_001025424" );
11274             SequenceDbWsTools.obtainSeqInformation( n1 );
11275             if ( !n1.getNodeData().getSequence().getName().equals( "Bcl2" ) ) {
11276                 return false;
11277             }
11278             if ( !n1.getNodeData().getTaxonomy().getScientificName().equals( "Danio rerio" ) ) {
11279                 return false;
11280             }
11281             if ( !n1.getNodeData().getSequence().getAccession().getSource().equals( Source.REFSEQ.toString() ) ) {
11282                 return false;
11283             }
11284             if ( !n1.getNodeData().getSequence().getAccession().getValue().equals( "NP_001025424" ) ) {
11285                 return false;
11286             }
11287             final PhylogenyNode n2 = new PhylogenyNode( "NM_001030253" );
11288             SequenceDbWsTools.obtainSeqInformation( n2 );
11289             if ( !n2.getNodeData().getSequence().getName().equals( "Danio rerio B-cell CLL/lymphoma 2a (bcl2a), mRNA" ) ) {
11290                 return false;
11291             }
11292             if ( !n2.getNodeData().getTaxonomy().getScientificName().equals( "Danio rerio" ) ) {
11293                 return false;
11294             }
11295             if ( !n2.getNodeData().getSequence().getAccession().getSource().equals( Source.REFSEQ.toString() ) ) {
11296                 return false;
11297             }
11298             if ( !n2.getNodeData().getSequence().getAccession().getValue().equals( "NM_001030253" ) ) {
11299                 return false;
11300             }
11301             final PhylogenyNode n3 = new PhylogenyNode( "NM_184234.2" );
11302             SequenceDbWsTools.obtainSeqInformation( n3 );
11303             if ( !n3.getNodeData().getSequence().getName()
11304                     .equals( "Homo sapiens RNA binding motif protein 39 (RBM39), transcript variant 1, mRNA" ) ) {
11305                 return false;
11306             }
11307             if ( !n3.getNodeData().getTaxonomy().getScientificName().equals( "Homo sapiens" ) ) {
11308                 return false;
11309             }
11310             if ( !n3.getNodeData().getSequence().getAccession().getSource().equals( Source.REFSEQ.toString() ) ) {
11311                 return false;
11312             }
11313             if ( !n3.getNodeData().getSequence().getAccession().getValue().equals( "NM_184234" ) ) {
11314                 return false;
11315             }
11316         }
11317         catch ( final IOException e ) {
11318             System.out.println();
11319             System.out.println( "the following might be due to absence internet connection:" );
11320             e.printStackTrace( System.out );
11321             return true;
11322         }
11323         catch ( final Exception e ) {
11324             e.printStackTrace();
11325             return false;
11326         }
11327         return true;
11328     }
11329
11330     private static boolean testSequenceIdParsing() {
11331         try {
11332             Accession id = SequenceAccessionTools.parseAccessorFromString( "gb_ADF31344_segmented_worms_" );
11333             if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() )
11334                     || !id.getValue().equals( "ADF31344" ) || !id.getSource().equals( "ncbi" ) ) {
11335                 if ( id != null ) {
11336                     System.out.println( "value   =" + id.getValue() );
11337                     System.out.println( "provider=" + id.getSource() );
11338                 }
11339                 return false;
11340             }
11341             id = SequenceAccessionTools.parseAccessorFromString( "segmented worms|gb_ADF31344" );
11342             if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() )
11343                     || !id.getValue().equals( "ADF31344" ) || !id.getSource().equals( "ncbi" ) ) {
11344                 if ( id != null ) {
11345                     System.out.println( "value   =" + id.getValue() );
11346                     System.out.println( "provider=" + id.getSource() );
11347                 }
11348                 return false;
11349             }
11350             id = SequenceAccessionTools.parseAccessorFromString( "segmented worms gb_ADF31344 and more" );
11351             if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() )
11352                     || !id.getValue().equals( "ADF31344" ) || !id.getSource().equals( "ncbi" ) ) {
11353                 if ( id != null ) {
11354                     System.out.println( "value   =" + id.getValue() );
11355                     System.out.println( "provider=" + id.getSource() );
11356                 }
11357                 return false;
11358             }
11359             id = SequenceAccessionTools.parseAccessorFromString( "gb_AAA96518_1" );
11360             if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() )
11361                     || !id.getValue().equals( "AAA96518" ) || !id.getSource().equals( "ncbi" ) ) {
11362                 if ( id != null ) {
11363                     System.out.println( "value   =" + id.getValue() );
11364                     System.out.println( "provider=" + id.getSource() );
11365                 }
11366                 return false;
11367             }
11368             id = SequenceAccessionTools.parseAccessorFromString( "gb_EHB07727_1_rodents_" );
11369             if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() )
11370                     || !id.getValue().equals( "EHB07727" ) || !id.getSource().equals( "ncbi" ) ) {
11371                 if ( id != null ) {
11372                     System.out.println( "value   =" + id.getValue() );
11373                     System.out.println( "provider=" + id.getSource() );
11374                 }
11375                 return false;
11376             }
11377             id = SequenceAccessionTools.parseAccessorFromString( "dbj_BAF37827_1_turtles_" );
11378             if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() )
11379                     || !id.getValue().equals( "BAF37827" ) || !id.getSource().equals( "ncbi" ) ) {
11380                 if ( id != null ) {
11381                     System.out.println( "value   =" + id.getValue() );
11382                     System.out.println( "provider=" + id.getSource() );
11383                 }
11384                 return false;
11385             }
11386             id = SequenceAccessionTools.parseAccessorFromString( "emb_CAA73223_1_primates_" );
11387             if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() )
11388                     || !id.getValue().equals( "CAA73223" ) || !id.getSource().equals( "ncbi" ) ) {
11389                 if ( id != null ) {
11390                     System.out.println( "value   =" + id.getValue() );
11391                     System.out.println( "provider=" + id.getSource() );
11392                 }
11393                 return false;
11394             }
11395             id = SequenceAccessionTools.parseAccessorFromString( "mites|ref_XP_002434188_1" );
11396             if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() )
11397                     || !id.getValue().equals( "XP_002434188" ) || !id.getSource().equals( "refseq" ) ) {
11398                 if ( id != null ) {
11399                     System.out.println( "value   =" + id.getValue() );
11400                     System.out.println( "provider=" + id.getSource() );
11401                 }
11402                 return false;
11403             }
11404             id = SequenceAccessionTools.parseAccessorFromString( "mites_ref_XP_002434188_1_bla_XP_12345" );
11405             if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() )
11406                     || !id.getValue().equals( "XP_002434188" ) || !id.getSource().equals( "refseq" ) ) {
11407                 if ( id != null ) {
11408                     System.out.println( "value   =" + id.getValue() );
11409                     System.out.println( "provider=" + id.getSource() );
11410                 }
11411                 return false;
11412             }
11413             id = SequenceAccessionTools.parseAccessorFromString( "P4A123" );
11414             if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() )
11415                     || !id.getValue().equals( "P4A123" ) || !id.getSource().equals( "uniprot" ) ) {
11416                 if ( id != null ) {
11417                     System.out.println( "value   =" + id.getValue() );
11418                     System.out.println( "provider=" + id.getSource() );
11419                 }
11420                 return false;
11421             }
11422             id = SequenceAccessionTools.parseAccessorFromString( "XP_12345" );
11423             if ( id != null ) {
11424                 System.out.println( "value   =" + id.getValue() );
11425                 System.out.println( "provider=" + id.getSource() );
11426                 return false;
11427             }
11428             id = SequenceAccessionTools.parseAccessorFromString( "N3B004Z009" );
11429             if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() )
11430                     || !id.getValue().equals( "N3B004Z009" ) || !id.getSource().equals( "uniprot" ) ) {
11431                 if ( id != null ) {
11432                     System.out.println( "value   =" + id.getValue() );
11433                     System.out.println( "provider=" + id.getSource() );
11434                 }
11435                 return false;
11436             }
11437             id = SequenceAccessionTools.parseAccessorFromString( "A4CAA4ZBB9" );
11438             if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() )
11439                     || !id.getValue().equals( "A4CAA4ZBB9" ) || !id.getSource().equals( "uniprot" ) ) {
11440                 if ( id != null ) {
11441                     System.out.println( "value   =" + id.getValue() );
11442                     System.out.println( "provider=" + id.getSource() );
11443                 }
11444                 return false;
11445             }
11446             id = SequenceAccessionTools.parseAccessorFromString( "ecoli_A4CAA4ZBB9_rt" );
11447             if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() )
11448                     || !id.getValue().equals( "A4CAA4ZBB9" ) || !id.getSource().equals( "uniprot" ) ) {
11449                 if ( id != null ) {
11450                     System.out.println( "value   =" + id.getValue() );
11451                     System.out.println( "provider=" + id.getSource() );
11452                 }
11453                 return false;
11454             }
11455             id = SequenceAccessionTools.parseAccessorFromString( "Q4CAA4ZBB9" );
11456             if ( id != null ) {
11457                 System.out.println( "value   =" + id.getValue() );
11458                 System.out.println( "provider=" + id.getSource() );
11459                 return false;
11460             }
11461         }
11462         catch ( final Exception e ) {
11463             e.printStackTrace( System.out );
11464             return false;
11465         }
11466         return true;
11467     }
11468
11469     private static boolean testSequenceWriter() {
