1 package jalview.analysis;
3 import jalview.bin.Cache;
5 import java.io.BufferedReader;
6 import java.io.IOException;
7 import java.io.InputStream;
8 import java.io.InputStreamReader;
9 import java.util.HashMap;
10 import java.util.LinkedHashMap;
12 import java.util.StringTokenizer;
15 * A singleton that provides instances of genetic code translation tables
18 * @see https://www.ncbi.nlm.nih.gov/Taxonomy/Utils/wprintgc.cgi
20 public final class GeneticCodes
22 private static final int CODON_LENGTH = 3;
24 private static final String QUOTE = "\"";
27 * nucleotides as ordered in data file
29 private static final String NUCS = "TCAG";
31 private static final int NUCS_COUNT = NUCS.length();
33 private static final int NUCS_COUNT_SQUARED = NUCS_COUNT * NUCS_COUNT;
35 private static final int NUCS_COUNT_CUBED = NUCS_COUNT * NUCS_COUNT
38 private static final String AMBIGUITY_CODES_FILE = "/AmbiguityCodes.dat";
40 private static final String RESOURCE_FILE = "/GeneticCodes.dat";
42 private static GeneticCodes instance = new GeneticCodes();
44 private Map<String, String> ambiguityCodes;
47 * loaded code tables, with keys in order of loading
49 private Map<String, GeneticCodeI> codeTables;
52 * Private constructor enforces singleton
54 private GeneticCodes()
58 ambiguityCodes = new HashMap<>();
61 * LinkedHashMap preserves order of addition of entries,
62 * so we can assume the Standard Code Table is the first
64 codeTables = new LinkedHashMap<>();
65 loadAmbiguityCodes(AMBIGUITY_CODES_FILE);
66 loadCodes(RESOURCE_FILE);
71 * Returns the singleton instance of this class
75 public static GeneticCodes getInstance()
81 * Returns the known code tables, in order of loading.
85 public Iterable<GeneticCodeI> getCodeTables()
87 return codeTables.values();
91 * Answers the code table with the given id
96 public GeneticCodeI getCodeTable(String id)
98 return codeTables.get(id);
102 * A convenience method that returns the standard code table (table 1). As
103 * implemented, this has to be the first table defined in the data file.
107 public GeneticCodeI getStandardCodeTable()
109 return codeTables.values().iterator().next();
113 * Loads the code tables from a data file
115 protected void loadCodes(String fileName)
119 InputStream is = getClass().getResourceAsStream(fileName);
122 System.err.println("Resource file not found: " + fileName);
125 BufferedReader dataIn = new BufferedReader(new InputStreamReader(is));
128 * skip comments and start of table
131 while (line != null && !line.startsWith("Genetic-code-table"))
133 line = readLine(dataIn);
135 line = readLine(dataIn);
137 while (line.startsWith("{"))
139 line = loadOneTable(dataIn);
141 } catch (IOException | NullPointerException e)
144 "Error reading genetic codes data file " + fileName + ": "
147 if (codeTables.isEmpty())
150 "No genetic code tables loaded, check format of file "
156 * Reads and saves Nucleotide ambiguity codes from a data file. The file may
157 * include comment lines (starting with #), a header 'DNA', and one line per
158 * ambiguity code, for example:
162 * means that R is an ambiguity code meaning "A or G"
166 protected void loadAmbiguityCodes(String fileName)
170 InputStream is = getClass().getResourceAsStream(fileName);
173 System.err.println("Resource file not found: " + fileName);
176 BufferedReader dataIn = new BufferedReader(new InputStreamReader(is));
180 line = readLine(dataIn);
181 if (line != null && !"DNA".equals(line.toUpperCase()))
183 String[] tokens = line.split("\\t");
184 if (tokens.length == 2)
186 ambiguityCodes.put(tokens[0].toUpperCase(),
187 tokens[1].toUpperCase());
192 "Unexpected data in " + fileName + ": " + line);
196 } catch (IOException e)
199 "Error reading nucleotide ambiguity codes data file: "
205 * Reads up to and returns the next non-comment line, trimmed. Comment lines
206 * start with a #. Returns null at end of file.
