test/Test.java

   1 // $Id:
   2 // FORESTER -- software libraries and applications
   3 // for evolutionary biology research and applications.
   4 //
   5 // Copyright (C) 2014 Christian M. Zmasek
   6 // Copyright (C) 2014 Sanford-Burnham Medical Research Institute
   7 // All rights reserved
   8 //
   9 // This library is free software; you can redistribute it and/or
  10 // modify it under the terms of the GNU Lesser General Public
  11 // License as published by the Free Software Foundation; either
  12 // version 2.1 of the License, or (at your option) any later version.
  13 //
  14 // This library is distributed in the hope that it will be useful,
  15 // but WITHOUT ANY WARRANTY; without even the implied warranty of
  16 // MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU
  17 // Lesser General Public License for more details.
  18 //
  19 // You should have received a copy of the GNU Lesser General Public
  20 // License along with this library; if not, write to the Free Software
  21 // Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301, USA
  22 //
  23 // WWW: https://sites.google.com/site/cmzmasek/home/software/forester
  24
  25 package org.forester.test;
  26
  27 import java.io.ByteArrayInputStream;
  28 import java.io.File;
  29 import java.io.FileInputStream;
  30 import java.io.IOException;
  31 import java.io.StringWriter;
  32 import java.io.Writer;
  33 import java.net.URL;
  34 import java.util.ArrayList;
  35 import java.util.Date;
  36 import java.util.HashSet;
  37 import java.util.Iterator;
  38 import java.util.List;
  39 import java.util.Locale;
  40 import java.util.Set;
  41 import java.util.SortedSet;
  42
  43 import org.forester.application.support_transfer;
  44 import org.forester.archaeopteryx.AptxUtil;
  45 import org.forester.archaeopteryx.TreePanelUtil;
  46 import org.forester.archaeopteryx.webservices.WebserviceUtil;
  47 import org.forester.development.DevelopmentTools;
  48 import org.forester.evoinference.TestPhylogenyReconstruction;
  49 import org.forester.evoinference.matrix.character.CharacterStateMatrix;
  50 import org.forester.evoinference.matrix.character.CharacterStateMatrix.BinaryStates;
  51 import org.forester.go.TestGo;
  52 import org.forester.io.parsers.FastaParser;
  53 import org.forester.io.parsers.GeneralMsaParser;
  54 import org.forester.io.parsers.HmmscanPerDomainTableParser;
  55 import org.forester.io.parsers.HmmscanPerDomainTableParser.INDIVIDUAL_SCORE_CUTOFF;
  56 import org.forester.io.parsers.nexus.NexusBinaryStatesMatrixParser;
  57 import org.forester.io.parsers.nexus.NexusCharactersParser;
  58 import org.forester.io.parsers.nexus.NexusPhylogeniesParser;
  59 import org.forester.io.parsers.nhx.NHXParser;
  60 import org.forester.io.parsers.nhx.NHXParser.TAXONOMY_EXTRACTION;
  61 import org.forester.io.parsers.phyloxml.PhyloXmlParser;
  62 import org.forester.io.parsers.tol.TolParser;
  63 import org.forester.io.parsers.util.ParserUtils;
  64 import org.forester.io.writers.PhylogenyWriter;
  65 import org.forester.io.writers.SequenceWriter;
  66 import org.forester.msa.BasicMsa;
  67 import org.forester.msa.DeleteableMsa;
  68 import org.forester.msa.Mafft;
  69 import org.forester.msa.Msa;
  70 import org.forester.msa.Msa.MSA_FORMAT;
  71 import org.forester.msa.MsaInferrer;
  72 import org.forester.msa.MsaMethods;
  73 import org.forester.pccx.TestPccx;
  74 import org.forester.phylogeny.Phylogeny;
  75 import org.forester.phylogeny.PhylogenyBranch;
  76 import org.forester.phylogeny.PhylogenyMethods;
  77 import org.forester.phylogeny.PhylogenyNode;
  78 import org.forester.phylogeny.PhylogenyNode.NH_CONVERSION_SUPPORT_VALUE_STYLE;
  79 import org.forester.phylogeny.data.Accession;
  80 import org.forester.phylogeny.data.Accession.Source;
  81 import org.forester.phylogeny.data.BinaryCharacters;
  82 import org.forester.phylogeny.data.BranchWidth;
  83 import org.forester.phylogeny.data.Confidence;
  84 import org.forester.phylogeny.data.Distribution;
  85 import org.forester.phylogeny.data.DomainArchitecture;
  86 import org.forester.phylogeny.data.Event;
  87 import org.forester.phylogeny.data.Identifier;
  88 import org.forester.phylogeny.data.PhylogenyData;
  89 import org.forester.phylogeny.data.PhylogenyDataUtil;
  90 import org.forester.phylogeny.data.Polygon;
  91 import org.forester.phylogeny.data.PropertiesMap;
  92 import org.forester.phylogeny.data.Property;
  93 import org.forester.phylogeny.data.Property.AppliesTo;
  94 import org.forester.phylogeny.data.ProteinDomain;
  95 import org.forester.phylogeny.data.Taxonomy;
  96 import org.forester.phylogeny.factories.ParserBasedPhylogenyFactory;
  97 import org.forester.phylogeny.factories.PhylogenyFactory;
  98 import org.forester.phylogeny.iterators.PhylogenyNodeIterator;
  99 import org.forester.protein.BasicDomain;
 100 import org.forester.protein.BasicProtein;
 101 import org.forester.protein.Domain;
 102 import org.forester.protein.Protein;
 103 import org.forester.protein.ProteinId;
 104 import org.forester.rio.TestRIO;
 105 import org.forester.sdi.SDI;
 106 import org.forester.sdi.SDIR;
 107 import org.forester.sdi.TestGSDI;
 108 import org.forester.sequence.BasicSequence;
 109 import org.forester.sequence.MolecularSequence;
 110 import org.forester.species.BasicSpecies;
 111 import org.forester.species.Species;
 112 import org.forester.surfacing.TestSurfacing;
 113 import org.forester.tools.ConfidenceAssessor;
 114 import org.forester.tools.SupportCount;
 115 import org.forester.tools.TreeSplitMatrix;
 116 import org.forester.util.AsciiHistogram;
 117 import org.forester.util.BasicDescriptiveStatistics;
 118 import org.forester.util.BasicTable;
 119 import org.forester.util.BasicTableParser;
 120 import org.forester.util.DescriptiveStatistics;
 121 import org.forester.util.ForesterConstants;
 122 import org.forester.util.ForesterUtil;
 123 import org.forester.util.GeneralTable;
 124 import org.forester.util.SequenceAccessionTools;
 125 import org.forester.ws.seqdb.SequenceDatabaseEntry;
 126 import org.forester.ws.seqdb.SequenceDbWsTools;
 127 import org.forester.ws.seqdb.UniProtTaxonomy;
 128 import org.forester.ws.wabi.TxSearch;
 129 import org.forester.ws.wabi.TxSearch.RANKS;
 130 import org.forester.ws.wabi.TxSearch.TAX_NAME_CLASS;
 131 import org.forester.ws.wabi.TxSearch.TAX_RANK;
 132
 133 @SuppressWarnings( "unused")
 134 public final class Test {
 135
 136     private final static String  PATH_TO_RESOURCES         = System.getProperty( "user.dir" )
 137             + ForesterUtil.getFileSeparator() + "resources"
 138             + ForesterUtil.getFileSeparator();
 139     private final static String  PATH_TO_TEST_DATA         = System.getProperty( "user.dir" )
 140             + ForesterUtil.getFileSeparator() + "test_data"
 141             + ForesterUtil.getFileSeparator();
 142     private final static boolean PERFORM_DB_TESTS          = true;
 143     private static final boolean PERFORM_WEB_TREE_ACCESS   = true;
 144     private static final String  PHYLOXML_LOCAL_XSD        = PATH_TO_RESOURCES + "phyloxml_schema/"
 145             + ForesterConstants.PHYLO_XML_VERSION + "/"
 146             + ForesterConstants.PHYLO_XML_XSD;
 147     private static final String  PHYLOXML_REMOTE_XSD       = ForesterConstants.PHYLO_XML_LOCATION + "/"
 148             + ForesterConstants.PHYLO_XML_VERSION + "/"
 149             + ForesterConstants.PHYLO_XML_XSD;
 150     private final static boolean USE_LOCAL_PHYLOXML_SCHEMA = true;
 151     private final static double  ZERO_DIFF                 = 1.0E-9;
 152
 153     public static boolean isEqual( final double a, final double b ) {
 154         return ( ( Math.abs( a - b ) ) < Test.ZERO_DIFF );
 155     }
 156
 157     public static void main( final String[] args ) {
 158         System.out.println( "[Java version: " + ForesterUtil.JAVA_VERSION + " " + ForesterUtil.JAVA_VENDOR + "]" );
 159         System.out.println( "[OS: " + ForesterUtil.OS_NAME + " " + ForesterUtil.OS_ARCH + " " + ForesterUtil.OS_VERSION
 160                             + "]" );
 161         Locale.setDefault( Locale.US );
 162         System.out.println( "[Locale: " + Locale.getDefault() + "]" );
 163         int failed = 0;
 164         int succeeded = 0;
 165         System.out.print( "[Test if directory with files for testing exists/is readable: " );
 166         if ( Test.testDir( PATH_TO_TEST_DATA ) ) {
 167             System.out.println( "OK.]" );
 168         }
 169         else {
 170             System.out.println( "could not find/read from directory \"" + PATH_TO_TEST_DATA + "\".]" );
 171             System.out.println( "Testing aborted." );
 172             System.exit( -1 );
 173         }
 174         System.out.print( "[Test if resources directory exists/is readable: " );
 175         if ( testDir( PATH_TO_RESOURCES ) ) {
 176             System.out.println( "OK.]" );
 177         }
 178         else {
 179             System.out.println( "could not find/read from directory \"" + Test.PATH_TO_RESOURCES + "\".]" );
 180             System.out.println( "Testing aborted." );
 181             System.exit( -1 );
 182         }
 183         final long start_time = new Date().getTime();
 184         System.out.print( "Basic node methods: " );
 185         if ( Test.testBasicNodeMethods() ) {
 186             System.out.println( "OK." );
 187             succeeded++;
 188         }
 189         else {
 190             System.out.println( "failed." );
 191             failed++;
 192         }
 193         System.out.print( "Protein id: " );
 194         if ( !testProteinId() ) {
 195             System.out.println( "failed." );
 196             failed++;
 197         }
 198         else {
 199             succeeded++;
 200         }
 201         System.out.println( "OK." );
 202         System.out.print( "Species: " );
 203         if ( !testSpecies() ) {
 204             System.out.println( "failed." );
 205             failed++;
 206         }
 207         else {
 208             succeeded++;
 209         }
 210         System.out.println( "OK." );
 211         System.out.print( "Basic domain: " );
 212         if ( !testBasicDomain() ) {
 213             System.out.println( "failed." );
 214             failed++;
 215         }
 216         else {
 217             succeeded++;
 218         }
 219         System.out.println( "OK." );
 220         System.out.print( "Basic protein: " );
 221         if ( !testBasicProtein() ) {
 222             System.out.println( "failed." );
 223             failed++;
 224         }
 225         else {
 226             succeeded++;
 227         }
 228         System.out.println( "OK." );
 229         System.out.print( "Sequence writer: " );
 230         if ( testSequenceWriter() ) {
 231             System.out.println( "OK." );
 232             succeeded++;
 233         }
 234         else {
 235             System.out.println( "failed." );
 236             failed++;
 237         }
 238         System.out.print( "Sequence id parsing: " );
 239         if ( testSequenceIdParsing() ) {
 240             System.out.println( "OK." );
 241             succeeded++;
 242         }
 243         else {
 244             System.out.println( "failed." );
 245             failed++;
 246         }
 247         System.out.print( "UniProtKB id extraction: " );
 248         if ( Test.testExtractUniProtKbProteinSeqIdentifier() ) {
 249             System.out.println( "OK." );
 250             succeeded++;
 251         }
 252         else {
 253             System.out.println( "failed." );
 254             failed++;
 255         }
 256         System.out.print( "Sequence DB tools 1: " );
 257         if ( testSequenceDbWsTools1() ) {
 258             System.out.println( "OK." );
 259             succeeded++;
 260         }
 261         else {
 262             System.out.println( "failed." );
 263             failed++;
 264         }
 265         System.out.print( "Hmmscan output parser: " );
 266         if ( testHmmscanOutputParser() ) {
 267             System.out.println( "OK." );
 268             succeeded++;
 269         }
 270         else {
 271             System.out.println( "failed." );
 272             failed++;
 273         }
 274         System.out.print( "Overlap removal: " );
 275         if ( !org.forester.test.Test.testOverlapRemoval() ) {
 276             System.out.println( "failed." );
 277             failed++;
 278         }
 279         else {
 280             succeeded++;
 281         }
 282         System.out.println( "OK." );
 283         System.out.print( "Engulfing overlap removal: " );
 284         if ( !Test.testEngulfingOverlapRemoval() ) {
 285             System.out.println( "failed." );
 286             failed++;
 287         }
 288         else {
 289             succeeded++;
 290         }
 291         System.out.println( "OK." );
 292         System.out.print( "Taxonomy data extraction: " );
 293         if ( Test.testExtractTaxonomyDataFromNodeName() ) {
 294             System.out.println( "OK." );
 295             succeeded++;
 296         }
 297         else {
 298             System.out.println( "failed." );
 299             failed++;
 300         }
 301         System.out.print( "Taxonomy code extraction: " );
 302         if ( Test.testExtractTaxonomyCodeFromNodeName() ) {
 303             System.out.println( "OK." );
 304             succeeded++;
 305         }
 306         else {
 307             System.out.println( "failed." );
 308             failed++;
 309         }
 310         System.out.print( "SN extraction: " );
 311         if ( Test.testExtractSNFromNodeName() ) {
 312             System.out.println( "OK." );
 313             succeeded++;
 314         }
 315         else {
 316             System.out.println( "failed." );
 317             failed++;
 318         }
 319         System.out.print( "Taxonomy extraction (general): " );
 320         if ( Test.testTaxonomyExtraction() ) {
 321             System.out.println( "OK." );
 322             succeeded++;
 323         }
 324         else {
 325             System.out.println( "failed." );
 326             failed++;
 327         }
 328         System.out.print( "Uri for Aptx web sequence accession: " );
 329         if ( Test.testCreateUriForSeqWeb() ) {
 330             System.out.println( "OK." );
 331             succeeded++;
 332         }
 333         else {
 334             System.out.println( "failed." );
 335             failed++;
 336         }
 337         System.out.print( "Basic node construction and parsing of NHX (node level): " );
 338         if ( Test.testNHXNodeParsing() ) {
 339             System.out.println( "OK." );
 340             succeeded++;
 341         }
 342         else {
 343             System.out.println( "failed." );