11470         try {
11471             final String n = ForesterUtil.LINE_SEPARATOR;
11472             if ( !SequenceWriter.toFasta( "name", "awes", 5 ).toString().equals( ">name" + n + "awes" ) ) {
11473                 return false;
11474             }
11475             if ( !SequenceWriter.toFasta( "name", "awes", 4 ).toString().equals( ">name" + n + "awes" ) ) {
11476                 return false;
11477             }
11478             if ( !SequenceWriter.toFasta( "name", "awes", 3 ).toString().equals( ">name" + n + "awe" + n + "s" ) ) {
11479                 return false;
11480             }
11481             if ( !SequenceWriter.toFasta( "name", "awes", 2 ).toString().equals( ">name" + n + "aw" + n + "es" ) ) {
11482                 return false;
11483             }
11484             if ( !SequenceWriter.toFasta( "name", "awes", 1 ).toString()
11485                     .equals( ">name" + n + "a" + n + "w" + n + "e" + n + "s" ) ) {
11486                 return false;
11487             }
11488             if ( !SequenceWriter.toFasta( "name", "abcdefghij", 3 ).toString()
11489                     .equals( ">name" + n + "abc" + n + "def" + n + "ghi" + n + "j" ) ) {
11490                 return false;
11491             }
11492         }
11493         catch ( final Exception e ) {
11494             e.printStackTrace();
11495             return false;
11496         }
11497         return true;
11498     }
11499
11500     private static boolean testSpecies() {
11501         try {
11502             final Species s1 = new BasicSpecies( "a" );
11503             final Species s2 = new BasicSpecies( "a" );
11504             final Species s3 = new BasicSpecies( "A" );
11505             final Species s4 = new BasicSpecies( "b" );
11506             if ( !s1.equals( s1 ) ) {
11507                 return false;
11508             }
11509             if ( s1.getSpeciesId().equals( "x" ) ) {
11510                 return false;
11511             }
11512             if ( s1.getSpeciesId().equals( null ) ) {
11513                 return false;
11514             }
11515             if ( !s1.equals( s2 ) ) {
11516                 return false;
11517             }
11518             if ( s1.equals( s3 ) ) {
11519                 return false;
11520             }
11521             if ( s1.hashCode() != s1.hashCode() ) {
11522                 return false;
11523             }
11524             if ( s1.hashCode() != s2.hashCode() ) {
11525                 return false;
11526             }
11527             if ( s1.hashCode() == s3.hashCode() ) {
11528                 return false;
11529             }
11530             if ( s1.compareTo( s1 ) != 0 ) {
11531                 return false;
11532             }
11533             if ( s1.compareTo( s2 ) != 0 ) {
11534                 return false;
11535             }
11536             if ( s1.compareTo( s3 ) != 0 ) {
11537                 return false;
11538             }
11539             if ( s1.compareTo( s4 ) >= 0 ) {
11540                 return false;
11541             }
11542             if ( s4.compareTo( s1 ) <= 0 ) {
11543                 return false;
11544             }
11545             if ( !s4.getSpeciesId().equals( "b" ) ) {
11546                 return false;
11547             }
11548             final Species s5 = new BasicSpecies( " C " );
11549             if ( !s5.getSpeciesId().equals( "C" ) ) {
11550                 return false;
11551             }
11552             if ( s5.equals( s1 ) ) {
11553                 return false;
11554             }
11555         }
11556         catch ( final Exception e ) {
11557             e.printStackTrace( System.out );
11558             return false;
11559         }
11560         return true;
11561     }
11562
11563     private static boolean testSplit() {
11564         try {
11565             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
11566             final Phylogeny p0 = factory.create( "(((A,B,C),D),(E,(F,G)))R", new NHXParser() )[ 0 ];
11567             //Archaeopteryx.createApplication( p0 );
11568             final Set<PhylogenyNode> ex = new HashSet<PhylogenyNode>();
11569             ex.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11570             ex.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
11571             ex.add( PhylogenyNode.createInstanceFromNhxString( "C" ) );
11572             ex.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
11573             ex.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
11574             ex.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
11575             ex.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
11576             ex.add( PhylogenyNode.createInstanceFromNhxString( "X" ) );
11577             ex.add( PhylogenyNode.createInstanceFromNhxString( "Y" ) );
11578             final TreeSplitMatrix s0 = new TreeSplitMatrix( p0, false, ex );
11579             // System.out.println( s0.toString() );
11580             //
11581             Set<PhylogenyNode> query_nodes = new HashSet<PhylogenyNode>();
11582             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11583             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
11584             if ( s0.match( query_nodes ) ) {
11585                 return false;
11586             }
11587             query_nodes = new HashSet<PhylogenyNode>();
11588             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11589             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
11590             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "C" ) );
11591             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
11592             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
11593             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
11594             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
11595             if ( !s0.match( query_nodes ) ) {
11596                 return false;
11597             }
11598             //
11599             query_nodes = new HashSet<PhylogenyNode>();
11600             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11601             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
11602             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "C" ) );
11603             if ( !s0.match( query_nodes ) ) {
11604                 return false;
11605             }
11606             //
11607             query_nodes = new HashSet<PhylogenyNode>();
11608             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
11609             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
11610             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
11611             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
11612             if ( !s0.match( query_nodes ) ) {
11613                 return false;
11614             }
11615             //
11616             query_nodes = new HashSet<PhylogenyNode>();
11617             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11618             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
11619             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "C" ) );
11620             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
11621             if ( !s0.match( query_nodes ) ) {
11622                 return false;
11623             }
11624             //
11625             query_nodes = new HashSet<PhylogenyNode>();
11626             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
11627             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
11628             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
11629             if ( !s0.match( query_nodes ) ) {
11630                 return false;
11631             }
11632             query_nodes = new HashSet<PhylogenyNode>();
11633             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
11634             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
11635             if ( !s0.match( query_nodes ) ) {
11636                 return false;
11637             }
11638             query_nodes = new HashSet<PhylogenyNode>();
11639             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
11640             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
11641             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "C" ) );
11642             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
11643             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11644             if ( !s0.match( query_nodes ) ) {
11645                 return false;
11646             }
11647             query_nodes = new HashSet<PhylogenyNode>();
11648             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
11649             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
11650             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
11651             if ( !s0.match( query_nodes ) ) {
11652                 return false;
11653             }
11654             query_nodes = new HashSet<PhylogenyNode>();
11655             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
11656             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
11657             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
11658             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
11659             if ( !s0.match( query_nodes ) ) {
11660                 return false;
11661             }
11662             query_nodes = new HashSet<PhylogenyNode>();
11663             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
11664             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11665             if ( s0.match( query_nodes ) ) {
11666                 return false;
11667             }
11668             query_nodes = new HashSet<PhylogenyNode>();
11669             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11670             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
11671             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
11672             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "C" ) );
11673             if ( s0.match( query_nodes ) ) {
11674                 return false;
11675             }
11676             query_nodes = new HashSet<PhylogenyNode>();
11677             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
11678             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
11679             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
11680             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
11681             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "C" ) );
11682             if ( s0.match( query_nodes ) ) {
11683                 return false;
11684             }
11685             query_nodes = new HashSet<PhylogenyNode>();
11686             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11687             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
11688             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
11689             if ( s0.match( query_nodes ) ) {
11690                 return false;
11691             }
