2 * Jalview - A Sequence Alignment Editor and Viewer ($$Version-Rel$$)
3 * Copyright (C) $$Year-Rel$$ The Jalview Authors
5 * This file is part of Jalview.
7 * Jalview is free software: you can redistribute it and/or
8 * modify it under the terms of the GNU General Public License
9 * as published by the Free Software Foundation, either version 3
10 * of the License, or (at your option) any later version.
12 * Jalview is distributed in the hope that it will be useful, but
13 * WITHOUT ANY WARRANTY; without even the implied warranty
14 * of MERCHANTABILITY or FITNESS FOR A PARTICULAR
15 * PURPOSE. See the GNU General Public License for more details.
17 * You should have received a copy of the GNU General Public License
18 * along with Jalview. If not, see <http://www.gnu.org/licenses/>.
19 * The Jalview Authors are detailed in the 'AUTHORS' file.
21 package jalview.analysis;
23 import java.util.Locale;
24 import java.io.BufferedReader;
25 import java.io.IOException;
26 import java.io.InputStream;
27 import java.io.InputStreamReader;
28 import java.util.HashMap;
29 import java.util.LinkedHashMap;
31 import java.util.StringTokenizer;
33 import jalview.bin.Console;
36 * A singleton that provides instances of genetic code translation tables
39 * @see https://www.ncbi.nlm.nih.gov/Taxonomy/Utils/wprintgc.cgi
41 public final class GeneticCodes
43 private static final int CODON_LENGTH = 3;
45 private static final String QUOTE = "\"";
48 * nucleotides as ordered in data file
50 private static final String NUCS = "TCAG";
52 private static final int NUCS_COUNT = NUCS.length();
54 private static final int NUCS_COUNT_SQUARED = NUCS_COUNT * NUCS_COUNT;
56 private static final int NUCS_COUNT_CUBED = NUCS_COUNT * NUCS_COUNT
59 private static final String AMBIGUITY_CODES_FILE = "/AmbiguityCodes.dat";
61 private static final String RESOURCE_FILE = "/GeneticCodes.dat";
63 private static GeneticCodes instance = new GeneticCodes();
65 private Map<String, String> ambiguityCodes;
68 * loaded code tables, with keys in order of loading
70 private Map<String, GeneticCodeI> codeTables;
73 * Private constructor enforces singleton
75 private GeneticCodes()
79 ambiguityCodes = new HashMap<>();
82 * LinkedHashMap preserves order of addition of entries,
83 * so we can assume the Standard Code Table is the first
85 codeTables = new LinkedHashMap<>();
86 loadAmbiguityCodes(AMBIGUITY_CODES_FILE);
87 loadCodes(RESOURCE_FILE);
92 * Returns the singleton instance of this class
96 public static GeneticCodes getInstance()
102 * Returns the known code tables, in order of loading.
106 public Iterable<GeneticCodeI> getCodeTables()
108 return codeTables.values();
112 * Answers the code table with the given id
117 public GeneticCodeI getCodeTable(String id)
119 return codeTables.get(id);
123 * A convenience method that returns the standard code table (table 1). As
124 * implemented, this has to be the first table defined in the data file.
128 public GeneticCodeI getStandardCodeTable()
130 return codeTables.values().iterator().next();
134 * Loads the code tables from a data file
136 protected void loadCodes(String fileName)
140 InputStream is = getClass().getResourceAsStream(fileName);
143 System.err.println("Resource file not found: " + fileName);
146 BufferedReader dataIn = new BufferedReader(new InputStreamReader(is));
149 * skip comments and start of table
152 while (line != null && !line.startsWith("Genetic-code-table"))
154 line = readLine(dataIn);
156 line = readLine(dataIn);
158 while (line.startsWith("{"))
160 line = loadOneTable(dataIn);
162 } catch (IOException | NullPointerException e)
165 "Error reading genetic codes data file " + fileName + ": "
168 if (codeTables.isEmpty())
171 "No genetic code tables loaded, check format of file "
177 * Reads and saves Nucleotide ambiguity codes from a data file. The file may
178 * include comment lines (starting with #), a header 'DNA', and one line per
179 * ambiguity code, for example:
183 * means that R is an ambiguity code meaning "A or G"
187 protected void loadAmbiguityCodes(String fileName)
191 InputStream is = getClass().getResourceAsStream(fileName);
194 System.err.println("Resource file not found: " + fileName);
197 BufferedReader dataIn = new BufferedReader(new InputStreamReader(is));
201 line = readLine(dataIn);
202 if (line != null && !"DNA".equals(line.toUpperCase(Locale.ROOT)))
204 String[] tokens = line.split("\\t");
205 if (tokens.length == 2)
207 ambiguityCodes.put(tokens[0].toUpperCase(Locale.ROOT),
208 tokens[1].toUpperCase(Locale.ROOT));
213 "Unexpected data in " + fileName + ": " + line);
217 } catch (IOException e)
220 "Error reading nucleotide ambiguity codes data file: "
226 * Reads up to and returns the next non-comment line, trimmed. Comment lines
227 * start with a #. Returns null at end of file.