 344             failed++;
 345         }
 346         System.out.print( "NHX parsing iterating: " );
 347         if ( Test.testNHParsingIter() ) {
 348             System.out.println( "OK." );
 349             succeeded++;
 350         }
 351         else {
 352             System.out.println( "failed." );
 353             failed++;
 354         }
 355         System.out.print( "NH parsing: " );
 356         if ( Test.testNHParsing() ) {
 357             System.out.println( "OK." );
 358             succeeded++;
 359         }
 360         else {
 361             System.out.println( "failed." );
 362             failed++;
 363         }
 364         System.out.print( "Conversion to NHX (node level): " );
 365         if ( Test.testNHXconversion() ) {
 366             System.out.println( "OK." );
 367             succeeded++;
 368         }
 369         else {
 370             System.out.println( "failed." );
 371             failed++;
 372         }
 373         System.out.print( "NHX parsing: " );
 374         if ( Test.testNHXParsing() ) {
 375             System.out.println( "OK." );
 376             succeeded++;
 377         }
 378         else {
 379             System.out.println( "failed." );
 380             failed++;
 381         }
 382         System.out.print( "NHX parsing with quotes: " );
 383         if ( Test.testNHXParsingQuotes() ) {
 384             System.out.println( "OK." );
 385             succeeded++;
 386         }
 387         else {
 388             System.out.println( "failed." );
 389             failed++;
 390         }
 391         System.out.print( "NHX parsing (MrBayes): " );
 392         if ( Test.testNHXParsingMB() ) {
 393             System.out.println( "OK." );
 394             succeeded++;
 395         }
 396         else {
 397             System.out.println( "failed." );
 398             failed++;
 399         }
 400         System.out.print( "Nexus characters parsing: " );
 401         if ( Test.testNexusCharactersParsing() ) {
 402             System.out.println( "OK." );
 403             succeeded++;
 404         }
 405         else {
 406             System.out.println( "failed." );
 407             failed++;
 408         }
 409         System.out.print( "Nexus tree parsing iterating: " );
 410         if ( Test.testNexusTreeParsingIterating() ) {
 411             System.out.println( "OK." );
 412             succeeded++;
 413         }
 414         else {
 415             System.out.println( "failed." );
 416             failed++;
 417         }
 418         System.out.print( "Nexus tree parsing: " );
 419         if ( Test.testNexusTreeParsing() ) {
 420             System.out.println( "OK." );
 421             succeeded++;
 422         }
 423         else {
 424             System.out.println( "failed." );
 425             failed++;
 426         }
 427         System.out.print( "Nexus tree parsing (translating): " );
 428         if ( Test.testNexusTreeParsingTranslating() ) {
 429             System.out.println( "OK." );
 430             succeeded++;
 431         }
 432         else {
 433             System.out.println( "failed." );
 434             failed++;
 435         }
 436         System.out.print( "Nexus matrix parsing: " );
 437         if ( Test.testNexusMatrixParsing() ) {
 438             System.out.println( "OK." );
 439             succeeded++;
 440         }
 441         else {
 442             System.out.println( "failed." );
 443             failed++;
 444         }
 445         System.out.print( "Basic phyloXML parsing: " );
 446         if ( Test.testBasicPhyloXMLparsing() ) {
 447             System.out.println( "OK." );
 448             succeeded++;
 449         }
 450         else {
 451             System.out.println( "failed." );
 452             failed++;
 453         }
 454         System.out.print( "Basic phyloXML parsing (validating against schema): " );
 455         if ( testBasicPhyloXMLparsingValidating() ) {
 456             System.out.println( "OK." );
 457             succeeded++;
 458         }
 459         else {
 460             System.out.println( "failed." );
 461             failed++;
 462         }
 463         System.out.print( "Roundtrip phyloXML parsing (validating against schema): " );
 464         if ( Test.testBasicPhyloXMLparsingRoundtrip() ) {
 465             System.out.println( "OK." );
 466             succeeded++;
 467         }
 468         else {
 469             System.out.println( "failed." );
 470             failed++;
 471         }
 472         System.out.print( "phyloXML Distribution Element: " );
 473         if ( Test.testPhyloXMLparsingOfDistributionElement() ) {
 474             System.out.println( "OK." );
 475             succeeded++;
 476         }
 477         else {
 478             System.out.println( "failed." );
 479             failed++;
 480         }
 481         System.out.print( "Tol XML parsing: " );
 482         if ( Test.testBasicTolXMLparsing() ) {
 483             System.out.println( "OK." );
 484             succeeded++;
 485         }
 486         else {
 487             System.out.println( "failed." );
 488             failed++;
 489         }
 490         System.out.print( "Copying of node data: " );
 491         if ( Test.testCopyOfNodeData() ) {
 492             System.out.println( "OK." );
 493             succeeded++;
 494         }
 495         else {
 496             System.out.println( "failed." );
 497             failed++;
 498         }
 499         System.out.print( "Tree copy: " );
 500         if ( Test.testTreeCopy() ) {
 501             System.out.println( "OK." );
 502             succeeded++;
 503         }
 504         else {
 505             System.out.println( "failed." );
 506             failed++;
 507         }
 508         System.out.print( "Basic tree methods: " );
 509         if ( Test.testBasicTreeMethods() ) {
 510             System.out.println( "OK." );
 511             succeeded++;
 512         }
 513         else {
 514             System.out.println( "failed." );
 515             failed++;
 516         }
 517         System.out.print( "Tree methods: " );
 518         if ( Test.testTreeMethods() ) {
 519             System.out.println( "OK." );
 520             succeeded++;
 521         }
 522         else {
 523             System.out.println( "failed." );
 524             failed++;
 525         }
 526         System.out.print( "Postorder Iterator: " );
 527         if ( Test.testPostOrderIterator() ) {
 528             System.out.println( "OK." );
 529             succeeded++;
 530         }
 531         else {
 532             System.out.println( "failed." );
 533             failed++;
 534         }
 535         System.out.print( "Preorder Iterator: " );
 536         if ( Test.testPreOrderIterator() ) {
 537             System.out.println( "OK." );
 538             succeeded++;
 539         }
 540         else {
 541             System.out.println( "failed." );
 542             failed++;
 543         }
 544         System.out.print( "Levelorder Iterator: " );
 545         if ( Test.testLevelOrderIterator() ) {
 546             System.out.println( "OK." );
 547             succeeded++;
 548         }
 549         else {
 550             System.out.println( "failed." );
 551             failed++;
 552         }
 553         System.out.print( "Re-id methods: " );
 554         if ( Test.testReIdMethods() ) {
 555             System.out.println( "OK." );
 556             succeeded++;
 557         }
 558         else {
 559             System.out.println( "failed." );
 560             failed++;
 561         }
 562         System.out.print( "Methods on last external nodes: " );
 563         if ( Test.testLastExternalNodeMethods() ) {
 564             System.out.println( "OK." );
 565             succeeded++;
 566         }
 567         else {
 568             System.out.println( "failed." );
 569             failed++;
 570         }
 571         System.out.print( "Methods on external nodes: " );
 572         if ( Test.testExternalNodeRelatedMethods() ) {
 573             System.out.println( "OK." );
 574             succeeded++;
 575         }
 576         else {
 577             System.out.println( "failed." );
 578             failed++;
 579         }
 580         System.out.print( "Deletion of external nodes: " );
 581         if ( Test.testDeletionOfExternalNodes() ) {
 582             System.out.println( "OK." );
 583             succeeded++;
 584         }
 585         else {
 586             System.out.println( "failed." );
 587             failed++;
 588         }
 589         System.out.print( "Subtree deletion: " );
 590         if ( Test.testSubtreeDeletion() ) {
 591             System.out.println( "OK." );
 592             succeeded++;
 593         }
 594         else {
 595             System.out.println( "failed." );
 596             failed++;
 597         }
 598         System.out.print( "Phylogeny branch: " );
 599         if ( Test.testPhylogenyBranch() ) {
 600             System.out.println( "OK." );
 601             succeeded++;
 602         }
 603         else {
 604             System.out.println( "failed." );
 605             failed++;
 606         }
 607         System.out.print( "Rerooting: " );
 608         if ( Test.testRerooting() ) {
 609             System.out.println( "OK." );
 610             succeeded++;
 611         }
 612         else {
 613             System.out.println( "failed." );
 614             failed++;
 615         }
 616         System.out.print( "Mipoint rooting: " );
 617         if ( Test.testMidpointrooting() ) {
 618             System.out.println( "OK." );
 619             succeeded++;
 620         }
 621         else {
 622             System.out.println( "failed." );
 623             failed++;
 624         }
 625         System.out.print( "Node removal: " );
 626         if ( Test.testNodeRemoval() ) {
 627             System.out.println( "OK." );
 628             succeeded++;
 629         }
 630         else {
 631             System.out.println( "failed." );
 632             failed++;
 633         }
 634         System.out.print( "Support count: " );
 635         if ( Test.testSupportCount() ) {
 636             System.out.println( "OK." );
 637             succeeded++;
 638         }
 639         else {
 640             System.out.println( "failed." );
 641             failed++;
 642         }
 643         System.out.print( "Support transfer: " );
 644         if ( Test.testSupportTransfer() ) {
 645             System.out.println( "OK." );
 646             succeeded++;
 647         }
 648         else {
 649             System.out.println( "failed." );
 650             failed++;
 651         }
 652         System.out.print( "Finding of LCA: " );
 653         if ( Test.testGetLCA() ) {
 654             System.out.println( "OK." );
 655             succeeded++;
 656         }
 657         else {
 658             System.out.println( "failed." );
 659             failed++;
 660         }
 661         System.out.print( "Finding of LCA 2: " );
 662         if ( Test.testGetLCA2() ) {
 663             System.out.println( "OK." );
 664             succeeded++;
 665         }
 666         else {
 667             System.out.println( "failed." );
 668             failed++;
 669         }
 670         System.out.print( "Calculation of distance between nodes: " );
 671         if ( Test.testGetDistance() ) {
 672             System.out.println( "OK." );
 673             succeeded++;
 674         }
 675         else {
 676             System.out.println( "failed." );
 677             failed++;
 678         }
 679         System.out.print( "Descriptive statistics: " );
 680         if ( Test.testDescriptiveStatistics() ) {
 681             System.out.println( "OK." );
 682             succeeded++;
 683         }
 684         else {
 685             System.out.println( "failed." );
 686             failed++;
 687         }
 688         System.out.print( "Data objects and methods: " );
 689         if ( Test.testDataObjects() ) {
 690             System.out.println( "OK." );
 691             succeeded++;
 692         }
 693         else {
 694             System.out.println( "failed." );
 695             failed++;
 696         }
 697         System.out.print( "Properties map: " );
 698         if ( Test.testPropertiesMap() ) {
 699             System.out.println( "OK." );
 700             succeeded++;
 701         }
 702         else {
 703             System.out.println( "failed." );
 704             failed++;
 705         }
 706         System.out.print( "SDIse: " );
 707         if ( Test.testSDIse() ) {
 708             System.out.println( "OK." );
 709             succeeded++;
 710         }
 711         else {
 712             System.out.println( "failed." );
 713             failed++;
 714         }
 715         System.out.print( "SDIunrooted: " );
 716         if ( Test.testSDIunrooted() ) {
 717             System.out.println( "OK." );
 718             succeeded++;
 719         }
 720         else {
 721             System.out.println( "failed." );
 722             failed++;
 723         }
 724         System.out.print( "GSDI: " );
 725         if ( TestGSDI.test() ) {
 726             System.out.println( "OK." );
 727             succeeded++;
 728         }
 729         else {
 730             System.out.println( "failed." );
 731             failed++;
 732         }
 733         System.out.print( "RIO: " );
 734         if ( TestRIO.test() ) {
 735             System.out.println( "OK." );
 736             succeeded++;
 737         }
 738         else {
 739             System.out.println( "failed." );
 740             failed++;
 741         }
 742         System.out.print( "Phylogeny reconstruction:" );
 743         System.out.println();
 744         if ( TestPhylogenyReconstruction.test( new File( PATH_TO_TEST_DATA ) ) ) {
 745             System.out.println( "OK." );
 746             succeeded++;
 747         }
 748         else {
 749             System.out.println( "failed." );
 750             failed++;
 751         }
 752         System.out.print( "Analysis of domain architectures: " );
 753         System.out.println();
 754         if ( TestSurfacing.test( new File( PATH_TO_TEST_DATA ) ) ) {
 755             System.out.println( "OK." );
 756             succeeded++;
 757         }
 758         else {
 759             System.out.println( "failed." );
 760             failed++;
 761         }
 762         System.out.print( "GO: " );
 763         System.out.println();
 764         if ( TestGo.test( new File( PATH_TO_TEST_DATA ) ) ) {
 765             System.out.println( "OK." );
 766             succeeded++;
 767         }
 768         else {
 769             System.out.println( "failed." );