11692             query_nodes = new HashSet<PhylogenyNode>();
11693             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11694             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
11695             if ( s0.match( query_nodes ) ) {
11696                 return false;
11697             }
11698             query_nodes = new HashSet<PhylogenyNode>();
11699             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11700             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
11701             if ( s0.match( query_nodes ) ) {
11702                 return false;
11703             }
11704             query_nodes = new HashSet<PhylogenyNode>();
11705             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11706             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "C" ) );
11707             if ( s0.match( query_nodes ) ) {
11708                 return false;
11709             }
11710             query_nodes = new HashSet<PhylogenyNode>();
11711             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11712             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
11713             if ( s0.match( query_nodes ) ) {
11714                 return false;
11715             }
11716             query_nodes = new HashSet<PhylogenyNode>();
11717             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11718             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
11719             if ( s0.match( query_nodes ) ) {
11720                 return false;
11721             }
11722             query_nodes = new HashSet<PhylogenyNode>();
11723             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11724             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
11725             if ( s0.match( query_nodes ) ) {
11726                 return false;
11727             }
11728             query_nodes = new HashSet<PhylogenyNode>();
11729             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11730             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
11731             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
11732             if ( s0.match( query_nodes ) ) {
11733                 return false;
11734             }
11735             query_nodes = new HashSet<PhylogenyNode>();
11736             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11737             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
11738             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
11739             if ( s0.match( query_nodes ) ) {
11740                 return false;
11741             }
11742             query_nodes = new HashSet<PhylogenyNode>();
11743             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
11744             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
11745             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11746             if ( s0.match( query_nodes ) ) {
11747                 return false;
11748             }
11749             query_nodes = new HashSet<PhylogenyNode>();
11750             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
11751             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
11752             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11753             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
11754             if ( s0.match( query_nodes ) ) {
11755                 return false;
11756             }
11757             /////////
11758             //            query_nodes = new HashSet<PhylogenyNode>();
11759             //            query_nodes.add( new PhylogenyNode( "X" ) );
11760             //            query_nodes.add( new PhylogenyNode( "Y" ) );
11761             //            query_nodes.add( new PhylogenyNode( "A" ) );
11762             //            query_nodes.add( new PhylogenyNode( "B" ) );
11763             //            query_nodes.add( new PhylogenyNode( "C" ) );
11764             //            query_nodes.add( new PhylogenyNode( "D" ) );
11765             //            query_nodes.add( new PhylogenyNode( "E" ) );
11766             //            query_nodes.add( new PhylogenyNode( "F" ) );
11767             //            query_nodes.add( new PhylogenyNode( "G" ) );
11768             //            if ( !s0.match( query_nodes ) ) {
11769             //                return false;
11770             //            }
11771             //            query_nodes = new HashSet<PhylogenyNode>();
11772             //            query_nodes.add( new PhylogenyNode( "X" ) );
11773             //            query_nodes.add( new PhylogenyNode( "Y" ) );
11774             //            query_nodes.add( new PhylogenyNode( "A" ) );
11775             //            query_nodes.add( new PhylogenyNode( "B" ) );
11776             //            query_nodes.add( new PhylogenyNode( "C" ) );
11777             //            if ( !s0.match( query_nodes ) ) {
11778             //                return false;
11779             //            }
11780             //            //
11781             //            query_nodes = new HashSet<PhylogenyNode>();
11782             //            query_nodes.add( new PhylogenyNode( "X" ) );
11783             //            query_nodes.add( new PhylogenyNode( "Y" ) );
11784             //            query_nodes.add( new PhylogenyNode( "D" ) );
11785             //            query_nodes.add( new PhylogenyNode( "E" ) );
11786             //            query_nodes.add( new PhylogenyNode( "F" ) );
11787             //            query_nodes.add( new PhylogenyNode( "G" ) );
11788             //            if ( !s0.match( query_nodes ) ) {
11789             //                return false;
11790             //            }
11791             //            //
11792             //            query_nodes = new HashSet<PhylogenyNode>();
11793             //            query_nodes.add( new PhylogenyNode( "X" ) );
11794             //            query_nodes.add( new PhylogenyNode( "Y" ) );
11795             //            query_nodes.add( new PhylogenyNode( "A" ) );
11796             //            query_nodes.add( new PhylogenyNode( "B" ) );
11797             //            query_nodes.add( new PhylogenyNode( "C" ) );
11798             //            query_nodes.add( new PhylogenyNode( "D" ) );
11799             //            if ( !s0.match( query_nodes ) ) {
11800             //                return false;
11801             //            }
11802             //            //
11803             //            query_nodes = new HashSet<PhylogenyNode>();
11804             //            query_nodes.add( new PhylogenyNode( "X" ) );
11805             //            query_nodes.add( new PhylogenyNode( "Y" ) );
11806             //            query_nodes.add( new PhylogenyNode( "E" ) );
11807             //            query_nodes.add( new PhylogenyNode( "F" ) );
11808             //            query_nodes.add( new PhylogenyNode( "G" ) );
11809             //            if ( !s0.match( query_nodes ) ) {
11810             //                return false;
11811             //            }
11812             //            //
11813             //            query_nodes = new HashSet<PhylogenyNode>();
11814             //            query_nodes.add( new PhylogenyNode( "X" ) );
11815             //            query_nodes.add( new PhylogenyNode( "Y" ) );
11816             //            query_nodes.add( new PhylogenyNode( "F" ) );
11817             //            query_nodes.add( new PhylogenyNode( "G" ) );
11818             //            if ( !s0.match( query_nodes ) ) {
11819             //                return false;
11820             //            }
11821             //
11822             query_nodes = new HashSet<PhylogenyNode>();
11823             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "X" ) );
11824             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "Y" ) );
11825             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
11826             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
11827             if ( s0.match( query_nodes ) ) {
11828                 return false;
11829             }
11830             //
11831             query_nodes = new HashSet<PhylogenyNode>();
11832             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "X" ) );
11833             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "Y" ) );
11834             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11835             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
11836             if ( s0.match( query_nodes ) ) {
11837                 return false;
11838             }
11839             ///////////////////////////
11840             //
11841             query_nodes = new HashSet<PhylogenyNode>();
11842             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "X" ) );
11843             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "Y" ) );
11844             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11845             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
11846             if ( s0.match( query_nodes ) ) {
11847                 return false;
11848             }
11849             //
11850             query_nodes = new HashSet<PhylogenyNode>();
11851             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "X" ) );
11852             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "Y" ) );
11853             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11854             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
11855             if ( s0.match( query_nodes ) ) {
11856                 return false;
11857             }
11858             //
11859             query_nodes = new HashSet<PhylogenyNode>();
11860             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "X" ) );
11861             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "Y" ) );
11862             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11863             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "C" ) );
11864             if ( s0.match( query_nodes ) ) {
11865                 return false;
11866             }
11867             //
11868             query_nodes = new HashSet<PhylogenyNode>();
11869             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "X" ) );
11870             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "Y" ) );
11871             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11872             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
11873             if ( s0.match( query_nodes ) ) {
11874                 return false;
11875             }
11876             //
11877             query_nodes = new HashSet<PhylogenyNode>();
11878             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "X" ) );
11879             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "Y" ) );
11880             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11881             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
11882             if ( s0.match( query_nodes ) ) {
11883                 return false;
11884             }
