8e93470121369fe52781f02d75c49c1d2f31ee7f
[jalview.git] / forester / test_data / phyloxml_test_t1.xml
1 <?xml version="1.0" encoding="UTF-8"?>
2 <phyloxml xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance"
3    xsi:schemaLocation="http://www.phyloxml.org http://www.phyloxml.org/1.10/phyloxml.xsd"
4    xmlns="http://www.phyloxml.org">
5    <phylogeny branch_length_unit="cc" rooted="true" rerootable="false" type="gene_tree">
6       <name>t1</name>
7       <clade/>
8    </phylogeny>
9    <phylogeny branch_length_unit="aa/m" rooted="true" type="host parasite reconciliation" rerootable="false">
10       <name>t2</name>
11       <clade>
12          <name>root node</name>
13          <clade branch_length="1">
14             <name>node a</name>
15             <taxonomy>
16                <common_name>some parasite</common_name>
17             </taxonomy>
18             <taxonomy>
19                <common_name>the host</common_name>
20             </taxonomy>
21             <sequence type="dna">
22                <mol_seq is_aligned="false"> actgtgggggtggggaggcggaggggtgtggtacactgactactgactgactga_ctgacgatcatatgac </mol_seq>
23             </sequence>
24             <sequence type="dna">
25                <mol_seq is_aligned="false">
26                   ctgtgatgcatgcatgcatgcatgcatcgatcgccggcatgcatcgatatctacgctgactgactagctactagtcacacgtgacgcgcgcatgc***
27                </mol_seq>
28             </sequence>
29          </clade>
30          <clade>
31             <name>node b</name>
32             <branch_length>2</branch_length>
33          </clade>
34       </clade>
35    </phylogeny>
36    <phylogeny branch_length_unit="c" rooted="true">
37       <name>t3</name>
38       <id provider="treebank">1-1</id>
39       <description>test phylogeny</description>
40       <confidence type="ml">0.1</confidence>
41       <clade branch_length="0.1">
42          <name>root node</name>
43          <confidence type="bootstrap">90</confidence>
44          <confidence type="ml">1e-3</confidence>
45          <confidence type="decay">2</confidence>
46          <width>10</width>
47          <color>
48             <red>2</red>
49             <green>22</green>
50             <blue>33</blue>
51          </color>
52          <node_id>root id</node_id>
53          <taxonomy>
54             <id provider="ncbi">1</id>
55             <code>ECDYS</code>
56             <scientific_name>ecdysozoa</scientific_name>
57             <common_name>molting animals</common_name>
58             <rank>phylum</rank>
59             <uri>http://www.ecdysozoa.org/</uri>
60          </taxonomy>
61          <sequence type="protein">
62             <symbol>BCL2L14</symbol>
63             <accession source="UniProtKB">Q9BZR8</accession>
64             <name>Apoptosis facilitator Bcl-2-like 14 protein</name>
65             <location>12p13-p12</location>
66             <mol_seq is_aligned="false">MCSTSGCDLEEIPLDDDDLNTIEFKILAYY</mol_seq>
67             <uri type="source" desc="UniProt link">http://www.pir.uniprot.org/cgi-bin/upEntry?id=B2L14_HUMAN</uri>
68             <annotation>
69                <desc>intracellular organelle</desc>
70             </annotation>
71             <annotation ref="GO:0005829"/>
72             <annotation ref="GO:0006915" source="UniProtKB" evidence="experimental" type="function">
73                <desc>apoptosis</desc>
74                <confidence type="ml">1</confidence>
75                <property datatype="xsd:double" applies_to="annotation" ref="AFFY:expression" unit="AFFY:x">0.2</property>
76                <property datatype="xsd:string" applies_to="annotation" ref="MED:disease">lymphoma</property>
77             </annotation>
78             <cross_references>
79                <accession source="UNIPROTKB">383</accession>
80                <accession source="PDB">1G5M</accession>
81                <accession source="KEGG">hsa:596</accession>
82                <accession source="PDB">2G5M</accession>
83             </cross_references>
84          </sequence>
85          <events>
86             <type>mixed</type>
87             <duplications>1</duplications>
88             <confidence type="bs">99</confidence>
89          </events>
90          <distribution>
91             <desc>irgendwo</desc>
92             <point geodetic_datum="WGS84" alt_unit="m">
93                <lat>35.9296730123456789</lat>
94                <long>-78.9482370123456789</long>
95                <alt>0</alt>
96             </point>
97          </distribution>
98          <reference doi="10.1038/387489a0">
99             <desc>
100                Aguinaldo, A. M. A.; J. M. Turbeville, L. S. Linford, M. C. Rivera, J. R. Garey, R. A. Raff, &amp; J. A. Lake (1997). "Evidence for a clade of nematodes, arthropods and other moulting animals". Nature 387 (6632): 489–493.