 770             failed++;
 771         }
 772         System.out.print( "Modeling tools: " );
 773         if ( TestPccx.test() ) {
 774             System.out.println( "OK." );
 775             succeeded++;
 776         }
 777         else {
 778             System.out.println( "failed." );
 779             failed++;
 780         }
 781         System.out.print( "Split Matrix strict: " );
 782         if ( Test.testSplitStrict() ) {
 783             System.out.println( "OK." );
 784             succeeded++;
 785         }
 786         else {
 787             System.out.println( "failed." );
 788             failed++;
 789         }
 790         System.out.print( "Split Matrix: " );
 791         if ( Test.testSplit() ) {
 792             System.out.println( "OK." );
 793             succeeded++;
 794         }
 795         else {
 796             System.out.println( "failed." );
 797             failed++;
 798         }
 799         System.out.print( "Confidence Assessor: " );
 800         if ( Test.testConfidenceAssessor() ) {
 801             System.out.println( "OK." );
 802             succeeded++;
 803         }
 804         else {
 805             System.out.println( "failed." );
 806             failed++;
 807         }
 808         System.out.print( "Basic table: " );
 809         if ( Test.testBasicTable() ) {
 810             System.out.println( "OK." );
 811             succeeded++;
 812         }
 813         else {
 814             System.out.println( "failed." );
 815             failed++;
 816         }
 817         System.out.print( "General table: " );
 818         if ( Test.testGeneralTable() ) {
 819             System.out.println( "OK." );
 820             succeeded++;
 821         }
 822         else {
 823             System.out.println( "failed." );
 824             failed++;
 825         }
 826         System.out.print( "Amino acid sequence: " );
 827         if ( Test.testAminoAcidSequence() ) {
 828             System.out.println( "OK." );
 829             succeeded++;
 830         }
 831         else {
 832             System.out.println( "failed." );
 833             failed++;
 834         }
 835         System.out.print( "General MSA parser: " );
 836         if ( Test.testGeneralMsaParser() ) {
 837             System.out.println( "OK." );
 838             succeeded++;
 839         }
 840         else {
 841             System.out.println( "failed." );
 842             failed++;
 843         }
 844         System.out.print( "Fasta parser for msa: " );
 845         if ( Test.testFastaParser() ) {
 846             System.out.println( "OK." );
 847             succeeded++;
 848         }
 849         else {
 850             System.out.println( "failed." );
 851             failed++;
 852         }
 853         System.out.print( "Creation of balanced phylogeny: " );
 854         if ( Test.testCreateBalancedPhylogeny() ) {
 855             System.out.println( "OK." );
 856             succeeded++;
 857         }
 858         else {
 859             System.out.println( "failed." );
 860             failed++;
 861         }
 862         System.out.print( "Genbank accessor parsing: " );
 863         if ( Test.testGenbankAccessorParsing() ) {
 864             System.out.println( "OK." );
 865             succeeded++;
 866         }
 867         else {
 868             System.out.println( "failed." );
 869             failed++;
 870         }
 871         String path = "";
 872         final String os = ForesterUtil.OS_NAME.toLowerCase();
 873         if ( ( os.indexOf( "mac" ) >= 0 ) && ( os.indexOf( "os" ) > 0 ) ) {
 874             path = "/usr/local/bin/mafft";
 875         }
 876         else if ( os.indexOf( "win" ) >= 0 ) {
 877             path = "C:\\Program Files\\mafft-win\\mafft.bat";
 878         }
 879         else {
 880             path = "mafft";
 881             if ( !MsaInferrer.isInstalled( path ) ) {
 882                 path = "/usr/bin/mafft";
 883             }
 884             if ( !MsaInferrer.isInstalled( path ) ) {
 885                 path = "/usr/local/bin/mafft";
 886             }
 887         }
 888         if ( MsaInferrer.isInstalled( path ) ) {
 889             System.out.print( "MAFFT (external program): " );
 890             if ( Test.testMafft( path ) ) {
 891                 System.out.println( "OK." );
 892                 succeeded++;
 893             }
 894             else {
 895                 System.out.println( "failed [will not count towards failed tests]" );
 896             }
 897         }
 898         System.out.print( "Next nodes with collapsed: " );
 899         if ( Test.testNextNodeWithCollapsing() ) {
 900             System.out.println( "OK." );
 901             succeeded++;
 902         }
 903         else {
 904             System.out.println( "failed." );
 905             failed++;
 906         }
 907         System.out.print( "Simple MSA quality: " );
 908         if ( Test.testMsaQualityMethod() ) {
 909             System.out.println( "OK." );
 910             succeeded++;
 911         }
 912         else {
 913             System.out.println( "failed." );
 914             failed++;
 915         }
 916         System.out.print( "Deleteable MSA: " );
 917         if ( Test.testDeleteableMsa() ) {
 918             System.out.println( "OK." );
 919             succeeded++;
 920         }
 921         else {
 922             System.out.println( "failed." );
 923             failed++;
 924         }
 925         System.out.print( "MSA entropy: " );
 926         if ( Test.testMsaEntropy() ) {
 927             System.out.println( "OK." );
 928             succeeded++;
 929         }
 930         else {
 931             System.out.println( "failed." );
 932             failed++;
 933         }
 934         if ( PERFORM_DB_TESTS ) {
 935             System.out.print( "Uniprot Entry Retrieval: " );
 936             if ( Test.testUniprotEntryRetrieval() ) {
 937                 System.out.println( "OK." );
 938                 succeeded++;
 939             }
 940             else {
 941                 System.out.println( "failed." );
 942                 failed++;
 943             }
 944             System.out.print( "Ebi Entry Retrieval: " );
 945             if ( Test.testEbiEntryRetrieval() ) {
 946                 System.out.println( "OK." );
 947                 succeeded++;
 948             }
 949             else {
 950                 System.out.println( "failed." );
 951                 failed++;
 952             }
 953             System.out.print( "Sequence DB tools 2: " );
 954             if ( testSequenceDbWsTools2() ) {
 955                 System.out.println( "OK." );
 956                 succeeded++;
 957             }
 958             else {
 959                 System.out.println( "failed." );
 960                 failed++;
 961                 System.exit( -1 );
 962             }
 963             System.out.print( "Uniprot Taxonomy Search: " );
 964             if ( Test.testUniprotTaxonomySearch() ) {
 965                 System.out.println( "OK." );
 966                 succeeded++;
 967             }
 968             else {
 969                 System.out.println( "failed." );
 970                 failed++;
 971             }
 972         }
 973         if ( PERFORM_WEB_TREE_ACCESS ) {
 974             System.out.print( "NHX parsing from URL: " );
 975             if ( Test.testNHXparsingFromURL() ) {
 976                 System.out.println( "OK." );
 977                 succeeded++;
 978             }
 979             else {
 980                 System.out.println( "failed." );
 981                 failed++;
 982             }
 983             System.out.print( "NHX parsing from URL 2: " );
 984             if ( Test.testNHXparsingFromURL2() ) {
 985                 System.out.println( "OK." );
 986                 succeeded++;
 987             }
 988             else {
 989                 System.out.println( "failed." );
 990                 failed++;
 991             }
 992             System.out.print( "phyloXML parsing from URL: " );
 993             if ( Test.testPhyloXMLparsingFromURL() ) {
 994                 System.out.println( "OK." );
 995                 succeeded++;
 996             }
 997             else {
 998                 System.out.println( "failed." );
 999                 failed++;
1000             }
1001             System.out.print( "TreeBase acccess: " );
1002             if ( Test.testTreeBaseReading() ) {
1003                 System.out.println( "OK." );
1004                 succeeded++;
1005             }
1006             else {
1007                 System.out.println( "failed." );
1008                 failed++;
1009             }
1010             //
1011             System.out.print( "ToL access: " );
1012             if ( Test.testToLReading() ) {
1013                 System.out.println( "OK." );
1014                 succeeded++;
1015             }
1016             else {
1017                 System.out.println( "failed." );
1018                 failed++;
1019             }
1020             //
1021             System.out.print( "TreeFam access: " );
1022             if ( Test.testTreeFamReading() ) {
1023                 System.out.println( "OK." );
1024                 succeeded++;
1025             }
1026             else {
1027                 System.out.println( "failed." );
1028                 failed++;
1029             }
1030             //
1031             //
1032             System.out.print( "Pfam tree access: " );
1033             if ( Test.testPfamTreeReading() ) {
1034                 System.out.println( "OK." );
1035                 succeeded++;
1036             }
1037             else {
1038                 System.out.println( "failed." );
1039                 failed++;
1040             }
1041         }
1042         System.out.println();
1043         final Runtime rt = java.lang.Runtime.getRuntime();
1044         final long free_memory = rt.freeMemory() / 1000000;
1045         final long total_memory = rt.totalMemory() / 1000000;
1046         System.out.println( "Running time    : " + ( new Date().getTime() - start_time ) + "ms " + "(free memory: "
1047                 + free_memory + "MB, total memory: " + total_memory + "MB)" );
1048         System.out.println();
1049         System.out.println( "Successful tests: " + succeeded );
1050         System.out.println( "Failed     tests: " + failed );
1051         System.out.println();
1052         if ( failed < 1 ) {
1053             System.out.println( "OK." );
1054         }
1055         else {
1056             System.out.println( "Not OK." );
1057         }
1058     }
1059
1060     public static boolean testEngulfingOverlapRemoval() {
1061         try {
1062             final Domain d0 = new BasicDomain( "d0", 0, 8, ( short ) 1, ( short ) 1, 0.1, 1 );
1063             final Domain d1 = new BasicDomain( "d1", 0, 1, ( short ) 1, ( short ) 1, 0.1, 1 );
1064             final Domain d2 = new BasicDomain( "d2", 0, 2, ( short ) 1, ( short ) 1, 0.1, 1 );
1065             final Domain d3 = new BasicDomain( "d3", 7, 8, ( short ) 1, ( short ) 1, 0.1, 1 );
1066             final Domain d4 = new BasicDomain( "d4", 7, 9, ( short ) 1, ( short ) 1, 0.1, 1 );
1067             final Domain d5 = new BasicDomain( "d4", 0, 9, ( short ) 1, ( short ) 1, 0.1, 1 );
1068             final Domain d6 = new BasicDomain( "d4", 4, 5, ( short ) 1, ( short ) 1, 0.1, 1 );
1069             final List<Boolean> covered = new ArrayList<Boolean>();
1070             covered.add( true ); // 0
1071             covered.add( false ); // 1
1072             covered.add( true ); // 2
1073             covered.add( false ); // 3
1074             covered.add( true ); // 4
1075             covered.add( true ); // 5
1076             covered.add( false ); // 6
1077             covered.add( true ); // 7
1078             covered.add( true ); // 8
1079             if ( ForesterUtil.isEngulfed( d0, covered ) ) {
1080                 return false;
1081             }
1082             if ( ForesterUtil.isEngulfed( d1, covered ) ) {
1083                 return false;
1084             }
1085             if ( ForesterUtil.isEngulfed( d2, covered ) ) {
1086                 return false;
1087             }
1088             if ( !ForesterUtil.isEngulfed( d3, covered ) ) {
1089                 return false;
1090             }
1091             if ( ForesterUtil.isEngulfed( d4, covered ) ) {
1092                 return false;
1093             }
1094             if ( ForesterUtil.isEngulfed( d5, covered ) ) {
1095                 return false;
1096             }
1097             if ( !ForesterUtil.isEngulfed( d6, covered ) ) {
1098                 return false;
1099             }
1100             final Domain a = new BasicDomain( "a", 0, 10, ( short ) 1, ( short ) 1, 0.1, 1 );
1101             final Domain b = new BasicDomain( "b", 8, 20, ( short ) 1, ( short ) 1, 0.2, 1 );
1102             final Domain c = new BasicDomain( "c", 15, 16, ( short ) 1, ( short ) 1, 0.3, 1 );
1103             final Protein abc = new BasicProtein( "abc", "nemve", 0 );
1104             abc.addProteinDomain( a );
1105             abc.addProteinDomain( b );
1106             abc.addProteinDomain( c );
1107             final Protein abc_r1 = ForesterUtil.removeOverlappingDomains( 3, false, abc );
1108             final Protein abc_r2 = ForesterUtil.removeOverlappingDomains( 3, true, abc );
1109             if ( abc.getNumberOfProteinDomains() != 3 ) {
1110                 return false;
1111             }
1112             if ( abc_r1.getNumberOfProteinDomains() != 3 ) {
1113                 return false;
1114             }
1115             if ( abc_r2.getNumberOfProteinDomains() != 2 ) {
1116                 return false;
1117             }
1118             if ( !abc_r2.getProteinDomain( 0 ).getDomainId().equals( "a" ) ) {
1119                 return false;
1120             }
1121             if ( !abc_r2.getProteinDomain( 1 ).getDomainId().equals( "b" ) ) {
1122                 return false;
1123             }
1124             final Domain d = new BasicDomain( "d", 0, 10, ( short ) 1, ( short ) 1, 0.1, 1 );
1125             final Domain e = new BasicDomain( "e", 8, 20, ( short ) 1, ( short ) 1, 0.3, 1 );
1126             final Domain f = new BasicDomain( "f", 15, 16, ( short ) 1, ( short ) 1, 0.2, 1 );
1127             final Protein def = new BasicProtein( "def", "nemve", 0 );
1128             def.addProteinDomain( d );
1129             def.addProteinDomain( e );
1130             def.addProteinDomain( f );
1131             final Protein def_r1 = ForesterUtil.removeOverlappingDomains( 5, false, def );
1132             final Protein def_r2 = ForesterUtil.removeOverlappingDomains( 5, true, def );
1133             if ( def.getNumberOfProteinDomains() != 3 ) {