11885             //
11886             query_nodes = new HashSet<PhylogenyNode>();
11887             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "Y" ) );
11888             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11889             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
11890             if ( s0.match( query_nodes ) ) {
11891                 return false;
11892             }
11893             //
11894             query_nodes = new HashSet<PhylogenyNode>();
11895             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "X" ) );
11896             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "Y" ) );
11897             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11898             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
11899             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
11900             if ( s0.match( query_nodes ) ) {
11901                 return false;
11902             }
11903             //
11904             query_nodes = new HashSet<PhylogenyNode>();
11905             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "X" ) );
11906             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "Y" ) );
11907             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11908             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
11909             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
11910             if ( s0.match( query_nodes ) ) {
11911                 return false;
11912             }
11913             //
11914             query_nodes = new HashSet<PhylogenyNode>();
11915             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "X" ) );
11916             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "Y" ) );
11917             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
11918             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
11919             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11920             if ( s0.match( query_nodes ) ) {
11921                 return false;
11922             }
11923             //
11924             query_nodes = new HashSet<PhylogenyNode>();
11925             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "X" ) );
11926             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "Y" ) );
11927             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
11928             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
11929             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11930             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
11931             if ( s0.match( query_nodes ) ) {
11932                 return false;
11933             }
11934         }
11935         catch ( final Exception e ) {
11936             e.printStackTrace();
11937             return false;
11938         }
11939         return true;
11940     }
11941
11942     private static boolean testSplitStrict() {
11943         try {
11944             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
11945             final Phylogeny p0 = factory.create( "(((A,B,C),D),(E,(F,G)))R", new NHXParser() )[ 0 ];
11946             final Set<PhylogenyNode> ex = new HashSet<PhylogenyNode>();
11947             ex.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11948             ex.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
11949             ex.add( PhylogenyNode.createInstanceFromNhxString( "C" ) );
11950             ex.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
11951             ex.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
11952             ex.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
11953             ex.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
11954             final TreeSplitMatrix s0 = new TreeSplitMatrix( p0, true, ex );
11955             Set<PhylogenyNode> query_nodes = new HashSet<PhylogenyNode>();
11956             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11957             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
11958             if ( s0.match( query_nodes ) ) {
11959                 return false;
11960             }
11961             query_nodes = new HashSet<PhylogenyNode>();
11962             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11963             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
11964             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "C" ) );
11965             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
11966             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
11967             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
11968             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
11969             if ( !s0.match( query_nodes ) ) {
11970                 return false;
11971             }
11972             //
11973             query_nodes = new HashSet<PhylogenyNode>();
11974             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11975             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
11976             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "C" ) );
11977             if ( !s0.match( query_nodes ) ) {
11978                 return false;
11979             }
11980             //
11981             query_nodes = new HashSet<PhylogenyNode>();
11982             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
11983             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
11984             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
11985             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
11986             if ( !s0.match( query_nodes ) ) {
11987                 return false;
11988             }
11989             //
11990             query_nodes = new HashSet<PhylogenyNode>();
11991             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11992             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
11993             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "C" ) );
11994             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
11995             if ( !s0.match( query_nodes ) ) {
11996                 return false;
11997             }
11998             //
11999             query_nodes = new HashSet<PhylogenyNode>();
12000             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
12001             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
12002             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
12003             if ( !s0.match( query_nodes ) ) {
12004                 return false;
12005             }
12006             //
12007             query_nodes = new HashSet<PhylogenyNode>();
12008             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
12009             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
12010             if ( !s0.match( query_nodes ) ) {
12011                 return false;
12012             }
12013             //
12014             query_nodes = new HashSet<PhylogenyNode>();
12015             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
12016             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
12017             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "C" ) );
12018             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
12019             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12020             if ( !s0.match( query_nodes ) ) {
12021                 return false;
12022             }
12023             //
12024             query_nodes = new HashSet<PhylogenyNode>();
12025             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
12026             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
12027             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
12028             if ( !s0.match( query_nodes ) ) {
12029                 return false;
12030             }
12031             //
12032             query_nodes = new HashSet<PhylogenyNode>();
12033             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
12034             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
12035             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
12036             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
12037             if ( !s0.match( query_nodes ) ) {
12038                 return false;
12039             }
12040             //
12041             query_nodes = new HashSet<PhylogenyNode>();
12042             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
12043             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12044             if ( s0.match( query_nodes ) ) {
12045                 return false;
12046             }
12047             //
12048             query_nodes = new HashSet<PhylogenyNode>();
12049             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12050             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
12051             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
12052             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "C" ) );
12053             if ( s0.match( query_nodes ) ) {
12054                 return false;
12055             }
12056             //
12057             query_nodes = new HashSet<PhylogenyNode>();
12058             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
12059             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
12060             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
12061             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
12062             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "C" ) );
12063             if ( s0.match( query_nodes ) ) {
12064                 return false;
12065             }
12066             //
12067             query_nodes = new HashSet<PhylogenyNode>();
12068             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12069             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
12070             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
12071             if ( s0.match( query_nodes ) ) {
12072                 return false;
12073             }
12074             //
12075             query_nodes = new HashSet<PhylogenyNode>();
12076             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12077             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
12078             if ( s0.match( query_nodes ) ) {
12079                 return false;
12080             }
12081             //
12082             query_nodes = new HashSet<PhylogenyNode>();
12083             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12084             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
12085             if ( s0.match( query_nodes ) ) {
12086                 return false;
12087             }
12088             //
12089             query_nodes = new HashSet<PhylogenyNode>();
12090             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12091             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "C" ) );
12092             if ( s0.match( query_nodes ) ) {
12093                 return false;