231 * @throws IOException
233 protected String readLine(BufferedReader dataIn) throws IOException
235 String line = dataIn.readLine();
236 while (line != null && line.startsWith("#"))
238 line = readLine(dataIn);
240 return line == null ? null : line.trim();
244 * Reads the lines of the data file describing one translation table, and
245 * creates and stores an instance of GeneticCodeI. Returns the '{' line
246 * starting the next table, or the '}' line at end of all tables. Data format
251 * name "Vertebrate Mitochondrial" ,
254 * ncbieaa "FFLLSSSSYY**CCWWLLLLPPPPHHQQRRRRIIMMTTTTNNKKSS**VVVVAAAADDEEGGGG",
255 * sncbieaa "----------**--------------------MMMM----------**---M------------"
256 * -- Base1 TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG
257 * -- Base2 TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG
258 * -- Base3 TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG
262 * of which we parse the first name, the id, and the ncbieaa translations for
263 * codons as ordered by the Base1/2/3 lines. Note Base1/2/3 are included for
264 * readability and are in a fixed order, these are not parsed. The sncbieaa
265 * line marks alternative start codons, these are not parsed.
269 * @throws IOException
271 protected String loadOneTable(BufferedReader dataIn) throws IOException
275 Map<String, String> codons = new HashMap<>();
277 String line = readLine(dataIn);
279 while (line != null && !line.startsWith("}"))
281 if (line.startsWith("name") && name == null)
283 name = line.substring(line.indexOf(QUOTE) + 1,
284 line.lastIndexOf(QUOTE));
286 else if (line.startsWith("id"))
288 id = new StringTokenizer(line.substring(2)).nextToken();
290 else if (line.startsWith("ncbieaa"))
292 String aminos = line.substring(line.indexOf(QUOTE) + 1,
293 line.lastIndexOf(QUOTE));
294 if (aminos.length() != NUCS_COUNT_CUBED) // 4 * 4 * 4 combinations
296 Console.error("wrong data length in code table: " + line);
300 for (int i = 0; i < aminos.length(); i++)
302 String peptide = String.valueOf(aminos.charAt(i));
303 char codon1 = NUCS.charAt(i / NUCS_COUNT_SQUARED);
305 .charAt((i % NUCS_COUNT_SQUARED) / NUCS_COUNT);
306 char codon3 = NUCS.charAt(i % NUCS_COUNT);
307 String codon = new String(
309 { codon1, codon2, codon3 });
310 codons.put(codon, peptide);
314 line = readLine(dataIn);
317 registerCodeTable(id, name, codons);
318 return readLine(dataIn);
322 * Constructs and registers a GeneticCodeI instance with the codon
323 * translations as defined in the data file. For all instances except the
324 * first, any undeclared translations default to those in the standard code
331 protected void registerCodeTable(final String id, final String name,
332 final Map<String, String> codons)
334 codeTables.put(id, new GeneticCodeI()
337 * map of ambiguous codons to their 'product'
338 * (null if not all possible translations match)
340 Map<String, String> ambiguous = new HashMap<>();
343 public String translateCanonical(String codon)
345 return codons.get(codon.toUpperCase(Locale.ROOT));
349 public String translate(String codon)
351 String upper = codon.toUpperCase(Locale.ROOT);
352 String peptide = translateCanonical(upper);
355 * if still not translated, check for ambiguity codes
359 peptide = getAmbiguousTranslation(upper, ambiguous, this);
365 public String getId()
371 public String getName()
379 * Computes all possible translations of a codon including one or more
380 * ambiguity codes, and stores and returns the result (null if not all
381 * translations match). If the codon includes no ambiguity codes, simply
389 protected String getAmbiguousTranslation(String codon,
390 Map<String, String> ambiguous, GeneticCodeI codeTable)
392 if (codon.length() != CODON_LENGTH)
397 boolean isAmbiguous = false;
399 char[][] expanded = new char[CODON_LENGTH][];
400 for (int i = 0; i < CODON_LENGTH; i++)
402 String base = String.valueOf(codon.charAt(i));
403 if (ambiguityCodes.containsKey(base))
406 base = ambiguityCodes.get(base);
408 expanded[i] = base.toCharArray();
413 // no ambiguity code involved here
418 * generate and translate all permutations of the ambiguous codon
419 * only return the translation if they all agree, else null
421 String peptide = null;
422 for (char c1 : expanded[0])
424 for (char c2 : expanded[1])
426 for (char c3 : expanded[2])
428 char[] cdn = new char[] { c1, c2, c3 };
429 String possibleCodon = String.valueOf(cdn);
430 String pep = codeTable.translate(possibleCodon);
431 if (pep == null || (peptide != null && !pep.equals(peptide)))
433 ambiguous.put(codon, null);
442 * all translations of ambiguous codons matched!
444 ambiguous.put(codon, peptide);