1134                 return false;
1135             }
1136             if ( def_r1.getNumberOfProteinDomains() != 3 ) {
1137                 return false;
1138             }
1139             if ( def_r2.getNumberOfProteinDomains() != 3 ) {
1140                 return false;
1141             }
1142             if ( !def_r2.getProteinDomain( 0 ).getDomainId().equals( "d" ) ) {
1143                 return false;
1144             }
1145             if ( !def_r2.getProteinDomain( 1 ).getDomainId().equals( "f" ) ) {
1146                 return false;
1147             }
1148             if ( !def_r2.getProteinDomain( 2 ).getDomainId().equals( "e" ) ) {
1149                 return false;
1150             }
1151         }
1152         catch ( final Exception e ) {
1153             e.printStackTrace( System.out );
1154             return false;
1155         }
1156         return true;
1157     }
1158
1159     public static final boolean testNHXparsingFromURL2() {
1160         try {
1161             final String s = "https://sites.google.com/site/cmzmasek/home/software/archaeopteryx/examples/simple/simple_1.nh";
1162             final Phylogeny phys[] = AptxUtil.readPhylogeniesFromUrl( new URL( s ),
1163                                                                       false,
1164                                                                       false,
1165                                                                       false,
1166                                                                       TAXONOMY_EXTRACTION.NO,
1167                                                                       false );
1168             if ( ( phys == null ) || ( phys.length != 5 ) ) {
1169                 return false;
1170             }
1171             if ( !phys[ 0 ].toNewHampshire().equals( "((((A,B),C),D),(E,F));" ) ) {
1172                 System.out.println( phys[ 0 ].toNewHampshire() );
1173                 return false;
1174             }
1175             if ( !phys[ 1 ].toNewHampshire().equals( "((1,2,3),(4,5,6),(7,8,9));" ) ) {
1176                 System.out.println( phys[ 1 ].toNewHampshire() );
1177                 return false;
1178             }
1179             final Phylogeny phys2[] = AptxUtil.readPhylogeniesFromUrl( new URL( s ),
1180                                                                        false,
1181                                                                        false,
1182                                                                        false,
1183                                                                        TAXONOMY_EXTRACTION.NO,
1184                                                                        false );
1185             if ( ( phys2 == null ) || ( phys2.length != 5 ) ) {
1186                 return false;
1187             }
1188             if ( !phys2[ 0 ].toNewHampshire().equals( "((((A,B),C),D),(E,F));" ) ) {
1189                 System.out.println( phys2[ 0 ].toNewHampshire() );
1190                 return false;
1191             }
1192             if ( !phys2[ 1 ].toNewHampshire().equals( "((1,2,3),(4,5,6),(7,8,9));" ) ) {
1193                 System.out.println( phys2[ 1 ].toNewHampshire() );
1194                 return false;
1195             }
1196             final Phylogeny phys3[] = AptxUtil.readPhylogeniesFromUrl( new URL( "http://swisstree.vital-it.ch:80/"
1197                     + "SwissTree/ST001/consensus_tree.nhx" ), false, false, false, TAXONOMY_EXTRACTION.NO, false );
1198             if ( ( phys3 == null ) || ( phys3.length != 1 ) ) {
1199                 return false;
1200             }
1201             if ( !phys3[ 0 ]
1202                     .toNewHampshire()
1203                     .equals( "((((POP23a_CIOIN_ENSCING00000016202,POP23b_CIOIN_ENSCING00000016169),POP23_CIOSA_ENSCSAVG00000000248),((POP23a_BRAFL_C3ZMF1,POP23b_BRAFL_121417),(((POP3_ORYLA_ENSORLG00000019669,POP3_GASAC_ENSGACG00000014023,POP3_DANRE_Q6JWW1),(POP3_XENTR_B1H1F6,(POP3_CHICK_Q9DG25,(POP3_ORNAN_ENSOANG00000004179,POP3_MONDO_ENSMODG00000018033,((POP3_MOUSE_Q9ES81,POP3_RAT_Q3BCU3),POP3_RABIT_ENSOCUG00000025973,POP3_MACMU_ENSMMUG00000014473,POP3_HUMAN_Q9HBV1))))),(((POP2_GASAC_ENSGACG00000001420,POP2_ORYLA_ENSORLG00000008627,POP2_TAKRU_ENSTRUG00000015933),POP2_DANRE_ENSDARG00000069922),POP2_XENTR_ENSXETG00000018064,(((POP2_TAEGU_ENSTGUG00000013383,POP2_CHICK_Q6T9Z5),POP2_ANOCA_ENSACAG00000003557),((POP2_MACEU_ENSMEUG00000015825,POP2_MONDO_ENSMODG00000018205),((POP2_RABIT_ENSOCUG00000009515,(POP2_RAT_Q6P722,POP2_MOUSE_Q9ES82)),(POP2_MACMU_ENSMMUG00000000905,POP2_HUMAN_Q9HBU9)))))))),((POP1_CIOSA_ENSCSAVG00000000247,POP1_CIOIN_ENSCING00000000496),((POP1_DANRE_Q5PQZ7,(POP1_ORYLA_ENSORLG00000019663,POP1_GASAC_ENSGACG00000014015,POP1_TAKRU_ENSORLG00000019663)),(POP1_XENTR_B1H1G2,(POP1_ANOCA_ENSACAG00000003910,(POP1_TAEGU_ENSTGUG00000012218,POP1_CHICK_Q9DG23)),POP1_ORNAN_ENSOANG00000004180,POP1_MONDO_ENSMODG00000018034,(POP1_RABIT_ENSOCUG00000016944,(POP1_RAT_Q3BCU4,POP1_MOUSE_Q9ES83),(POP1_HUMAN_Q8NE79,POP1_MACMU_ENSMMUG00000014471))))));" ) ) {
1204                 System.out.println( phys3[ 0 ].toNewHampshire() );
1205                 return false;
1206             }
1207             final Phylogeny phys4[] = AptxUtil.readPhylogeniesFromUrl( new URL( "http://swisstree.vital-it.ch:80/"
1208                     + "SwissTree/ST001/consensus_tree.nhx" ), false, false, false, TAXONOMY_EXTRACTION.NO, false );
1209             if ( ( phys4 == null ) || ( phys4.length != 1 ) ) {
1210                 return false;
1211             }
1212             if ( !phys4[ 0 ]
1213                     .toNewHampshire()
1214                     .equals( "((((POP23a_CIOIN_ENSCING00000016202,POP23b_CIOIN_ENSCING00000016169),POP23_CIOSA_ENSCSAVG00000000248),((POP23a_BRAFL_C3ZMF1,POP23b_BRAFL_121417),(((POP3_ORYLA_ENSORLG00000019669,POP3_GASAC_ENSGACG00000014023,POP3_DANRE_Q6JWW1),(POP3_XENTR_B1H1F6,(POP3_CHICK_Q9DG25,(POP3_ORNAN_ENSOANG00000004179,POP3_MONDO_ENSMODG00000018033,((POP3_MOUSE_Q9ES81,POP3_RAT_Q3BCU3),POP3_RABIT_ENSOCUG00000025973,POP3_MACMU_ENSMMUG00000014473,POP3_HUMAN_Q9HBV1))))),(((POP2_GASAC_ENSGACG00000001420,POP2_ORYLA_ENSORLG00000008627,POP2_TAKRU_ENSTRUG00000015933),POP2_DANRE_ENSDARG00000069922),POP2_XENTR_ENSXETG00000018064,(((POP2_TAEGU_ENSTGUG00000013383,POP2_CHICK_Q6T9Z5),POP2_ANOCA_ENSACAG00000003557),((POP2_MACEU_ENSMEUG00000015825,POP2_MONDO_ENSMODG00000018205),((POP2_RABIT_ENSOCUG00000009515,(POP2_RAT_Q6P722,POP2_MOUSE_Q9ES82)),(POP2_MACMU_ENSMMUG00000000905,POP2_HUMAN_Q9HBU9)))))))),((POP1_CIOSA_ENSCSAVG00000000247,POP1_CIOIN_ENSCING00000000496),((POP1_DANRE_Q5PQZ7,(POP1_ORYLA_ENSORLG00000019663,POP1_GASAC_ENSGACG00000014015,POP1_TAKRU_ENSORLG00000019663)),(POP1_XENTR_B1H1G2,(POP1_ANOCA_ENSACAG00000003910,(POP1_TAEGU_ENSTGUG00000012218,POP1_CHICK_Q9DG23)),POP1_ORNAN_ENSOANG00000004180,POP1_MONDO_ENSMODG00000018034,(POP1_RABIT_ENSOCUG00000016944,(POP1_RAT_Q3BCU4,POP1_MOUSE_Q9ES83),(POP1_HUMAN_Q8NE79,POP1_MACMU_ENSMMUG00000014471))))));" ) ) {
1215                 System.out.println( phys4[ 0 ].toNewHampshire() );
1216                 return false;
1217             }
1218         }
1219         catch ( final Exception e ) {
1220             e.printStackTrace();
1221             return false;
1222         }
1223         return true;
1224     }
1225
1226     public static final boolean testNHXparsingFromURL() {
1227         try {
1228             final String s = "https://sites.google.com/site/cmzmasek/home/software/archaeopteryx/examples/simple/simple_1.nh";
1229             final URL u = new URL( s );
1230             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
1231             final Phylogeny[] phys = factory.create( u, new NHXParser() );
1232             if ( ( phys == null ) || ( phys.length != 5 ) ) {
1233                 return false;
1234             }
1235             if ( !phys[ 0 ].toNewHampshire().equals( "((((A,B),C),D),(E,F));" ) ) {
1236                 System.out.println( phys[ 0 ].toNewHampshire() );
1237                 return false;
1238             }
1239             if ( !phys[ 1 ].toNewHampshire().equals( "((1,2,3),(4,5,6),(7,8,9));" ) ) {
1240                 System.out.println( phys[ 1 ].toNewHampshire() );
1241                 return false;
1242             }
1243             final URL u2 = new URL( s );
1244             final Phylogeny[] phys2 = factory.create( u2.openStream(), new NHXParser() );
1245             if ( ( phys2 == null ) || ( phys2.length != 5 ) ) {
1246                 return false;
1247             }
1248             if ( !phys2[ 0 ].toNewHampshire().equals( "((((A,B),C),D),(E,F));" ) ) {
1249                 System.out.println( phys2[ 0 ].toNewHampshire() );
1250                 return false;
1251             }
1252             final PhylogenyFactory factory2 = ParserBasedPhylogenyFactory.getInstance();
1253             final NHXParser p = new NHXParser();
1254             final URL u3 = new URL( s );
1255             p.setSource( u3 );
1256             if ( !p.hasNext() ) {
1257                 return false;
1258             }
1259             if ( !p.next().toNewHampshire().equals( "((((A,B),C),D),(E,F));" ) ) {
1260                 return false;
1261             }
1262             if ( !p.hasNext() ) {
1263                 return false;
1264             }
1265             p.reset();
1266             if ( !p.hasNext() ) {
1267                 return false;
1268             }
1269             if ( !p.next().toNewHampshire().equals( "((((A,B),C),D),(E,F));" ) ) {
1270                 return false;
1271             }
1272             if ( !p.next().toNewHampshire().equals( "((1,2,3),(4,5,6),(7,8,9));" ) ) {
1273                 return false;
1274             }
1275             p.reset();
1276             if ( !p.hasNext() ) {
1277                 return false;
1278             }
1279             if ( !p.next().toNewHampshire().equals( "((((A,B),C),D),(E,F));" ) ) {
1280                 return false;
1281             }
1282             if ( !p.next().toNewHampshire().equals( "((1,2,3),(4,5,6),(7,8,9));" ) ) {
1283                 return false;
1284             }
1285         }
1286         catch ( final Exception e ) {
1287             System.out.println( e.toString() );
1288             e.printStackTrace();
1289             return false;
1290         }
1291         return true;
1292     }
1293
1294     public static boolean testOverlapRemoval() {
1295         try {
1296             final Domain d0 = new BasicDomain( "d0", ( short ) 2, ( short ) 5, ( short ) 1, ( short ) 1, 0.1, 1 );
1297             final Domain d1 = new BasicDomain( "d1", ( short ) 7, ( short ) 10, ( short ) 1, ( short ) 1, 0.1, 1 );
1298             final Domain d2 = new BasicDomain( "d2", ( short ) 0, ( short ) 20, ( short ) 1, ( short ) 1, 0.1, 1 );
1299             final Domain d3 = new BasicDomain( "d3", ( short ) 9, ( short ) 10, ( short ) 1, ( short ) 1, 0.1, 1 );
1300             final Domain d4 = new BasicDomain( "d4", ( short ) 7, ( short ) 8, ( short ) 1, ( short ) 1, 0.1, 1 );
1301             final List<Boolean> covered = new ArrayList<Boolean>();
1302             covered.add( true ); // 0
1303             covered.add( false ); // 1
1304             covered.add( true ); // 2
1305             covered.add( false ); // 3
1306             covered.add( true ); // 4
1307             covered.add( true ); // 5
1308             covered.add( false ); // 6
1309             covered.add( true ); // 7
1310             covered.add( true ); // 8
1311             if ( ForesterUtil.calculateOverlap( d0, covered ) != 3 ) {
1312                 return false;
1313             }
1314             if ( ForesterUtil.calculateOverlap( d1, covered ) != 2 ) {
1315                 return false;
1316             }
1317             if ( ForesterUtil.calculateOverlap( d2, covered ) != 6 ) {
1318                 return false;
1319             }
1320             if ( ForesterUtil.calculateOverlap( d3, covered ) != 0 ) {
1321                 return false;
1322             }
1323             if ( ForesterUtil.calculateOverlap( d4, covered ) != 2 ) {
1324                 return false;
1325             }
1326             final Domain a = new BasicDomain( "a", ( short ) 2, ( short ) 5, ( short ) 1, ( short ) 1, 1, -1 );
1327             final Domain b = new BasicDomain( "b", ( short ) 2, ( short ) 10, ( short ) 1, ( short ) 1, 0.1, -1 );
1328             final Protein ab = new BasicProtein( "ab", "varanus", 0 );
1329             ab.addProteinDomain( a );
1330             ab.addProteinDomain( b );
1331             final Protein ab_s0 = ForesterUtil.removeOverlappingDomains( 3, false, ab );
1332             if ( ab.getNumberOfProteinDomains() != 2 ) {
1333                 return false;
1334             }
1335             if ( ab_s0.getNumberOfProteinDomains() != 1 ) {
1336                 return false;
1337             }
1338             if ( !ab_s0.getProteinDomain( 0 ).getDomainId().equals( "b" ) ) {
1339                 return false;
1340             }
1341             final Protein ab_s1 = ForesterUtil.removeOverlappingDomains( 4, false, ab );
1342             if ( ab.getNumberOfProteinDomains() != 2 ) {
1343                 return false;
1344             }
1345             if ( ab_s1.getNumberOfProteinDomains() != 2 ) {
1346                 return false;
1347             }
1348             final Domain c = new BasicDomain( "c", ( short ) 20000, ( short ) 20500, ( short ) 1, ( short ) 1, 10, 1 );
1349             final Domain d = new BasicDomain( "d",
1350                                               ( short ) 10000,
1351                                               ( short ) 10500,
1352                                               ( short ) 1,
1353                                               ( short ) 1,
1354                                               0.0000001,
1355                                               1 );
1356             final Domain e = new BasicDomain( "e", ( short ) 5000, ( short ) 5500, ( short ) 1, ( short ) 1, 0.0001, 1 );
1357             final Protein cde = new BasicProtein( "cde", "varanus", 0 );
1358             cde.addProteinDomain( c );
1359             cde.addProteinDomain( d );
1360             cde.addProteinDomain( e );
1361             final Protein cde_s0 = ForesterUtil.removeOverlappingDomains( 0, false, cde );
1362             if ( cde.getNumberOfProteinDomains() != 3 ) {
1363                 return false;
1364             }
1365             if ( cde_s0.getNumberOfProteinDomains() != 3 ) {
1366                 return false;
1367             }
1368             final Domain f = new BasicDomain( "f", ( short ) 10, ( short ) 20, ( short ) 1, ( short ) 1, 10, 1 );
1369             final Domain g = new BasicDomain( "g", ( short ) 10, ( short ) 20, ( short ) 1, ( short ) 1, 0.01, 1 );