12094             }
12095             //
12096             query_nodes = new HashSet<PhylogenyNode>();
12097             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12098             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
12099             if ( s0.match( query_nodes ) ) {
12100                 return false;
12101             }
12102             //
12103             query_nodes = new HashSet<PhylogenyNode>();
12104             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12105             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
12106             if ( s0.match( query_nodes ) ) {
12107                 return false;
12108             }
12109             //
12110             query_nodes = new HashSet<PhylogenyNode>();
12111             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12112             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
12113             if ( s0.match( query_nodes ) ) {
12114                 return false;
12115             }
12116             //
12117             query_nodes = new HashSet<PhylogenyNode>();
12118             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12119             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
12120             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
12121             if ( s0.match( query_nodes ) ) {
12122                 return false;
12123             }
12124             //
12125             query_nodes = new HashSet<PhylogenyNode>();
12126             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12127             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
12128             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
12129             if ( s0.match( query_nodes ) ) {
12130                 return false;
12131             }
12132             //
12133             query_nodes = new HashSet<PhylogenyNode>();
12134             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
12135             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
12136             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12137             if ( s0.match( query_nodes ) ) {
12138                 return false;
12139             }
12140             //
12141             query_nodes = new HashSet<PhylogenyNode>();
12142             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
12143             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
12144             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12145             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
12146             if ( s0.match( query_nodes ) ) {
12147                 return false;
12148             }
12149         }
12150         catch ( final Exception e ) {
12151             e.printStackTrace();
12152             return false;
12153         }
12154         return true;
12155     }
12156
12157     private static boolean testSubtreeDeletion() {
12158         try {
12159             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
12160             final Phylogeny t1 = factory.create( "((A,B,C)abc,(D,E,F)def)r", new NHXParser() )[ 0 ];
12161             t1.deleteSubtree( t1.getNode( "A" ), false );
12162             if ( t1.getNumberOfExternalNodes() != 5 ) {
12163                 return false;
12164             }
12165             t1.toNewHampshireX();
12166             t1.deleteSubtree( t1.getNode( "E" ), false );
12167             if ( t1.getNumberOfExternalNodes() != 4 ) {
12168                 return false;
12169             }
12170             t1.toNewHampshireX();
12171             t1.deleteSubtree( t1.getNode( "F" ), false );
12172             if ( t1.getNumberOfExternalNodes() != 3 ) {
12173                 return false;
12174             }
12175             t1.toNewHampshireX();
12176             t1.deleteSubtree( t1.getNode( "D" ), false );
12177             t1.toNewHampshireX();
12178             if ( t1.getNumberOfExternalNodes() != 3 ) {
12179                 return false;
12180             }
12181             t1.deleteSubtree( t1.getNode( "def" ), false );
12182             t1.toNewHampshireX();
12183             if ( t1.getNumberOfExternalNodes() != 2 ) {
12184                 return false;
12185             }
12186             t1.deleteSubtree( t1.getNode( "B" ), false );
12187             t1.toNewHampshireX();
12188             if ( t1.getNumberOfExternalNodes() != 1 ) {
12189                 return false;
12190             }
12191             t1.deleteSubtree( t1.getNode( "C" ), false );
12192             t1.toNewHampshireX();
12193             if ( t1.getNumberOfExternalNodes() != 1 ) {
12194                 return false;
12195             }
12196             t1.deleteSubtree( t1.getNode( "abc" ), false );
12197             t1.toNewHampshireX();
12198             if ( t1.getNumberOfExternalNodes() != 1 ) {
12199                 return false;
12200             }
12201             t1.deleteSubtree( t1.getNode( "r" ), false );
12202             if ( t1.getNumberOfExternalNodes() != 0 ) {
12203                 return false;
12204             }
12205             if ( !t1.isEmpty() ) {
12206                 return false;
12207             }
12208             final Phylogeny t2 = factory.create( "(((1,2,3)A,B,C)abc,(D,E,F)def)r", new NHXParser() )[ 0 ];
12209             t2.deleteSubtree( t2.getNode( "A" ), false );
12210             t2.toNewHampshireX();
12211             if ( t2.getNumberOfExternalNodes() != 5 ) {
12212                 return false;
12213             }
12214             t2.deleteSubtree( t2.getNode( "abc" ), false );
12215             t2.toNewHampshireX();
12216             if ( t2.getNumberOfExternalNodes() != 3 ) {
12217                 return false;
12218             }
12219             t2.deleteSubtree( t2.getNode( "def" ), false );
12220             t2.toNewHampshireX();
12221             if ( t2.getNumberOfExternalNodes() != 1 ) {
12222                 return false;
12223             }
12224         }
12225         catch ( final Exception e ) {
12226             e.printStackTrace( System.out );
12227             return false;
12228         }
12229         return true;
12230     }
12231
12232     private static boolean testSupportCount() {
12233         try {
12234             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
12235             final Phylogeny t0_1 = factory.create( "(((A,B),C),(D,E))", new NHXParser() )[ 0 ];
12236             final Phylogeny[] phylogenies_1 = factory.create( "(((A,B),C),(D,E)) " + "(((C,B),A),(D,E))"
12237                     + "(((A,B),C),(D,E)) " + "(((A,B),C),(D,E))"
12238                     + "(((A,B),C),(D,E))" + "(((C,B),A),(D,E))"
12239                     + "(((E,B),D),(C,A))" + "(((C,B),A),(D,E))"
12240                     + "(((A,B),C),(D,E))" + "(((A,B),C),(D,E))",
12241                     new NHXParser() );
12242             SupportCount.count( t0_1, phylogenies_1, true, false );
12243             final Phylogeny t0_2 = factory.create( "(((((A,B),C),D),E),(F,G))", new NHXParser() )[ 0 ];
12244             final Phylogeny[] phylogenies_2 = factory.create( "(((((A,B),C),D),E),(F,G))"
12245                     + "(((((A,B),C),D),E),((F,G),X))"
12246                     + "(((((A,Y),B),C),D),((F,G),E))"
12247                     + "(((((A,B),C),D),E),(F,G))"
12248                     + "(((((A,B),C),D),E),(F,G))"
12249                     + "(((((A,B),C),D),E),(F,G))"
12250                     + "(((((A,B),C),D),E),(F,G),Z)"
12251                     + "(((((A,B),C),D),E),(F,G))"
12252                     + "((((((A,B),C),D),E),F),G)"
12253                     + "(((((X,Y),F,G),E),((A,B),C)),D)",
12254                     new NHXParser() );
12255             SupportCount.count( t0_2, phylogenies_2, true, false );
12256             final PhylogenyNodeIterator it = t0_2.iteratorPostorder();
12257             while ( it.hasNext() ) {
12258                 final PhylogenyNode n = it.next();
12259                 if ( !n.isExternal() && ( PhylogenyMethods.getConfidenceValue( n ) != 10 ) ) {
12260                     return false;
12261                 }
12262             }
12263             final Phylogeny t0_3 = factory.create( "(((A,B)ab,C)abc,((D,E)de,F)def)", new NHXParser() )[ 0 ];
12264             final Phylogeny[] phylogenies_3 = factory.create( "(((A,B),C),((D,E),F))" + "(((A,C),B),((D,F),E))"
12265                     + "(((C,A),B),((F,D),E))" + "(((A,B),F),((D,E),C))" + "(((((A,B),C),D),E),F)", new NHXParser() );
12266             SupportCount.count( t0_3, phylogenies_3, true, false );
12267             t0_3.reRoot( t0_3.getNode( "def" ).getId() );
12268             if ( PhylogenyMethods.getConfidenceValue( t0_3.getNode( "ab" ) ) != 3 ) {
12269                 return false;
12270             }
12271             if ( PhylogenyMethods.getConfidenceValue( t0_3.getNode( "abc" ) ) != 4 ) {
12272                 return false;
12273             }
12274             if ( PhylogenyMethods.getConfidenceValue( t0_3.getNode( "def" ) ) != 4 ) {
12275                 return false;
12276             }
12277             if ( PhylogenyMethods.getConfidenceValue( t0_3.getNode( "de" ) ) != 2 ) {
12278                 return false;
12279             }
12280             if ( PhylogenyMethods.getConfidenceValue( t0_3.getNode( "A" ) ) != 5 ) {
12281                 return false;
12282             }
12283             if ( PhylogenyMethods.getConfidenceValue( t0_3.getNode( "B" ) ) != 5 ) {
12284                 return false;
12285             }
12286             if ( PhylogenyMethods.getConfidenceValue( t0_3.getNode( "C" ) ) != 5 ) {
12287                 return false;
12288             }
12289             if ( PhylogenyMethods.getConfidenceValue( t0_3.getNode( "D" ) ) != 5 ) {
12290                 return false;
12291             }
12292             if ( PhylogenyMethods.getConfidenceValue( t0_3.getNode( "E" ) ) != 5 ) {
12293                 return false;
12294             }
12295             if ( PhylogenyMethods.getConfidenceValue( t0_3.getNode( "F" ) ) != 5 ) {
12296                 return false;
12297             }
12298             final Phylogeny t0_4 = factory.create( "(((((A,B)1,C)2,D)3,E)4,F)", new NHXParser() )[ 0 ];
12299             final Phylogeny[] phylogenies_4 = factory.create( "((((((A,X),C),B),D),E),F) "
12300                     + "(((A,B,Z),C,Q),(((D,Y),E),F))", new NHXParser() );
12301             SupportCount.count( t0_4, phylogenies_4, true, false );
12302             t0_4.reRoot( t0_4.getNode( "F" ).getId() );
12303             if ( PhylogenyMethods.getConfidenceValue( t0_4.getNode( "1" ) ) != 1 ) {
12304                 return false;
12305             }
12306             if ( PhylogenyMethods.getConfidenceValue( t0_4.getNode( "2" ) ) != 2 ) {
12307                 return false;
12308             }
12309             if ( PhylogenyMethods.getConfidenceValue( t0_4.getNode( "3" ) ) != 1 ) {
12310                 return false;
12311             }
12312             if ( PhylogenyMethods.getConfidenceValue( t0_4.getNode( "4" ) ) != 2 ) {
12313                 return false;
12314             }