210 * @throws IOException
212 protected String readLine(BufferedReader dataIn) throws IOException
214 String line = dataIn.readLine();
215 while (line != null && line.startsWith("#"))
217 line = readLine(dataIn);
219 return line == null ? null : line.trim();
223 * Reads the lines of the data file describing one translation table, and
224 * creates and stores an instance of GeneticCodeI. Returns the '{' line
225 * starting the next table, or the '}' line at end of all tables. Data format
230 * name "Vertebrate Mitochondrial" ,
233 * ncbieaa "FFLLSSSSYY**CCWWLLLLPPPPHHQQRRRRIIMMTTTTNNKKSS**VVVVAAAADDEEGGGG",
234 * sncbieaa "----------**--------------------MMMM----------**---M------------"
235 * -- Base1 TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG
236 * -- Base2 TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG
237 * -- Base3 TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG
241 * of which we parse the first name, the id, and the ncbieaa translations for
242 * codons as ordered by the Base1/2/3 lines. Note Base1/2/3 are included for
243 * readability and are in a fixed order, these are not parsed. The sncbieaa
244 * line marks alternative start codons, these are not parsed.
248 * @throws IOException
250 protected String loadOneTable(BufferedReader dataIn) throws IOException
254 Map<String, String> codons = new HashMap<>();
256 String line = readLine(dataIn);
258 while (line != null && !line.startsWith("}"))
260 if (line.startsWith("name") && name == null)
262 name = line.substring(line.indexOf(QUOTE) + 1,
263 line.lastIndexOf(QUOTE));
265 else if (line.startsWith("id"))
267 id = new StringTokenizer(line.substring(2)).nextToken();
269 else if (line.startsWith("ncbieaa"))
271 String aminos = line.substring(line.indexOf(QUOTE) + 1,
272 line.lastIndexOf(QUOTE));
273 if (aminos.length() != NUCS_COUNT_CUBED) // 4 * 4 * 4 combinations
275 Cache.log.error("wrong data length in code table: " + line);
279 for (int i = 0; i < aminos.length(); i++)
281 String peptide = String.valueOf(aminos.charAt(i));
282 char codon1 = NUCS.charAt(i / NUCS_COUNT_SQUARED);
284 .charAt((i % NUCS_COUNT_SQUARED) / NUCS_COUNT);
285 char codon3 = NUCS.charAt(i % NUCS_COUNT);
286 String codon = new String(
288 { codon1, codon2, codon3 });
289 codons.put(codon, peptide);
293 line = readLine(dataIn);
296 registerCodeTable(id, name, codons);
297 return readLine(dataIn);
301 * Constructs and registers a GeneticCodeI instance with the codon
302 * translations as defined in the data file. For all instances except the
303 * first, any undeclared translations default to those in the standard code
310 protected void registerCodeTable(final String id, final String name,
311 final Map<String, String> codons)
313 codeTables.put(id, new GeneticCodeI()
316 * map of ambiguous codons to their 'product'
317 * (null if not all possible translations match)
319 Map<String, String> ambiguous = new HashMap<>();
322 public String translateCanonical(String codon)
324 return codons.get(codon.toUpperCase());
328 public String translate(String codon)
330 String upper = codon.toUpperCase();
331 String peptide = translateCanonical(upper);
334 * if still not translated, check for ambiguity codes
338 peptide = getAmbiguousTranslation(upper, ambiguous, this);
344 public String getId()
350 public String getName()
358 * Computes all possible translations of a codon including one or more
359 * ambiguity codes, and stores and returns the result (null if not all
360 * translations match). If the codon includes no ambiguity codes, simply
368 protected String getAmbiguousTranslation(String codon,
369 Map<String, String> ambiguous, GeneticCodeI codeTable)
371 if (codon.length() != CODON_LENGTH)
376 boolean isAmbiguous = false;
378 char[][] expanded = new char[CODON_LENGTH][];
379 for (int i = 0; i < CODON_LENGTH; i++)
381 String base = String.valueOf(codon.charAt(i));
382 if (ambiguityCodes.containsKey(base))
385 base = ambiguityCodes.get(base);
387 expanded[i] = base.toCharArray();
392 // no ambiguity code involved here
397 * generate and translate all permutations of the ambiguous codon
398 * only return the translation if they all agree, else null
400 String peptide = null;
401 for (char c1 : expanded[0])
403 for (char c2 : expanded[1])
405 for (char c3 : expanded[2])
407 char[] cdn = new char[] { c1, c2, c3 };
408 String possibleCodon = String.valueOf(cdn);
409 String pep = codeTable.translate(possibleCodon);
410 if (pep == null || (peptide != null && !pep.equals(peptide)))
412 ambiguous.put(codon, null);
421 * all translations of ambiguous codons matched!
423 ambiguous.put(codon, peptide);