1370             final Domain h = new BasicDomain( "h", ( short ) 10, ( short ) 20, ( short ) 1, ( short ) 1, 0.0001, 1 );
1371             final Domain i = new BasicDomain( "i", ( short ) 10, ( short ) 20, ( short ) 1, ( short ) 1, 0.5, 1 );
1372             final Domain i2 = new BasicDomain( "i", ( short ) 5, ( short ) 30, ( short ) 1, ( short ) 1, 0.5, 10 );
1373             final Protein fghi = new BasicProtein( "fghi", "varanus", 0 );
1374             fghi.addProteinDomain( f );
1375             fghi.addProteinDomain( g );
1376             fghi.addProteinDomain( h );
1377             fghi.addProteinDomain( i );
1378             fghi.addProteinDomain( i );
1379             fghi.addProteinDomain( i );
1380             fghi.addProteinDomain( i2 );
1381             final Protein fghi_s0 = ForesterUtil.removeOverlappingDomains( 10, false, fghi );
1382             if ( fghi.getNumberOfProteinDomains() != 7 ) {
1383                 return false;
1384             }
1385             if ( fghi_s0.getNumberOfProteinDomains() != 1 ) {
1386                 return false;
1387             }
1388             if ( !fghi_s0.getProteinDomain( 0 ).getDomainId().equals( "h" ) ) {
1389                 return false;
1390             }
1391             final Protein fghi_s1 = ForesterUtil.removeOverlappingDomains( 11, false, fghi );
1392             if ( fghi.getNumberOfProteinDomains() != 7 ) {
1393                 return false;
1394             }
1395             if ( fghi_s1.getNumberOfProteinDomains() != 7 ) {
1396                 return false;
1397             }
1398             final Domain j = new BasicDomain( "j", ( short ) 10, ( short ) 20, ( short ) 1, ( short ) 1, 10, 1 );
1399             final Domain k = new BasicDomain( "k", ( short ) 10, ( short ) 20, ( short ) 1, ( short ) 1, 0.01, 1 );
1400             final Domain l = new BasicDomain( "l", ( short ) 10, ( short ) 20, ( short ) 1, ( short ) 1, 0.0001, 1 );
1401             final Domain m = new BasicDomain( "m", ( short ) 10, ( short ) 20, ( short ) 1, ( short ) 4, 0.5, 1 );
1402             final Domain m0 = new BasicDomain( "m", ( short ) 10, ( short ) 20, ( short ) 2, ( short ) 4, 0.5, 1 );
1403             final Domain m1 = new BasicDomain( "m", ( short ) 10, ( short ) 20, ( short ) 3, ( short ) 4, 0.5, 1 );
1404             final Domain m2 = new BasicDomain( "m", ( short ) 5, ( short ) 30, ( short ) 4, ( short ) 4, 0.5, 10 );
1405             final Protein jklm = new BasicProtein( "jklm", "varanus", 0 );
1406             jklm.addProteinDomain( j );
1407             jklm.addProteinDomain( k );
1408             jklm.addProteinDomain( l );
1409             jklm.addProteinDomain( m );
1410             jklm.addProteinDomain( m0 );
1411             jklm.addProteinDomain( m1 );
1412             jklm.addProteinDomain( m2 );
1413             final Protein jklm_s0 = ForesterUtil.removeOverlappingDomains( 10, false, jklm );
1414             if ( jklm.getNumberOfProteinDomains() != 7 ) {
1415                 return false;
1416             }
1417             if ( jklm_s0.getNumberOfProteinDomains() != 1 ) {
1418                 return false;
1419             }
1420             if ( !jklm_s0.getProteinDomain( 0 ).getDomainId().equals( "l" ) ) {
1421                 return false;
1422             }
1423             final Protein jklm_s1 = ForesterUtil.removeOverlappingDomains( 11, false, jklm );
1424             if ( jklm.getNumberOfProteinDomains() != 7 ) {
1425                 return false;
1426             }
1427             if ( jklm_s1.getNumberOfProteinDomains() != 7 ) {
1428                 return false;
1429             }
1430             final Domain only = new BasicDomain( "only", ( short ) 5, ( short ) 30, ( short ) 4, ( short ) 4, 0.5, 10 );
1431             final Protein od = new BasicProtein( "od", "varanus", 0 );
1432             od.addProteinDomain( only );
1433             final Protein od_s0 = ForesterUtil.removeOverlappingDomains( 0, false, od );
1434             if ( od.getNumberOfProteinDomains() != 1 ) {
1435                 return false;
1436             }
1437             if ( od_s0.getNumberOfProteinDomains() != 1 ) {
1438                 return false;
1439             }
1440         }
1441         catch ( final Exception e ) {
1442             e.printStackTrace( System.out );
1443             return false;
1444         }
1445         return true;
1446     }
1447
1448     public static final boolean testPfamTreeReading() {
1449         try {
1450             final URL u = new URL( WebserviceUtil.PFAM_SERVER + "/family/PF" + "01849" + "/tree/download" );
1451             final NHXParser parser = new NHXParser();
1452             parser.setTaxonomyExtraction( NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
1453             parser.setReplaceUnderscores( false );
1454             parser.setGuessRootedness( true );
1455             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
1456             final Phylogeny[] phys = factory.create( u.openStream(), parser );
1457             if ( ( phys == null ) || ( phys.length != 1 ) ) {
1458                 return false;
1459             }
1460             if ( phys[ 0 ].getNumberOfExternalNodes() < 10 ) {
1461                 return false;
1462             }
1463         }
1464         catch ( final Exception e ) {
1465             e.printStackTrace();
1466         }
1467         return true;
1468     }
1469
1470     public static final boolean testPhyloXMLparsingFromURL() {
1471         try {
1472             final String s = "https://sites.google.com/site/cmzmasek/home/software/archaeopteryx/examples/archaeopteryx_a/apaf_bcl2.xml";
1473             final URL u = new URL( s );
1474             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
1475             final Phylogeny[] phys = factory.create( u.openStream(), PhyloXmlParser.createPhyloXmlParser() );
1476             if ( ( phys == null ) || ( phys.length != 2 ) ) {
1477                 return false;
1478             }
1479         }
1480         catch ( final Exception e ) {
1481             e.printStackTrace();
1482         }
1483         return true;
1484     }
1485
1486     public static final boolean testToLReading() {
1487         try {
1488             final URL u = new URL( WebserviceUtil.TOL_URL_BASE + "15079" );
1489             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
1490             final Phylogeny[] phys = factory.create( u.openStream(), new TolParser() );
1491             if ( ( phys == null ) || ( phys.length != 1 ) ) {
1492                 return false;
1493             }
1494             if ( !phys[ 0 ].getRoot().getNodeData().getTaxonomy().getIdentifier().getValue().equals( "15079" ) ) {
1495                 return false;
1496             }
1497             if ( !phys[ 0 ].getRoot().getNodeData().getTaxonomy().getScientificName().equals( "Protacanthopterygii" ) ) {
1498                 return false;
1499             }
1500             if ( phys[ 0 ].getNumberOfExternalNodes() < 5 ) {
1501                 return false;
1502             }
1503         }
1504         catch ( final Exception e ) {
1505             e.printStackTrace();
1506         }
1507         return true;
1508     }
1509
1510     public static final boolean testTreeBaseReading() {
1511         try {
1512             final URL u = new URL( WebserviceUtil.TREEBASE_PHYLOWS_TREE_URL_BASE + "825?format=nexus" );
1513             final NexusPhylogeniesParser parser = new NexusPhylogeniesParser();
1514             parser.setReplaceUnderscores( true );
1515             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
1516             final Phylogeny[] phys = factory.create( u.openStream(), parser );
1517             if ( ( phys == null ) || ( phys.length != 1 ) ) {
1518                 return false;
1519             }
1520             final URL u2 = new URL( WebserviceUtil.TREEBASE_PHYLOWS_STUDY_URL_BASE + "15613?format=nexus" );
1521             final NexusPhylogeniesParser parser2 = new NexusPhylogeniesParser();
1522             parser2.setReplaceUnderscores( true );
1523             final PhylogenyFactory factory2 = ParserBasedPhylogenyFactory.getInstance();
1524             final Phylogeny[] phys2 = factory2.create( u2.openStream(), parser2 );
1525             if ( ( phys2 == null ) || ( phys2.length != 9 ) ) {
1526                 return false;
1527             }
1528         }
1529         catch ( final Exception e ) {
1530             e.printStackTrace();
1531         }
1532         return true;
1533     }
1534
1535     public static final boolean testTreeFamReading() {
1536         try {
1537             final URL u = new URL( WebserviceUtil.TREE_FAM_URL_BASE + "101004" + "/tree/newick" );
1538             final NHXParser parser = new NHXParser();
1539             parser.setTaxonomyExtraction( NHXParser.TAXONOMY_EXTRACTION.NO );
1540             parser.setReplaceUnderscores( false );
1541             parser.setGuessRootedness( true );
1542             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
1543             final Phylogeny[] phys = factory.create( u.openStream(), parser );
1544             if ( ( phys == null ) || ( phys.length != 1 ) ) {
1545                 return false;
1546             }
1547             if ( phys[ 0 ].getNumberOfExternalNodes() < 10 ) {
1548                 return false;
1549             }
1550         }
1551         catch ( final Exception e ) {
1552             e.printStackTrace();
1553         }
1554         return true;
1555     }
1556
1557     private final static Phylogeny createPhylogeny( final String nhx ) throws IOException {
1558         final Phylogeny p = ParserBasedPhylogenyFactory.getInstance().create( nhx, new NHXParser() )[ 0 ];
1559         return p;
1560     }
1561
1562     private final static Event getEvent( final Phylogeny p, final String n1, final String n2 ) {
1563         return PhylogenyMethods.calculateLCA( p.getNode( n1 ), p.getNode( n2 ) ).getNodeData().getEvent();
1564     }
1565
1566     private static boolean testAminoAcidSequence() {
1567         try {
1568             final MolecularSequence aa1 = BasicSequence.createAaSequence( "aa1", "aAklm-?xX*z$#" );
1569             if ( aa1.getLength() != 13 ) {
1570                 return false;
1571             }
1572             if ( aa1.getResidueAt( 0 ) != 'A' ) {
1573                 return false;
1574             }
1575             if ( aa1.getResidueAt( 2 ) != 'K' ) {
1576                 return false;
1577             }
1578             if ( !new String( aa1.getMolecularSequence() ).equals( "AAKLM-XXX*ZXX" ) ) {
1579                 return false;
1580             }
1581             final MolecularSequence aa2 = BasicSequence.createAaSequence( "aa3", "ARNDCQEGHILKMFPSTWYVX*-BZOJU" );
1582             if ( !new String( aa2.getMolecularSequence() ).equals( "ARNDCQEGHILKMFPSTWYVX*-BZOXU" ) ) {
1583                 return false;
1584             }
1585             final MolecularSequence dna1 = BasicSequence.createDnaSequence( "dna1", "ACGTUX*-?RYMKWSN" );
1586             if ( !new String( dna1.getMolecularSequence() ).equals( "ACGTNN*-NRYMKWSN" ) ) {
1587                 return false;
1588             }
1589             final MolecularSequence rna1 = BasicSequence.createRnaSequence( "rna1", "..ACGUTX*-?RYMKWSN" );
1590             if ( !new String( rna1.getMolecularSequence() ).equals( "--ACGUNN*-NRYMKWSN" ) ) {
1591                 return false;
1592             }
1593         }
1594         catch ( final Exception e ) {
1595             e.printStackTrace();
1596             return false;
1597         }
1598         return true;
1599     }
1600
1601     private static boolean testBasicDomain() {
1602         try {
1603             final Domain pd = new BasicDomain( "id", 23, 25, ( short ) 1, ( short ) 4, 0.1, -12 );
1604             if ( !pd.getDomainId().equals( "id" ) ) {
1605                 return false;
1606             }
1607             if ( pd.getNumber() != 1 ) {
1608                 return false;
1609             }
1610             if ( pd.getTotalCount() != 4 ) {
1611                 return false;
1612             }
1613             if ( !pd.equals( new BasicDomain( "id", 22, 111, ( short ) 1, ( short ) 4, 0.2, -12 ) ) ) {
1614                 return false;
1615             }
1616             final Domain a1 = new BasicDomain( "a", 1, 10, ( short ) 1, ( short ) 4, 0.1, -12 );
1617             final BasicDomain a1_copy = new BasicDomain( "a", 1, 10, ( short ) 1, ( short ) 4, 0.1, -12 );
1618             final BasicDomain a1_equal = new BasicDomain( "a", 524, 743994, ( short ) 1, ( short ) 300, 3.0005, 230 );
1619             final BasicDomain a2 = new BasicDomain( "a", 1, 10, ( short ) 2, ( short ) 4, 0.1, -12 );
1620             final BasicDomain a3 = new BasicDomain( "A", 1, 10, ( short ) 1, ( short ) 4, 0.1, -12 );
1621             if ( !a1.equals( a1 ) ) {
1622                 return false;
1623             }
1624             if ( !a1.equals( a1_copy ) ) {
1625                 return false;
1626             }
1627             if ( !a1.equals( a1_equal ) ) {
1628                 return false;
1629             }
1630             if ( !a1.equals( a2 ) ) {
1631                 return false;
1632             }
1633             if ( a1.equals( a3 ) ) {
1634                 return false;
1635             }
1636             if ( a1.compareTo( a1 ) != 0 ) {
1637                 return false;
1638             }
1639             if ( a1.compareTo( a1_copy ) != 0 ) {
1640                 return false;
1641             }
1642             if ( a1.compareTo( a1_equal ) != 0 ) {
1643                 return false;
1644             }
1645             if ( a1.compareTo( a2 ) != 0 ) {
1646                 return false;
1647             }
1648             if ( a1.compareTo( a3 ) == 0 ) {
1649                 return false;
1650             }
1651         }
1652         catch ( final Exception e ) {
1653             e.printStackTrace( System.out );
1654             return false;
1655         }
1656         return true;
1657     }
1658
1659     private static boolean testBasicNodeMethods() {
1660         try {
1661             if ( PhylogenyNode.getNodeCount() != 0 ) {
1662                 return false;
1663             }
1664             final PhylogenyNode n1 = new PhylogenyNode();
1665             final PhylogenyNode n2 = PhylogenyNode
1666                     .createInstanceFromNhxString( "", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
1667             final PhylogenyNode n3 = PhylogenyNode
1668                     .createInstanceFromNhxString( "n3", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
1669             final PhylogenyNode n4 = PhylogenyNode