12315             if ( PhylogenyMethods.getConfidenceValue( t0_4.getNode( "A" ) ) != 2 ) {
12316                 return false;
12317             }
12318             if ( PhylogenyMethods.getConfidenceValue( t0_4.getNode( "B" ) ) != 2 ) {
12319                 return false;
12320             }
12321             if ( PhylogenyMethods.getConfidenceValue( t0_4.getNode( "C" ) ) != 2 ) {
12322                 return false;
12323             }
12324             if ( PhylogenyMethods.getConfidenceValue( t0_4.getNode( "D" ) ) != 2 ) {
12325                 return false;
12326             }
12327             if ( PhylogenyMethods.getConfidenceValue( t0_4.getNode( "E" ) ) != 2 ) {
12328                 return false;
12329             }
12330             if ( PhylogenyMethods.getConfidenceValue( t0_4.getNode( "F" ) ) != 2 ) {
12331                 return false;
12332             }
12333             Phylogeny a = factory.create( "(((((A,B)1,C)2,D)3,E)4,F)", new NHXParser() )[ 0 ];
12334             final Phylogeny b1 = factory.create( "(((((B,A)1,C)2,D)3,E)4,F)", new NHXParser() )[ 0 ];
12335             double d = SupportCount.compare( b1, a, true, true, true );
12336             if ( !Test.isEqual( d, 5.0 / 5.0 ) ) {
12337                 return false;
12338             }
12339             a = factory.create( "(((((A,B)1,C)2,D)3,E)4,F)", new NHXParser() )[ 0 ];
12340             final Phylogeny b2 = factory.create( "(((((C,B)1,A)2,D)3,E)4,F)", new NHXParser() )[ 0 ];
12341             d = SupportCount.compare( b2, a, true, true, true );
12342             if ( !Test.isEqual( d, 4.0 / 5.0 ) ) {
12343                 return false;
12344             }
12345             a = factory.create( "(((((A,B)1,C)2,D)3,E)4,F)", new NHXParser() )[ 0 ];
12346             final Phylogeny b3 = factory.create( "(((((F,C)1,A)2,B)3,D)4,E)", new NHXParser() )[ 0 ];
12347             d = SupportCount.compare( b3, a, true, true, true );
12348             if ( !Test.isEqual( d, 2.0 / 5.0 ) ) {
12349                 return false;
12350             }
12351             a = factory.create( "(((((A,B)1,C)2,D)3,E)4,F)r", new NHXParser() )[ 0 ];
12352             final Phylogeny b4 = factory.create( "(((((F,C)1,A)2,B)3,D)4,E)r", new NHXParser() )[ 0 ];
12353             d = SupportCount.compare( b4, a, true, true, false );
12354             if ( !Test.isEqual( d, 1.0 / 5.0 ) ) {
12355                 return false;
12356             }
12357         }
12358         catch ( final Exception e ) {
12359             e.printStackTrace( System.out );
12360             return false;
12361         }
12362         return true;
12363     }
12364
12365     private static boolean testSupportTransfer() {
12366         try {
12367             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
12368             final Phylogeny p1 = factory.create( "(((A,B)ab:97,C)abc:57,((D,E)de:10,(F,G)fg:50,(H,I)hi:64)defghi)",
12369                                                  new NHXParser() )[ 0 ];
12370             final Phylogeny p2 = factory
12371                     .create( "(((A:0.1,B:0.3)ab:0.4,C)abc:0.5,((D,E)de,(F,G)fg,(H,I)hi:0.59)defghi)", new NHXParser() )[ 0 ];
12372             if ( PhylogenyMethods.getConfidenceValue( p2.getNode( "ab" ) ) >= 0.0 ) {
12373                 return false;
12374             }
12375             if ( PhylogenyMethods.getConfidenceValue( p2.getNode( "abc" ) ) >= 0.0 ) {
12376                 return false;
12377             }
12378             support_transfer.moveBranchLengthsToBootstrap( p1 );
12379             support_transfer.transferSupportValues( p1, p2 );
12380             if ( p2.getNode( "ab" ).getDistanceToParent() != 0.4 ) {
12381                 return false;
12382             }
12383             if ( p2.getNode( "abc" ).getDistanceToParent() != 0.5 ) {
12384                 return false;
12385             }
12386             if ( p2.getNode( "hi" ).getDistanceToParent() != 0.59 ) {
12387                 return false;
12388             }
12389             if ( PhylogenyMethods.getConfidenceValue( p2.getNode( "ab" ) ) != 97 ) {
12390                 return false;
12391             }
12392             if ( PhylogenyMethods.getConfidenceValue( p2.getNode( "abc" ) ) != 57 ) {
12393                 return false;
12394             }
12395             if ( PhylogenyMethods.getConfidenceValue( p2.getNode( "de" ) ) != 10 ) {
12396                 return false;
12397             }
12398             if ( PhylogenyMethods.getConfidenceValue( p2.getNode( "fg" ) ) != 50 ) {
12399                 return false;
12400             }
12401             if ( PhylogenyMethods.getConfidenceValue( p2.getNode( "hi" ) ) != 64 ) {
12402                 return false;
12403             }
12404         }
12405         catch ( final Exception e ) {
12406             e.printStackTrace( System.out );
12407             return false;
12408         }
12409         return true;
12410     }
12411
12412     private static boolean testTaxonomyExtraction() {
12413         try {
12414             final PhylogenyNode n0 = PhylogenyNode
12415                     .createInstanceFromNhxString( "sd_12345678", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
12416             if ( n0.getNodeData().isHasTaxonomy() ) {
12417                 return false;
12418             }
12419             final PhylogenyNode n1 = PhylogenyNode
12420                     .createInstanceFromNhxString( "sd_12345x", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
12421             if ( n1.getNodeData().isHasTaxonomy() ) {
12422                 System.out.println( n1.toString() );
12423                 return false;
12424             }
12425             final PhylogenyNode n2x = PhylogenyNode
12426                     .createInstanceFromNhxString( "12345", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
12427             if ( n2x.getNodeData().isHasTaxonomy() ) {
12428                 return false;
12429             }
12430             final PhylogenyNode n3 = PhylogenyNode
12431                     .createInstanceFromNhxString( "BLAG_12345", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
12432             if ( !n3.getNodeData().getTaxonomy().getIdentifier().getValue().equals( "12345" ) ) {
12433                 System.out.println( n3.toString() );
12434                 return false;
12435             }
12436             final PhylogenyNode n4 = PhylogenyNode
12437                     .createInstanceFromNhxString( "blag-12345", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
12438             if ( n4.getNodeData().isHasTaxonomy() ) {
12439                 System.out.println( n4.toString() );
12440                 return false;
12441             }
12442             final PhylogenyNode n5 = PhylogenyNode
12443                     .createInstanceFromNhxString( "12345-blag", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
12444             if ( n5.getNodeData().isHasTaxonomy() ) {
12445                 System.out.println( n5.toString() );
12446                 return false;
12447             }
12448             final PhylogenyNode n6 = PhylogenyNode
12449                     .createInstanceFromNhxString( "BLAG-12345-blag", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
12450             if ( n6.getNodeData().isHasTaxonomy() ) {
12451                 System.out.println( n6.toString() );
12452                 return false;
12453             }
12454             final PhylogenyNode n7 = PhylogenyNode
12455                     .createInstanceFromNhxString( "BLAG-12345_blag", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
12456             if ( n7.getNodeData().isHasTaxonomy() ) {
12457                 System.out.println( n7.toString() );
12458                 return false;
12459             }
12460             final PhylogenyNode n8 = PhylogenyNode
12461                     .createInstanceFromNhxString( "BLAG_12345-blag", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
12462             if ( !n8.getNodeData().getTaxonomy().getIdentifier().getValue().equals( "12345" ) ) {
12463                 System.out.println( n8.toString() );
12464                 return false;
12465             }
12466             final PhylogenyNode n9 = PhylogenyNode
12467                     .createInstanceFromNhxString( "BLAG_12345/blag", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
12468             if ( !n9.getNodeData().getTaxonomy().getIdentifier().getValue().equals( "12345" ) ) {
12469                 System.out.println( n9.toString() );
12470                 return false;
12471             }
12472             final PhylogenyNode n10x = PhylogenyNode
12473                     .createInstanceFromNhxString( "BLAG_12X45-blag", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
12474             if ( n10x.getNodeData().isHasTaxonomy() ) {
12475                 System.out.println( n10x.toString() );
12476                 return false;
12477             }
12478             final PhylogenyNode n10xx = PhylogenyNode
12479                     .createInstanceFromNhxString( "BLAG_1YX45-blag", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
12480             if ( n10xx.getNodeData().isHasTaxonomy() ) {
12481                 System.out.println( n10xx.toString() );
12482                 return false;
12483             }
12484             final PhylogenyNode n10 = PhylogenyNode
12485                     .createInstanceFromNhxString( "BLAG_9YX45-blag", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
12486             if ( !n10.getNodeData().getTaxonomy().getTaxonomyCode().equals( "9YX45" ) ) {
12487                 System.out.println( n10.toString() );
12488                 return false;
12489             }
12490             final PhylogenyNode n11 = PhylogenyNode
12491                     .createInstanceFromNhxString( "BLAG_Mus_musculus", NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
12492             if ( !n11.getNodeData().getTaxonomy().getScientificName().equals( "Mus musculus" ) ) {
12493                 System.out.println( n11.toString() );
12494                 return false;
12495             }
12496             final PhylogenyNode n12 = PhylogenyNode
12497                     .createInstanceFromNhxString( "BLAG_Mus_musculus_musculus",
12498                                                   NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
12499             if ( !n12.getNodeData().getTaxonomy().getScientificName().equals( "Mus musculus musculus" ) ) {
12500                 System.out.println( n12.toString() );
12501                 return false;
12502             }
12503             final PhylogenyNode n13 = PhylogenyNode
12504                     .createInstanceFromNhxString( "BLAG_Mus_musculus1", NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
12505             if ( n13.getNodeData().isHasTaxonomy() ) {
12506                 System.out.println( n13.toString() );
12507                 return false;
12508             }
12509             final PhylogenyNode n14 = PhylogenyNode
12510                     .createInstanceFromNhxString( "Mus_musculus_392", NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