101             </desc>
102          </reference>
103          <property ref="F:foo" datatype="xsd:int" applies_to="clade">bar</property>
104          <clade>
105             <name>node a</name>
106             <branch_length>0.2</branch_length>
107             <color>
108                <red>12</red>
109                <green>14</green>
110                <blue>16</blue>
111             </color>
112             <node_id provider="nodeid">a id</node_id>
113             <taxonomy>
114                <id provider="ncbi">123</id>
115                <code>CAEEL</code>
116                <scientific_name>C elegans</scientific_name>
117                <common_name>elegant nematode worm</common_name>
118                <rank>species</rank>
119                <uri>http://www.wormbase.org/</uri>
120             </taxonomy>
121             <sequence>
122                <name>CAEEL_XYZ</name>
123             </sequence>
124          </clade>
125          <clade>
126             <name>node b</name>
127             <events>
128                <duplications>1</duplications>
129                <confidence type="">80</confidence>
130             </events>
131             <binary_characters type="characters" present_count="2" lost_count="3" gained_count="1">
132                <gained>
133                   <bc>c</bc>
134                </gained>
135                <lost>
136                   <bc>d</bc>
137                   <bc>e</bc>
138                   <bc>f</bc>
139                </lost>
140                <present>
141                   <bc>a</bc>
142                   <bc>b</bc>
143                </present>
144             </binary_characters>
145             <clade>
146                <name>node ba</name>
147                <distribution>
148                   <desc>Africa</desc>
149                </distribution>
150                <date unit="mya">
151                   <desc> Silurian  </desc>
152                   <value>435</value>
153                   <minimum>416</minimum>
154                   <maximum>443.7</maximum>
155                </date>
156             </clade>
157             <clade>
158                <name>node bb</name>
159                <taxonomy>
160                    <id provider="EOL">704294</id>
161                    <code>NEMVE</code>
162                    <scientific_name>Nematostella vectensis</scientific_name>
163                    <authority>Stephenson, 1935</authority>
164                    <common_name>starlet sea anemone</common_name>
165                    <synonym>Nematostella vectensis Stephenson1935</synonym>
166                    <synonym> See            
167                    Anemone   
168                    </synonym>
169                    <synonym></synonym>
170                    <rank>species</rank>
171                    <uri desc="EOL" type="linkout">http://www.eol.org/pages/704294</uri>
172                </taxonomy>
173                <binary_characters type="domains">
174                   <gained>
175                      <bc>A</bc>
176                      <bc>B</bc>
177                      <bc>C</bc>
178                   </gained>
179                   <lost>
180                      <bc>D</bc>
181                   </lost>
182                   <present>
183                      <bc>X</bc>
184                      <bc>M</bc>
185                   </present>
186                </binary_characters>
187                <date>
188                   <desc>Triassic  </desc>
189                </date>
190             </clade>
191             <clade>
192                <name>node bc</name>
193                <sequence>
194                   <name>bc seq</name>
195                   <domain_architecture length="124">
196                      <domain from="120" to="130" confidence="0.9" id=""> A </domain>
197                      <domain from="21" to="44" confidence="2144" id="pfam"> B </domain>
198                      <domain to="43" confidence="1.0E-89" from="34" id=""> C </domain>
199                      <domain id="123" from="34" to="43" confidence="-1.3e-34"> D </domain>
200                   </domain_architecture>
201                </sequence>
202                <date>
203                    <value>433</value>
204                </date>
205             </clade>
206          </clade>
207       </clade>
208    </phylogeny>
209    <phylogeny rooted="true">
210       <name>t4</name>
211       <clade>
212          <clade> </clade>
213          <clade> </clade>
214       </clade>
215    </phylogeny>
216 </phyloxml>