1670                     .createInstanceFromNhxString( "n4:0.01", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
1671             if ( n1.isHasAssignedEvent() ) {
1672                 return false;
1673             }
1674             if ( PhylogenyNode.getNodeCount() != 4 ) {
1675                 return false;
1676             }
1677             if ( n3.getIndicator() != 0 ) {
1678                 return false;
1679             }
1680             if ( n3.getNumberOfExternalNodes() != 1 ) {
1681                 return false;
1682             }
1683             if ( !n3.isExternal() ) {
1684                 return false;
1685             }
1686             if ( !n3.isRoot() ) {
1687                 return false;
1688             }
1689             if ( !n4.getName().equals( "n4" ) ) {
1690                 return false;
1691             }
1692         }
1693         catch ( final Exception e ) {
1694             e.printStackTrace( System.out );
1695             return false;
1696         }
1697         return true;
1698     }
1699
1700     private static boolean testBasicPhyloXMLparsing() {
1701         try {
1702             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
1703             final PhyloXmlParser xml_parser = PhyloXmlParser.createPhyloXmlParser();
1704             final Phylogeny[] phylogenies_0 = factory.create( Test.PATH_TO_TEST_DATA + "phyloxml_test_t1.xml",
1705                                                               xml_parser );
1706             if ( xml_parser.getErrorCount() > 0 ) {
1707                 System.out.println( xml_parser.getErrorMessages().toString() );
1708                 return false;
1709             }
1710             if ( phylogenies_0.length != 4 ) {
1711                 return false;
1712             }
1713             final Phylogeny t1 = phylogenies_0[ 0 ];
1714             final Phylogeny t2 = phylogenies_0[ 1 ];
1715             final Phylogeny t3 = phylogenies_0[ 2 ];
1716             final Phylogeny t4 = phylogenies_0[ 3 ];
1717             if ( t1.getNumberOfExternalNodes() != 1 ) {
1718                 return false;
1719             }
1720             if ( !t1.isRooted() ) {
1721                 return false;
1722             }
1723             if ( t1.isRerootable() ) {
1724                 return false;
1725             }
1726             if ( !t1.getType().equals( "gene_tree" ) ) {
1727                 return false;
1728             }
1729             if ( t2.getNumberOfExternalNodes() != 2 ) {
1730                 return false;
1731             }
1732             if ( !isEqual( t2.getNode( "node a" ).getDistanceToParent(), 1.0 ) ) {
1733                 return false;
1734             }
1735             if ( !isEqual( t2.getNode( "node b" ).getDistanceToParent(), 2.0 ) ) {
1736                 return false;
1737             }
1738             if ( t2.getNode( "node a" ).getNodeData().getTaxonomies().size() != 2 ) {
1739                 return false;
1740             }
1741             if ( !t2.getNode( "node a" ).getNodeData().getTaxonomy( 0 ).getCommonName().equals( "some parasite" ) ) {
1742                 return false;
1743             }
1744             if ( !t2.getNode( "node a" ).getNodeData().getTaxonomy( 1 ).getCommonName().equals( "the host" ) ) {
1745                 return false;
1746             }
1747             if ( t2.getNode( "node a" ).getNodeData().getSequences().size() != 2 ) {
1748                 return false;
1749             }
1750             if ( !t2.getNode( "node a" ).getNodeData().getSequence( 0 ).getMolecularSequence()
1751                     .startsWith( "actgtgggggt" ) ) {
1752                 return false;
1753             }
1754             if ( !t2.getNode( "node a" ).getNodeData().getSequence( 1 ).getMolecularSequence()
1755                     .startsWith( "ctgtgatgcat" ) ) {
1756                 return false;
1757             }
1758             if ( t3.getNumberOfExternalNodes() != 4 ) {
1759                 return false;
1760             }
1761             if ( !t1.getName().equals( "t1" ) ) {
1762                 return false;
1763             }
1764             if ( !t2.getName().equals( "t2" ) ) {
1765                 return false;
1766             }
1767             if ( !t3.getName().equals( "t3" ) ) {
1768                 return false;
1769             }
1770             if ( !t4.getName().equals( "t4" ) ) {
1771                 return false;
1772             }
1773             if ( !t3.getIdentifier().getValue().equals( "1-1" ) ) {
1774                 return false;
1775             }
1776             if ( !t3.getIdentifier().getProvider().equals( "treebank" ) ) {
1777                 return false;
1778             }
1779             if ( !t3.getNode( "root node" ).isDuplication() ) {
1780                 return false;
1781             }
1782             if ( !t3.getNode( "node a" ).isDuplication() ) {
1783                 return false;
1784             }
1785             if ( t3.getNode( "node a" ).isSpeciation() ) {
1786                 return false;
1787             }
1788             if ( t3.getNode( "node bc" ).isDuplication() ) {
1789                 return false;
1790             }
1791             if ( !t3.getNode( "node bc" ).isSpeciation() ) {
1792                 return false;
1793             }
1794             if ( !t3.getNode( "root node" ).getNodeData().getSequence().getType().equals( "protein" ) ) {
1795                 return false;
1796             }
1797             if ( !t3.getNode( "root node" ).getNodeData().getSequence().getName()
1798                     .equals( "Apoptosis facilitator Bcl-2-like 14 protein" ) ) {
1799                 return false;
1800             }
1801             if ( !t3.getNode( "root node" ).getNodeData().getSequence().getSymbol().equals( "BCL2L14" ) ) {
1802                 return false;
1803             }
1804             if ( !t3.getNode( "root node" ).getNodeData().getSequence().getAccession().getValue().equals( "Q9BZR8" ) ) {
1805                 return false;
1806             }
1807             if ( !t3.getNode( "root node" ).getNodeData().getSequence().getAccession().getSource().equals( "UniProtKB" ) ) {
1808                 return false;
1809             }
1810             if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getDesc()
1811                     .equals( "apoptosis" ) ) {
1812                 return false;
1813             }
1814             if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getRef()
1815                     .equals( "GO:0006915" ) ) {
1816                 return false;
1817             }
1818             if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getSource()
1819                     .equals( "UniProtKB" ) ) {
1820                 return false;
1821             }
1822             if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getEvidence()
1823                     .equals( "experimental" ) ) {
1824                 return false;
1825             }
1826             if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getType()
1827                     .equals( "function" ) ) {
1828                 return false;
1829             }
1830             if ( ( t3.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getConfidence()
1831                     .getValue() != 1 ) {
1832                 return false;
1833             }
1834             if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getConfidence()
1835                     .getType().equals( "ml" ) ) {
1836                 return false;
1837             }
1838             if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getDesc()
1839                     .equals( "apoptosis" ) ) {
1840                 return false;
1841             }
1842             if ( ( t3.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getProperties()
1843                     .getProperty( "AFFY:expression" ).getAppliesTo() != AppliesTo.ANNOTATION ) {
1844                 return false;
1845             }
1846             if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getProperties()
1847                     .getProperty( "AFFY:expression" ).getDataType().equals( "xsd:double" ) ) {
1848                 return false;
1849             }
1850             if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getProperties()
1851                     .getProperty( "AFFY:expression" ).getRef().equals( "AFFY:expression" ) ) {
1852                 return false;
1853             }
1854             if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getProperties()
1855                     .getProperty( "AFFY:expression" ).getUnit().equals( "AFFY:x" ) ) {
1856                 return false;
1857             }
1858             if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getProperties()
1859                     .getProperty( "AFFY:expression" ).getValue().equals( "0.2" ) ) {
1860                 return false;
1861             }
1862             if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getProperties()
1863                     .getProperty( "MED:disease" ).getValue().equals( "lymphoma" ) ) {
1864                 return false;
1865             }
1866             if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 1 ) ).getRef()
1867                     .equals( "GO:0005829" ) ) {
1868                 return false;
1869             }
1870             if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 0 ) ).getDesc()
1871                     .equals( "intracellular organelle" ) ) {
1872                 return false;
1873             }
1874             if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getUri( 0 ).getType().equals( "source" ) ) ) {
1875                 return false;
1876             }
1877             if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getUri( 0 ).getDescription()
1878                     .equals( "UniProt link" ) ) ) {
1879                 return false;
1880             }
1881             if ( !( t3.getNode( "root node" ).getNodeData().getSequence().getLocation().equals( "12p13-p12" ) ) ) {
1882                 return false;
1883             }
1884             final SortedSet<Accession> x = t3.getNode( "root node" ).getNodeData().getSequence().getCrossReferences();
1885             if ( x.size() != 4 ) {
1886                 return false;
1887             }
1888             int c = 0;
1889             for( final Accession acc : x ) {
1890                 if ( c == 0 ) {
1891                     if ( !acc.getSource().equals( "KEGG" ) ) {
1892                         return false;
1893                     }
1894                     if ( !acc.getValue().equals( "hsa:596" ) ) {
1895                         return false;
1896                     }
1897                 }
1898                 c++;
1899             }
1900         }
1901         catch ( final Exception e ) {
1902             e.printStackTrace( System.out );
1903             return false;
1904         }
1905         return true;
1906     }
1907
1908     private static boolean testBasicPhyloXMLparsingRoundtrip() {
1909         try {
1910             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
1911             final PhyloXmlParser xml_parser = PhyloXmlParser.createPhyloXmlParser();
1912             if ( USE_LOCAL_PHYLOXML_SCHEMA ) {
1913                 xml_parser.setValidateAgainstSchema( PHYLOXML_LOCAL_XSD );
1914             }
1915             else {
1916                 xml_parser.setValidateAgainstSchema( PHYLOXML_REMOTE_XSD );
1917             }
1918             final Phylogeny[] phylogenies_0 = factory.create( Test.PATH_TO_TEST_DATA + "phyloxml_test_t1.xml",
1919                                                               xml_parser );
1920             if ( xml_parser.getErrorCount() > 0 ) {
1921                 System.out.println( xml_parser.getErrorMessages().toString() );
1922                 return false;
1923             }
1924             if ( phylogenies_0.length != 4 ) {
1925                 return false;
1926             }
1927             final StringBuffer t1_sb = new StringBuffer( phylogenies_0[ 0 ].toPhyloXML( 0 ) );
1928             final Phylogeny[] phylogenies_t1 = factory.create( t1_sb, xml_parser );
1929             if ( phylogenies_t1.length != 1 ) {
1930                 return false;
1931             }
1932             final Phylogeny t1_rt = phylogenies_t1[ 0 ];
1933             if ( !t1_rt.getDistanceUnit().equals( "cc" ) ) {
1934                 return false;
1935             }
1936             if ( !t1_rt.isRooted() ) {
1937                 return false;
1938             }
1939             if ( t1_rt.isRerootable() ) {
1940                 return false;
1941             }
1942             if ( !t1_rt.getType().equals( "gene_tree" ) ) {
1943                 return false;
1944             }
1945             final StringBuffer t2_sb = new StringBuffer( phylogenies_0[ 1 ].toPhyloXML( 0 ) );
1946             final Phylogeny[] phylogenies_t2 = factory.create( t2_sb, xml_parser );
1947             final Phylogeny t2_rt = phylogenies_t2[ 0 ];
1948             if ( t2_rt.getNode( "node a" ).getNodeData().getTaxonomies().size() != 2 ) {
1949                 return false;
1950             }
1951             if ( !t2_rt.getNode( "node a" ).getNodeData().getTaxonomy( 0 ).getCommonName().equals( "some parasite" ) ) {
1952                 return false;
1953             }
1954             if ( !t2_rt.getNode( "node a" ).getNodeData().getTaxonomy( 1 ).getCommonName().equals( "the host" ) ) {
1955                 return false;
1956             }
1957             if ( t2_rt.getNode( "node a" ).getNodeData().getSequences().size() != 2 ) {
1958                 return false;
1959             }
1960             if ( !t2_rt.getNode( "node a" ).getNodeData().getSequence( 0 ).getMolecularSequence()
1961                     .startsWith( "actgtgggggt" ) ) {
1962                 return false;
1963             }
1964             if ( !t2_rt.getNode( "node a" ).getNodeData().getSequence( 1 ).getMolecularSequence()
1965                     .startsWith( "ctgtgatgcat" ) ) {
1966                 return false;
1967             }
1968             final StringBuffer t3_sb_0 = new StringBuffer( phylogenies_0[ 2 ].toPhyloXML( 0 ) );
1969             final Phylogeny[] phylogenies_1_0 = factory.create( t3_sb_0, xml_parser );
1970             final StringBuffer t3_sb = new StringBuffer( phylogenies_1_0[ 0 ].toPhyloXML( 0 ) );
1971             final Phylogeny[] phylogenies_1 = factory.create( t3_sb, xml_parser );
1972             if ( phylogenies_1.length != 1 ) {
1973                 return false;
1974             }
1975             final Phylogeny t3_rt = phylogenies_1[ 0 ];
1976             if ( !t3_rt.getName().equals( "t3" ) ) {
1977                 return false;
1978             }