12511             if ( !n14.getNodeData().getTaxonomy().getScientificName().equals( "Mus musculus" ) ) {
12512                 System.out.println( n14.toString() );
12513                 return false;
12514             }
12515             final PhylogenyNode n15 = PhylogenyNode
12516                     .createInstanceFromNhxString( "Mus_musculus_K392", NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
12517             if ( !n15.getNodeData().getTaxonomy().getScientificName().equals( "Mus musculus" ) ) {
12518                 System.out.println( n15.toString() );
12519                 return false;
12520             }
12521             final PhylogenyNode n16 = PhylogenyNode
12522                     .createInstanceFromNhxString( "Mus musculus 392", NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
12523             if ( !n16.getNodeData().getTaxonomy().getScientificName().equals( "Mus musculus" ) ) {
12524                 System.out.println( n16.toString() );
12525                 return false;
12526             }
12527             final PhylogenyNode n17 = PhylogenyNode
12528                     .createInstanceFromNhxString( "Mus musculus K392", NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
12529             if ( !n17.getNodeData().getTaxonomy().getScientificName().equals( "Mus musculus" ) ) {
12530                 System.out.println( n17.toString() );
12531                 return false;
12532             }
12533             final PhylogenyNode n18 = PhylogenyNode
12534                     .createInstanceFromNhxString( "Mus_musculus_musculus_392", NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
12535             if ( !n18.getNodeData().getTaxonomy().getScientificName().equals( "Mus musculus musculus" ) ) {
12536                 System.out.println( n18.toString() );
12537                 return false;
12538             }
12539             final PhylogenyNode n19 = PhylogenyNode
12540                     .createInstanceFromNhxString( "Mus_musculus_musculus_K392",
12541                                                   NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
12542             if ( !n19.getNodeData().getTaxonomy().getScientificName().equals( "Mus musculus musculus" ) ) {
12543                 System.out.println( n19.toString() );
12544                 return false;
12545             }
12546             final PhylogenyNode n20 = PhylogenyNode
12547                     .createInstanceFromNhxString( "Mus musculus musculus 392", NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
12548             if ( !n20.getNodeData().getTaxonomy().getScientificName().equals( "Mus musculus musculus" ) ) {
12549                 System.out.println( n20.toString() );
12550                 return false;
12551             }
12552             final PhylogenyNode n21 = PhylogenyNode
12553                     .createInstanceFromNhxString( "Mus musculus musculus K392",
12554                                                   NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
12555             if ( !n21.getNodeData().getTaxonomy().getScientificName().equals( "Mus musculus musculus" ) ) {
12556                 System.out.println( n21.toString() );
12557                 return false;
12558             }
12559             final PhylogenyNode n23 = PhylogenyNode
12560                     .createInstanceFromNhxString( "9EMVE_Nematostella_vectensis",
12561                                                   NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
12562             if ( !n23.getNodeData().getTaxonomy().getScientificName().equals( "Nematostella vectensis" ) ) {
12563                 System.out.println( n23.toString() );
12564                 return false;
12565             }
12566             final PhylogenyNode n24 = PhylogenyNode
12567                     .createInstanceFromNhxString( "9EMVE_Nematostella", NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
12568             if ( !n24.getNodeData().getTaxonomy().getTaxonomyCode().equals( "9EMVE" ) ) {
12569                 System.out.println( n24.toString() );
12570                 return false;
12571             }
12572             //
12573             final PhylogenyNode n25 = PhylogenyNode
12574                     .createInstanceFromNhxString( "Nematostella_vectensis_NEMVE",
12575                                                   NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
12576             if ( !n25.getNodeData().getTaxonomy().getTaxonomyCode().equals( "NEMVE" ) ) {
12577                 System.out.println( n25.toString() );
12578                 return false;
12579             }
12580             final PhylogenyNode n26 = PhylogenyNode
12581                     .createInstanceFromNhxString( "Nematostella_vectensis_9EMVE",
12582                                                   NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
12583             if ( !n26.getNodeData().getTaxonomy().getScientificName().equals( "Nematostella vectensis" ) ) {
12584                 System.out.println( n26.toString() );
12585                 return false;
12586             }
12587             final PhylogenyNode n27 = PhylogenyNode
12588                     .createInstanceFromNhxString( "Nematostella_9EMVE", NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
12589             if ( !n27.getNodeData().getTaxonomy().getTaxonomyCode().equals( "9EMVE" ) ) {
12590                 System.out.println( n27.toString() );
12591                 return false;
12592             }
12593         }
12594         catch ( final Exception e ) {
12595             e.printStackTrace( System.out );
12596             return false;
12597         }
12598         return true;
12599     }
12600
12601     private static boolean testTreeCopy() {
12602         try {
12603             final String str_0 = "((((a,b),c),d)[&&NHX:S=lizards],e[&&NHX:S=reptiles])r[&&NHX:S=animals]";
12604             final Phylogeny t0 = Phylogeny.createInstanceFromNhxString( str_0 );
12605             final Phylogeny t1 = t0.copy();
12606             if ( !t1.toNewHampshireX().equals( t0.toNewHampshireX() ) ) {
12607                 return false;
12608             }
12609             if ( !t1.toNewHampshireX().equals( str_0 ) ) {
12610                 return false;
12611             }
12612             t0.deleteSubtree( t0.getNode( "c" ), true );
12613             t0.deleteSubtree( t0.getNode( "a" ), true );
12614             t0.getRoot().getNodeData().getTaxonomy().setScientificName( "metazoa" );
12615             t0.getNode( "b" ).setName( "Bee" );
12616             if ( !t0.toNewHampshireX().equals( "((Bee,d)[&&NHX:S=lizards],e[&&NHX:S=reptiles])r[&&NHX:S=metazoa]" ) ) {
12617                 return false;
12618             }
12619             if ( !t1.toNewHampshireX().equals( str_0 ) ) {
12620                 return false;
12621             }
12622             t0.deleteSubtree( t0.getNode( "e" ), true );
12623             t0.deleteSubtree( t0.getNode( "Bee" ), true );
12624             t0.deleteSubtree( t0.getNode( "d" ), true );
12625             if ( !t1.toNewHampshireX().equals( str_0 ) ) {
12626                 return false;
12627             }
12628         }
12629         catch ( final Exception e ) {
12630             e.printStackTrace();
12631             return false;
12632         }
12633         return true;
12634     }
12635
12636     private static boolean testTreeMethods() {
12637         try {
12638             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
12639             final Phylogeny t0 = factory.create( "((((A,B)ab,C)abc,D)abcd,E)", new NHXParser() )[ 0 ];
12640             PhylogenyMethods.collapseSubtreeStructure( t0.getNode( "abcd" ) );
12641             if ( !t0.toNewHampshireX().equals( "((A,B,C,D)abcd,E)" ) ) {
12642                 System.out.println( t0.toNewHampshireX() );
12643                 return false;
12644             }
12645             final Phylogeny t1 = factory.create( "((((A:0.1,B)ab:0.2,C)abc:0.3,D)abcd:0.4,E)", new NHXParser() )[ 0 ];
12646             PhylogenyMethods.collapseSubtreeStructure( t1.getNode( "abcd" ) );
12647             if ( !isEqual( t1.getNode( "A" ).getDistanceToParent(), 0.6 ) ) {
12648                 return false;
12649             }
12650             if ( !isEqual( t1.getNode( "B" ).getDistanceToParent(), 0.5 ) ) {
12651                 return false;
12652             }
12653             if ( !isEqual( t1.getNode( "C" ).getDistanceToParent(), 0.3 ) ) {
12654                 return false;
12655             }
12656         }
12657         catch ( final Exception e ) {
12658             e.printStackTrace( System.out );
12659             return false;
12660         }
12661         return true;
12662     }
12663
12664     private static boolean testUniprotEntryRetrieval() {
12665         try {
12666             final SequenceDatabaseEntry entry = SequenceDbWsTools.obtainUniProtEntry( "P12345", 200 );
12667             if ( !entry.getAccession().equals( "P12345" ) ) {
12668                 return false;
12669             }
12670             if ( !entry.getTaxonomyScientificName().equals( "Oryctolagus cuniculus" ) ) {
12671                 return false;
12672             }
12673             if ( !entry.getSequenceName().equals( "Aspartate aminotransferase, mitochondrial" ) ) {
12674                 return false;
12675             }
12676             if ( !entry.getSequenceSymbol().equals( "mAspAT" ) ) {
12677                 return false;
12678             }
12679             if ( !entry.getGeneName().equals( "GOT2" ) ) {
12680                 return false;
12681             }
12682             if ( !entry.getTaxonomyIdentifier().equals( "9986" ) ) {
12683                 return false;
12684             }
12685             if ( !entry
12686                     .getMolecularSequence()
12687                     .getMolecularSequenceAsString()
12688                     .startsWith( "MALLHSARVLSGVASAFHPGLAAAASARASSWWAHVEMGPPDPILGVTEAYKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKGLDKEYLPIGGLAEFCRASAELALGENSEV" )
12689                     || !entry.getMolecularSequence().getMolecularSequenceAsString().endsWith( "LAHAIHQVTK" ) ) {
12690                 System.out.println( entry.getMolecularSequence().getMolecularSequenceAsString() );
12691                 return false;
12692             }
12693         }
12694         catch ( final IOException e ) {
12695             System.out.println();
12696             System.out.println( "the following might be due to absence internet connection:" );
12697             e.printStackTrace( System.out );
12698             return true;
12699         }
12700         catch ( final Exception e ) {
12701             return false;
12702         }
12703         return true;
12704     }
12705
12706     private static boolean testUniprotTaxonomySearch() {
12707         try {
12708             List<UniProtTaxonomy> results = SequenceDbWsTools.getTaxonomiesFromCommonNameStrict( "starlet sea anemone",
12709                                                                                                  10 );
12710             if ( results.size() != 1 ) {
12711                 return false;
12712             }