1979             if ( t3_rt.getNumberOfExternalNodes() != 4 ) {
1980                 return false;
1981             }
1982             if ( !t3_rt.getIdentifier().getValue().equals( "1-1" ) ) {
1983                 return false;
1984             }
1985             if ( !t3_rt.getIdentifier().getProvider().equals( "treebank" ) ) {
1986                 return false;
1987             }
1988             if ( !t3_rt.getNode( "root node" ).getNodeData().getSequence().getType().equals( "protein" ) ) {
1989                 return false;
1990             }
1991             if ( !t3_rt.getNode( "root node" ).getNodeData().getSequence().getName()
1992                     .equals( "Apoptosis facilitator Bcl-2-like 14 protein" ) ) {
1993                 return false;
1994             }
1995             if ( !t3_rt.getNode( "root node" ).getNodeData().getSequence().getSymbol().equals( "BCL2L14" ) ) {
1996                 return false;
1997             }
1998             if ( !t3_rt.getNode( "root node" ).getNodeData().getSequence().getAccession().getValue().equals( "Q9BZR8" ) ) {
1999                 return false;
2000             }
2001             if ( !t3_rt.getNode( "root node" ).getNodeData().getSequence().getAccession().getSource()
2002                     .equals( "UniProtKB" ) ) {
2003                 return false;
2004             }
2005             if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getDesc()
2006                     .equals( "apoptosis" ) ) {
2007                 return false;
2008             }
2009             if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getRef()
2010                     .equals( "GO:0006915" ) ) {
2011                 return false;
2012             }
2013             if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getSource()
2014                     .equals( "UniProtKB" ) ) {
2015                 return false;
2016             }
2017             if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getEvidence()
2018                     .equals( "experimental" ) ) {
2019                 return false;
2020             }
2021             if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getType()
2022                     .equals( "function" ) ) {
2023                 return false;
2024             }
2025             if ( ( t3_rt.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getConfidence()
2026                     .getValue() != 1 ) {
2027                 return false;
2028             }
2029             if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getConfidence()
2030                     .getType().equals( "ml" ) ) {
2031                 return false;
2032             }
2033             if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getDesc()
2034                     .equals( "apoptosis" ) ) {
2035                 return false;
2036             }
2037             if ( ( t3_rt.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getProperties()
2038                     .getProperty( "AFFY:expression" ).getAppliesTo() != AppliesTo.ANNOTATION ) {
2039                 return false;
2040             }
2041             if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getProperties()
2042                     .getProperty( "AFFY:expression" ).getDataType().equals( "xsd:double" ) ) {
2043                 return false;
2044             }
2045             if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getProperties()
2046                     .getProperty( "AFFY:expression" ).getRef().equals( "AFFY:expression" ) ) {
2047                 return false;
2048             }
2049             if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getProperties()
2050                     .getProperty( "AFFY:expression" ).getUnit().equals( "AFFY:x" ) ) {
2051                 return false;
2052             }
2053             if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getProperties()
2054                     .getProperty( "AFFY:expression" ).getValue().equals( "0.2" ) ) {
2055                 return false;
2056             }
2057             if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 2 ) ).getProperties()
2058                     .getProperty( "MED:disease" ).getValue().equals( "lymphoma" ) ) {
2059                 return false;
2060             }
2061             if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 1 ) ).getRef()
2062                     .equals( "GO:0005829" ) ) {
2063                 return false;
2064             }
2065             if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getAnnotation( 0 ) ).getDesc()
2066                     .equals( "intracellular organelle" ) ) {
2067                 return false;
2068             }
2069             if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getUri( 0 ).getType().equals( "source" ) ) ) {
2070                 return false;
2071             }
2072             if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getUri( 0 ).getDescription()
2073                     .equals( "UniProt link" ) ) ) {
2074                 return false;
2075             }
2076             if ( !( t3_rt.getNode( "root node" ).getNodeData().getSequence().getLocation().equals( "12p13-p12" ) ) ) {
2077                 return false;
2078             }
2079             if ( !( t3_rt.getNode( "root node" ).getNodeData().getReference().getDoi().equals( "10.1038/387489a0" ) ) ) {
2080                 return false;
2081             }
2082             if ( !( t3_rt.getNode( "root node" ).getNodeData().getReference().getDescription()
2083                     .equals( "Aguinaldo, A. M. A.; J. M. Turbeville, L. S. Linford, M. C. Rivera, J. R. Garey, R. A. Raff, & J. A. Lake (1997). \"Evidence for a clade of nematodes, arthropods and other moulting animals\". Nature 387 (6632): 489–493." ) ) ) {
2084                 return false;
2085             }
2086             if ( !t3_rt.getNode( "root node" ).getNodeData().getTaxonomy().getTaxonomyCode().equals( "ECDYS" ) ) {
2087                 return false;
2088             }
2089             if ( !t3_rt.getNode( "root node" ).getNodeData().getTaxonomy().getScientificName().equals( "ecdysozoa" ) ) {
2090                 return false;
2091             }
2092             if ( !t3_rt.getNode( "root node" ).getNodeData().getTaxonomy().getCommonName().equals( "molting animals" ) ) {
2093                 return false;
2094             }
2095             if ( !t3_rt.getNode( "root node" ).getNodeData().getTaxonomy().getIdentifier().getValue().equals( "1" ) ) {
2096                 return false;
2097             }
2098             if ( !t3_rt.getNode( "root node" ).getNodeData().getTaxonomy().getIdentifier().getProvider()
2099                     .equals( "ncbi" ) ) {
2100                 return false;
2101             }
2102             if ( t3_rt.getNode( "node bc" ).getNodeData().getSequence().getDomainArchitecture().getTotalLength() != 124 ) {
2103                 return false;
2104             }
2105             if ( !t3_rt.getNode( "node bc" ).getNodeData().getSequence().getDomainArchitecture().getDomain( 0 )
2106                     .getName().equals( "B" ) ) {
2107                 return false;
2108             }
2109             if ( t3_rt.getNode( "node bc" ).getNodeData().getSequence().getDomainArchitecture().getDomain( 0 )
2110                     .getFrom() != 21 ) {
2111                 return false;
2112             }
2113             if ( t3_rt.getNode( "node bc" ).getNodeData().getSequence().getDomainArchitecture().getDomain( 0 ).getTo() != 44 ) {
2114                 return false;
2115             }
2116             if ( t3_rt.getNode( "node bc" ).getNodeData().getSequence().getDomainArchitecture().getDomain( 0 )
2117                     .getLength() != 24 ) {
2118                 return false;
2119             }
2120             if ( t3_rt.getNode( "node bc" ).getNodeData().getSequence().getDomainArchitecture().getDomain( 0 )
2121                     .getConfidence() != 0 ) {
2122                 return false;
2123             }
2124             if ( !t3_rt.getNode( "node bc" ).getNodeData().getSequence().getDomainArchitecture().getDomain( 0 ).getId()
2125                     .equals( "pfam" ) ) {
2126                 return false;
2127             }
2128             if ( t3_rt.getNode( "node bb" ).getNodeData().getBinaryCharacters().getGainedCharacters().size() != 3 ) {
2129                 return false;
2130             }
2131             if ( t3_rt.getNode( "node bb" ).getNodeData().getBinaryCharacters().getPresentCharacters().size() != 2 ) {
2132                 return false;
2133             }
2134             if ( t3_rt.getNode( "node bb" ).getNodeData().getBinaryCharacters().getLostCharacters().size() != 1 ) {
2135                 return false;
2136             }
2137             if ( !t3_rt.getNode( "node bb" ).getNodeData().getBinaryCharacters().getType().equals( "domains" ) ) {
2138                 return false;
2139             }
2140             final Taxonomy taxbb = t3_rt.getNode( "node bb" ).getNodeData().getTaxonomy();
2141             if ( !taxbb.getAuthority().equals( "Stephenson, 1935" ) ) {
2142                 return false;
2143             }
2144             if ( !taxbb.getCommonName().equals( "starlet sea anemone" ) ) {
2145                 return false;
2146             }
2147             if ( !taxbb.getIdentifier().getProvider().equals( "EOL" ) ) {
2148                 return false;
2149             }
2150             if ( !taxbb.getIdentifier().getValue().equals( "704294" ) ) {
2151                 return false;
2152             }
2153             if ( !taxbb.getTaxonomyCode().equals( "NEMVE" ) ) {
2154                 return false;
2155             }
2156             if ( !taxbb.getScientificName().equals( "Nematostella vectensis" ) ) {
2157                 return false;
2158             }
2159             if ( taxbb.getSynonyms().size() != 2 ) {
2160                 return false;
2161             }
2162             if ( !taxbb.getSynonyms().contains( "Nematostella vectensis Stephenson1935" ) ) {
2163                 return false;
2164             }
2165             if ( !taxbb.getSynonyms().contains( "See Anemone" ) ) {
2166                 return false;
2167             }
2168             if ( !taxbb.getUri( 0 ).getDescription().equals( "EOL" ) ) {
2169                 return false;
2170             }
2171             if ( !taxbb.getUri( 0 ).getType().equals( "linkout" ) ) {
2172                 return false;
2173             }
2174             if ( !taxbb.getUri( 0 ).getValue().toString().equals( "http://www.eol.org/pages/704294" ) ) {
2175                 return false;
2176             }
2177             if ( ( ( BinaryCharacters ) t3_rt.getNode( "node bb" ).getNodeData().getBinaryCharacters().copy() )
2178                     .getLostCount() != BinaryCharacters.COUNT_DEFAULT ) {
2179                 return false;
2180             }
2181             if ( t3_rt.getNode( "node b" ).getNodeData().getBinaryCharacters().getGainedCount() != 1 ) {
2182                 return false;
2183             }
2184             if ( t3_rt.getNode( "node b" ).getNodeData().getBinaryCharacters().getGainedCharacters().size() != 1 ) {
2185                 return false;
2186             }
2187             if ( t3_rt.getNode( "node b" ).getNodeData().getBinaryCharacters().getLostCount() != 3 ) {
2188                 return false;
2189             }
2190             if ( t3_rt.getNode( "node b" ).getNodeData().getBinaryCharacters().getLostCharacters().size() != 3 ) {
2191                 return false;
2192             }
2193             if ( t3_rt.getNode( "node b" ).getNodeData().getBinaryCharacters().getPresentCount() != 2 ) {
2194                 return false;
2195             }
2196             if ( t3_rt.getNode( "node b" ).getNodeData().getBinaryCharacters().getPresentCharacters().size() != 2 ) {
2197                 return false;
2198             }
2199             if ( !t3_rt.getNode( "node b" ).getNodeData().getBinaryCharacters().getType().equals( "characters" ) ) {
2200                 return false;
2201             }
2202             if ( !t3_rt.getNode( "node ba" ).getNodeData().getDate().getDesc().equals( "Silurian" ) ) {
2203                 return false;
2204             }
2205             if ( !t3_rt.getNode( "node ba" ).getNodeData().getDate().getValue().toPlainString()
2206                     .equalsIgnoreCase( "435" ) ) {
2207                 return false;
2208             }
2209             if ( !t3_rt.getNode( "node ba" ).getNodeData().getDate().getMin().toPlainString().equalsIgnoreCase( "416" ) ) {
2210                 return false;
2211             }
2212             if ( !t3_rt.getNode( "node ba" ).getNodeData().getDate().getMax().toPlainString()
2213                     .equalsIgnoreCase( "443.7" ) ) {
2214                 return false;
2215             }
2216             if ( !t3_rt.getNode( "node ba" ).getNodeData().getDate().getUnit().equals( "mya" ) ) {
2217                 return false;
2218             }
2219             if ( !t3_rt.getNode( "node bb" ).getNodeData().getDate().getDesc().equals( "Triassic" ) ) {
2220                 return false;
2221             }
2222             if ( !t3_rt.getNode( "node bc" ).getNodeData().getDate().getValue().toPlainString()
2223                     .equalsIgnoreCase( "433" ) ) {
2224                 return false;
2225             }
2226             final SortedSet<Accession> x = t3_rt.getNode( "root node" ).getNodeData().getSequence()
2227                     .getCrossReferences();
2228             if ( x.size() != 4 ) {
2229                 return false;
2230             }
2231             int c = 0;
2232             for( final Accession acc : x ) {
2233                 if ( c == 0 ) {
2234                     if ( !acc.getSource().equals( "KEGG" ) ) {
2235                         return false;
2236                     }
2237                     if ( !acc.getValue().equals( "hsa:596" ) ) {
2238                         return false;
2239                     }
2240                 }
2241                 c++;
2242             }
2243         }
2244         catch ( final Exception e ) {
2245             e.printStackTrace( System.out );
2246             return false;
2247         }
2248         return true;
2249     }
2250
2251     private static boolean testBasicPhyloXMLparsingValidating() {
2252         try {
2253             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
2254             PhyloXmlParser xml_parser = null;
2255             try {
2256                 xml_parser = PhyloXmlParser.createPhyloXmlParserXsdValidating();
2257             }
2258             catch ( final Exception e ) {
2259                 // Do nothing -- means were not running from jar.