12713             if ( !results.get( 0 ).getCode().equals( "NEMVE" ) ) {
12714                 return false;
12715             }
12716             if ( !results.get( 0 ).getCommonName().equalsIgnoreCase( "starlet sea anemone" ) ) {
12717                 return false;
12718             }
12719             if ( !results.get( 0 ).getId().equalsIgnoreCase( "45351" ) ) {
12720                 return false;
12721             }
12722             if ( !results.get( 0 ).getRank().equalsIgnoreCase( "species" ) ) {
12723                 return false;
12724             }
12725             if ( !results.get( 0 ).getScientificName().equals( "Nematostella vectensis" ) ) {
12726                 return false;
12727             }
12728             results = null;
12729             results = SequenceDbWsTools.getTaxonomiesFromScientificNameStrict( "Nematostella vectensis", 10 );
12730             if ( results.size() != 1 ) {
12731                 return false;
12732             }
12733             if ( !results.get( 0 ).getCode().equals( "NEMVE" ) ) {
12734                 return false;
12735             }
12736             if ( !results.get( 0 ).getCommonName().equalsIgnoreCase( "starlet sea anemone" ) ) {
12737                 return false;
12738             }
12739             if ( !results.get( 0 ).getId().equalsIgnoreCase( "45351" ) ) {
12740                 return false;
12741             }
12742             if ( !results.get( 0 ).getRank().equalsIgnoreCase( "species" ) ) {
12743                 return false;
12744             }
12745             if ( !results.get( 0 ).getScientificName().equals( "Nematostella vectensis" ) ) {
12746                 return false;
12747             }
12748             results = null;
12749             results = SequenceDbWsTools.getTaxonomiesFromId( "45351", 10 );
12750             if ( results.size() != 1 ) {
12751                 return false;
12752             }
12753             if ( !results.get( 0 ).getCode().equals( "NEMVE" ) ) {
12754                 return false;
12755             }
12756             if ( !results.get( 0 ).getCommonName().equalsIgnoreCase( "starlet sea anemone" ) ) {
12757                 return false;
12758             }
12759             if ( !results.get( 0 ).getId().equalsIgnoreCase( "45351" ) ) {
12760                 return false;
12761             }
12762             if ( !results.get( 0 ).getRank().equalsIgnoreCase( "species" ) ) {
12763                 return false;
12764             }
12765             if ( !results.get( 0 ).getScientificName().equals( "Nematostella vectensis" ) ) {
12766                 return false;
12767             }
12768             results = null;
12769             results = SequenceDbWsTools.getTaxonomiesFromTaxonomyCode( "NEMVE", 10 );
12770             if ( results.size() != 1 ) {
12771                 return false;
12772             }
12773             if ( !results.get( 0 ).getCode().equals( "NEMVE" ) ) {
12774                 return false;
12775             }
12776             if ( !results.get( 0 ).getCommonName().equalsIgnoreCase( "starlet sea anemone" ) ) {
12777                 return false;
12778             }
12779             if ( !results.get( 0 ).getId().equalsIgnoreCase( "45351" ) ) {
12780                 return false;
12781             }
12782             if ( !results.get( 0 ).getRank().equalsIgnoreCase( "species" ) ) {
12783                 return false;
12784             }
12785             if ( !results.get( 0 ).getScientificName().equals( "Nematostella vectensis" ) ) {
12786                 return false;
12787             }
12788             if ( !results.get( 0 ).getLineage().get( 1 ).equals( "Eukaryota" ) ) {
12789                 return false;
12790             }
12791             if ( !results.get( 0 ).getLineage().get( 2 ).equals( "Metazoa" ) ) {
12792                 return false;
12793             }
12794             if ( !results.get( 0 ).getLineage().get( results.get( 0 ).getLineage().size() - 1 )
12795                     .equals( "Nematostella vectensis" ) ) {
12796                 System.out.println( results.get( 0 ).getLineage() );
12797                 return false;
12798             }
12799             //
12800             results = null;
12801             results = SequenceDbWsTools.getTaxonomiesFromScientificNameStrict( "Xenopus tropicalis", 10 );
12802             if ( results.size() != 1 ) {
12803                 return false;
12804             }
12805             if ( !results.get( 0 ).getCode().equals( "XENTR" ) ) {
12806                 return false;
12807             }
12808             if ( !results.get( 0 ).getCommonName().equalsIgnoreCase( "Western clawed frog" ) ) {
12809                 return false;
12810             }
12811             if ( !results.get( 0 ).getId().equalsIgnoreCase( "8364" ) ) {
12812                 return false;
12813             }
12814             if ( !results.get( 0 ).getRank().equalsIgnoreCase( "species" ) ) {
12815                 return false;
12816             }
12817             if ( !results.get( 0 ).getScientificName().equals( "Xenopus tropicalis" ) ) {
12818                 return false;
12819             }
12820             if ( !results.get( 0 ).getLineage().get( results.get( 0 ).getLineage().size() - 1 )
12821                     .equals( "Xenopus tropicalis" ) ) {
12822                 System.out.println( results.get( 0 ).getLineage() );
12823                 return false;
12824             }
12825             //
12826             results = null;
12827             results = SequenceDbWsTools.getTaxonomiesFromId( "8364", 10 );
12828             if ( results.size() != 1 ) {
12829                 return false;
12830             }
12831             if ( !results.get( 0 ).getCode().equals( "XENTR" ) ) {
12832                 return false;
12833             }
12834             if ( !results.get( 0 ).getCommonName().equalsIgnoreCase( "Western clawed frog" ) ) {
12835                 return false;
12836             }
12837             if ( !results.get( 0 ).getId().equalsIgnoreCase( "8364" ) ) {
12838                 return false;
12839             }
12840             if ( !results.get( 0 ).getRank().equalsIgnoreCase( "species" ) ) {
12841                 return false;
12842             }
12843             if ( !results.get( 0 ).getScientificName().equals( "Xenopus tropicalis" ) ) {
12844                 return false;
12845             }
12846             if ( !results.get( 0 ).getLineage().get( results.get( 0 ).getLineage().size() - 1 )
12847                     .equals( "Xenopus tropicalis" ) ) {
12848                 System.out.println( results.get( 0 ).getLineage() );
12849                 return false;
12850             }
12851             //
12852             results = null;
12853             results = SequenceDbWsTools.getTaxonomiesFromTaxonomyCode( "XENTR", 10 );
12854             if ( results.size() != 1 ) {
12855                 return false;
12856             }
12857             if ( !results.get( 0 ).getCode().equals( "XENTR" ) ) {
12858                 return false;
12859             }
12860             if ( !results.get( 0 ).getCommonName().equalsIgnoreCase( "Western clawed frog" ) ) {
12861                 return false;
12862             }
12863             if ( !results.get( 0 ).getId().equalsIgnoreCase( "8364" ) ) {
12864                 return false;
12865             }
12866             if ( !results.get( 0 ).getRank().equalsIgnoreCase( "species" ) ) {
12867                 return false;
12868             }
12869             if ( !results.get( 0 ).getScientificName().equals( "Xenopus tropicalis" ) ) {
12870                 return false;
12871             }
12872             if ( !results.get( 0 ).getLineage().get( results.get( 0 ).getLineage().size() - 1 )
12873                     .equals( "Xenopus tropicalis" ) ) {
12874                 System.out.println( results.get( 0 ).getLineage() );
12875                 return false;
12876             }
12877         }
12878         catch ( final IOException e ) {
12879             System.out.println();
12880             System.out.println( "the following might be due to absence internet connection:" );
12881             e.printStackTrace( System.out );
12882             return true;
12883         }
12884         catch ( final Exception e ) {
12885             return false;
12886         }
12887         return true;
12888     }
12889
12890     private static boolean testWabiTxSearch() {
12891         try {
12892             String result = "";
12893             result = TxSearch.searchSimple( "nematostella" );
12894             result = TxSearch.getTxId( "nematostella" );
12895             if ( !result.equals( "45350" ) ) {
12896                 return false;
12897             }
12898             result = TxSearch.getTxName( "45350" );
12899             if ( !result.equals( "Nematostella" ) ) {
12900                 return false;
12901             }
12902             result = TxSearch.getTxId( "nematostella vectensis" );
12903             if ( !result.equals( "45351" ) ) {
12904                 return false;
12905             }
12906             result = TxSearch.getTxName( "45351" );
12907             if ( !result.equals( "Nematostella vectensis" ) ) {
12908                 return false;
12909             }
12910             result = TxSearch.getTxId( "Bacillus subtilis subsp. subtilis str. N170" );
12911             if ( !result.equals( "536089" ) ) {
12912                 return false;
12913             }
12914             result = TxSearch.getTxName( "536089" );
12915             if ( !result.equals( "Bacillus subtilis subsp. subtilis str. N170" ) ) {
12916                 return false;
12917             }
12918             final List<String> queries = new ArrayList<String>();
12919             queries.add( "Campylobacter coli" );
12920             queries.add( "Escherichia coli" );
12921             queries.add( "Arabidopsis" );
12922             queries.add( "Trichoplax" );
12923             queries.add( "Samanea saman" );
12924             queries.add( "Kluyveromyces marxianus" );
12925             queries.add( "Bacillus subtilis subsp. subtilis str. N170" );
12926             queries.add( "Bornavirus parrot/PDD/2008" );
12927             final List<RANKS> ranks = new ArrayList<RANKS>();
12928             ranks.add( RANKS.SUPERKINGDOM );
12929             ranks.add( RANKS.KINGDOM );
12930             ranks.add( RANKS.FAMILY );
12931             ranks.add( RANKS.GENUS );
12932             ranks.add( RANKS.TRIBE );
12933             result = TxSearch.searchLineage( queries, ranks );
12934             result = TxSearch.searchParam( "Homo sapiens", TAX_NAME_CLASS.ALL, TAX_RANK.SPECIES, 10, true );
12935             result = TxSearch.searchParam( "Samanea saman", TAX_NAME_CLASS.SCIENTIFIC_NAME, TAX_RANK.ALL, 10, true );
12936         }
12937         catch ( final Exception e ) {
12938             System.out.println();
12939             System.out.println( "the following might be due to absence internet connection:" );
12940             e.printStackTrace( System.out );
12941             return false;
12942         }
12943         return true;
12944     }
12945 }