2260             }
2261             if ( xml_parser == null ) {
2262                 xml_parser = PhyloXmlParser.createPhyloXmlParser();
2263                 if ( USE_LOCAL_PHYLOXML_SCHEMA ) {
2264                     xml_parser.setValidateAgainstSchema( PHYLOXML_LOCAL_XSD );
2265                 }
2266                 else {
2267                     xml_parser.setValidateAgainstSchema( PHYLOXML_REMOTE_XSD );
2268                 }
2269             }
2270             final Phylogeny[] phylogenies_0 = factory.create( Test.PATH_TO_TEST_DATA + "phyloxml_test_t1.xml",
2271                                                               xml_parser );
2272             if ( xml_parser.getErrorCount() > 0 ) {
2273                 System.out.println( xml_parser.getErrorMessages().toString() );
2274                 return false;
2275             }
2276             if ( phylogenies_0.length != 4 ) {
2277                 return false;
2278             }
2279             final Phylogeny t1 = phylogenies_0[ 0 ];
2280             final Phylogeny t2 = phylogenies_0[ 1 ];
2281             final Phylogeny t3 = phylogenies_0[ 2 ];
2282             final Phylogeny t4 = phylogenies_0[ 3 ];
2283             if ( !t1.getName().equals( "t1" ) ) {
2284                 return false;
2285             }
2286             if ( !t2.getName().equals( "t2" ) ) {
2287                 return false;
2288             }
2289             if ( !t3.getName().equals( "t3" ) ) {
2290                 return false;
2291             }
2292             if ( !t4.getName().equals( "t4" ) ) {
2293                 return false;
2294             }
2295             if ( t1.getNumberOfExternalNodes() != 1 ) {
2296                 return false;
2297             }
2298             if ( t2.getNumberOfExternalNodes() != 2 ) {
2299                 return false;
2300             }
2301             if ( t3.getNumberOfExternalNodes() != 4 ) {
2302                 return false;
2303             }
2304             final String x2 = Test.PATH_TO_TEST_DATA + "phyloxml_test_t1.xml";
2305             final Phylogeny[] phylogenies_1 = factory.create( x2, xml_parser );
2306             if ( xml_parser.getErrorCount() > 0 ) {
2307                 System.out.println( "errors:" );
2308                 System.out.println( xml_parser.getErrorMessages().toString() );
2309                 return false;
2310             }
2311             if ( phylogenies_1.length != 4 ) {
2312                 return false;
2313             }
2314             final Phylogeny[] phylogenies_2 = factory.create( Test.PATH_TO_TEST_DATA + "phyloxml_test_t3.xml",
2315                                                               xml_parser );
2316             if ( xml_parser.getErrorCount() > 0 ) {
2317                 System.out.println( "errors:" );
2318                 System.out.println( xml_parser.getErrorMessages().toString() );
2319                 return false;
2320             }
2321             if ( phylogenies_2.length != 1 ) {
2322                 return false;
2323             }
2324             if ( phylogenies_2[ 0 ].getNumberOfExternalNodes() != 2 ) {
2325                 return false;
2326             }
2327             final Phylogeny[] phylogenies_3 = factory.create( Test.PATH_TO_TEST_DATA + "phyloxml_test_t4.xml",
2328                                                               xml_parser );
2329             if ( xml_parser.getErrorCount() > 0 ) {
2330                 System.out.println( xml_parser.getErrorMessages().toString() );
2331                 return false;
2332             }
2333             if ( phylogenies_3.length != 2 ) {
2334                 return false;
2335             }
2336             final Phylogeny a = phylogenies_3[ 0 ];
2337             if ( !a.getName().equals( "tree 4" ) ) {
2338                 return false;
2339             }
2340             if ( a.getNumberOfExternalNodes() != 3 ) {
2341                 return false;
2342             }
2343             if ( !a.getNode( "node b1" ).getNodeData().getSequence().getName().equals( "b1 gene" ) ) {
2344                 return false;
2345             }
2346             if ( !a.getNode( "node b1" ).getNodeData().getTaxonomy().getCommonName().equals( "b1 species" ) ) {
2347                 return false;
2348             }
2349             final Phylogeny[] phylogenies_4 = factory.create( Test.PATH_TO_TEST_DATA + "special_characters.xml",
2350                                                               xml_parser );
2351             if ( xml_parser.getErrorCount() > 0 ) {
2352                 System.out.println( xml_parser.getErrorMessages().toString() );
2353                 return false;
2354             }
2355             if ( phylogenies_4.length != 1 ) {
2356                 return false;
2357             }
2358             final Phylogeny s = phylogenies_4[ 0 ];
2359             if ( s.getNumberOfExternalNodes() != 6 ) {
2360                 return false;
2361             }
2362             s.getNode( "first" );
2363             s.getNode( "<>" );
2364             s.getNode( "\"<a'b&c'd\">\"" );
2365             s.getNode( "'''\"" );
2366             s.getNode( "\"\"\"" );
2367             s.getNode( "dick & doof" );
2368         }
2369         catch ( final Exception e ) {
2370             e.printStackTrace( System.out );
2371             return false;
2372         }
2373         return true;
2374     }
2375
2376     private static boolean testBasicProtein() {
2377         try {
2378             final BasicProtein p0 = new BasicProtein( "p0", "owl", 0 );
2379             final Domain a = new BasicDomain( "a", 1, 10, ( short ) 1, ( short ) 5, 0.1, -12 );
2380             final Domain b = new BasicDomain( "b", 11, 20, ( short ) 1, ( short ) 5, 0.1, -12 );
2381             final Domain c = new BasicDomain( "c", 9, 23, ( short ) 1, ( short ) 5, 0.1, -12 );
2382             final Domain d = new BasicDomain( "d", 15, 30, ( short ) 1, ( short ) 5, 0.1, -12 );
2383             final Domain e = new BasicDomain( "e", 60, 70, ( short ) 1, ( short ) 5, 0.1, -12 );
2384             final Domain x = new BasicDomain( "x", 100, 110, ( short ) 1, ( short ) 5, 0.1, -12 );
2385             final Domain y = new BasicDomain( "y", 100, 110, ( short ) 1, ( short ) 5, 0.1, -12 );
2386             p0.addProteinDomain( y );
2387             p0.addProteinDomain( e );
2388             p0.addProteinDomain( b );
2389             p0.addProteinDomain( c );
2390             p0.addProteinDomain( d );
2391             p0.addProteinDomain( a );
2392             p0.addProteinDomain( x );
2393             if ( !p0.toDomainArchitectureString( "~" ).equals( "a~b~c~d~e~x~y" ) ) {
2394                 return false;
2395             }
2396             if ( !p0.toDomainArchitectureString( "~", 3, "=" ).equals( "a~b~c~d~e~x~y" ) ) {
2397                 return false;
2398             }
2399             //
2400             final BasicProtein aa0 = new BasicProtein( "aa", "owl", 0 );
2401             final Domain a1 = new BasicDomain( "a", 1, 10, ( short ) 1, ( short ) 5, 0.1, -12 );
2402             aa0.addProteinDomain( a1 );
2403             if ( !aa0.toDomainArchitectureString( "~" ).equals( "a" ) ) {
2404                 return false;
2405             }
2406             if ( !aa0.toDomainArchitectureString( "~", 3, "" ).equals( "a" ) ) {
2407                 return false;
2408             }
2409             //
2410             final BasicProtein aa1 = new BasicProtein( "aa", "owl", 0 );
2411             final Domain a11 = new BasicDomain( "a", 1, 10, ( short ) 1, ( short ) 5, 0.1, -12 );
2412             final Domain a12 = new BasicDomain( "a", 2, 20, ( short ) 1, ( short ) 5, 0.1, -12 );
2413             aa1.addProteinDomain( a11 );
2414             aa1.addProteinDomain( a12 );
2415             if ( !aa1.toDomainArchitectureString( "~" ).equals( "a~a" ) ) {
2416                 return false;
2417             }
2418             if ( !aa1.toDomainArchitectureString( "~", 3, "" ).equals( "a~a" ) ) {
2419                 return false;
2420             }
2421             aa1.addProteinDomain( new BasicDomain( "a", 20, 30, ( short ) 1, ( short ) 5, 0.1, -12 ) );
2422             if ( !aa1.toDomainArchitectureString( "~" ).equals( "a~a~a" ) ) {
2423                 return false;
2424             }
2425             if ( !aa1.toDomainArchitectureString( "~", 3, "" ).equals( "aaa" ) ) {
2426                 return false;
2427             }
2428             if ( !aa1.toDomainArchitectureString( "~", 4, "" ).equals( "a~a~a" ) ) {
2429                 return false;
2430             }
2431             aa1.addProteinDomain( new BasicDomain( "a", 30, 40, ( short ) 1, ( short ) 5, 0.1, -12 ) );
2432             if ( !aa1.toDomainArchitectureString( "~" ).equals( "a~a~a~a" ) ) {
2433                 return false;
2434             }
2435             if ( !aa1.toDomainArchitectureString( "~", 3, "" ).equals( "aaa" ) ) {
2436                 return false;
2437             }
2438             if ( !aa1.toDomainArchitectureString( "~", 4, "" ).equals( "aaa" ) ) {
2439                 return false;
2440             }
2441             if ( !aa1.toDomainArchitectureString( "~", 5, "" ).equals( "a~a~a~a" ) ) {
2442                 return false;
2443             }
2444             aa1.addProteinDomain( new BasicDomain( "b", 32, 40, ( short ) 1, ( short ) 5, 0.1, -12 ) );
2445             if ( !aa1.toDomainArchitectureString( "~" ).equals( "a~a~a~a~b" ) ) {
2446                 return false;
2447             }
2448             if ( !aa1.toDomainArchitectureString( "~", 3, "" ).equals( "aaa~b" ) ) {
2449                 return false;
2450             }
2451             if ( !aa1.toDomainArchitectureString( "~", 4, "" ).equals( "aaa~b" ) ) {
2452                 return false;
2453             }
2454             if ( !aa1.toDomainArchitectureString( "~", 5, "" ).equals( "a~a~a~a~b" ) ) {
2455                 return false;
2456             }
2457             aa1.addProteinDomain( new BasicDomain( "c", 1, 2, ( short ) 1, ( short ) 5, 0.1, -12 ) );
2458             if ( !aa1.toDomainArchitectureString( "~" ).equals( "c~a~a~a~a~b" ) ) {
2459                 return false;
2460             }
2461             if ( !aa1.toDomainArchitectureString( "~", 3, "" ).equals( "c~aaa~b" ) ) {
2462                 return false;
2463             }
2464             if ( !aa1.toDomainArchitectureString( "~", 4, "" ).equals( "c~aaa~b" ) ) {
2465                 return false;
2466             }
2467             if ( !aa1.toDomainArchitectureString( "~", 5, "" ).equals( "c~a~a~a~a~b" ) ) {
2468                 return false;
2469             }
2470             //
2471             final BasicProtein p00 = new BasicProtein( "p0", "owl", 0 );
2472             final Domain a0 = new BasicDomain( "a", 1, 10, ( short ) 1, ( short ) 5, 0.1, -12 );
2473             final Domain b0 = new BasicDomain( "b", 11, 20, ( short ) 1, ( short ) 5, 0.1, -12 );
2474             final Domain c0 = new BasicDomain( "c", 9, 23, ( short ) 1, ( short ) 5, 0.1, -12 );
2475             final Domain d0 = new BasicDomain( "d", 15, 30, ( short ) 1, ( short ) 5, 0.1, -12 );
2476             final Domain e0 = new BasicDomain( "e", 60, 70, ( short ) 1, ( short ) 5, 0.1, -12 );
2477             final Domain e1 = new BasicDomain( "e", 61, 71, ( short ) 1, ( short ) 5, 0.1, -12 );
2478             final Domain e2 = new BasicDomain( "e", 62, 72, ( short ) 1, ( short ) 5, 0.1, -12 );
2479             final Domain e3 = new BasicDomain( "e", 63, 73, ( short ) 1, ( short ) 5, 0.1, -12 );
2480             final Domain e4 = new BasicDomain( "e", 64, 74, ( short ) 1, ( short ) 5, 0.1, -12 );
2481             final Domain e5 = new BasicDomain( "e", 65, 75, ( short ) 1, ( short ) 5, 0.1, -12 );
2482             final Domain x0 = new BasicDomain( "x", 100, 110, ( short ) 1, ( short ) 5, 0.1, -12 );
2483             final Domain y0 = new BasicDomain( "y", 100, 110, ( short ) 1, ( short ) 5, 0.1, -12 );
2484             final Domain y1 = new BasicDomain( "y", 120, 130, ( short ) 1, ( short ) 5, 0.1, -12 );
2485             final Domain y2 = new BasicDomain( "y", 140, 150, ( short ) 1, ( short ) 5, 0.1, -12 );
2486             final Domain y3 = new BasicDomain( "y", 160, 170, ( short ) 1, ( short ) 5, 0.1, -12 );
2487             final Domain z0 = new BasicDomain( "z", 200, 210, ( short ) 1, ( short ) 5, 0.1, -12 );
2488             final Domain z1 = new BasicDomain( "z", 300, 310, ( short ) 1, ( short ) 5, 0.1, -12 );
2489             final Domain z2 = new BasicDomain( "z", 400, 410, ( short ) 1, ( short ) 5, 0.1, -12 );
2490             final Domain zz0 = new BasicDomain( "Z", 500, 510, ( short ) 1, ( short ) 5, 0.1, -12 );
2491             final Domain zz1 = new BasicDomain( "Z", 600, 610, ( short ) 1, ( short ) 5, 0.1, -12 );
2492             p00.addProteinDomain( y0 );
2493             p00.addProteinDomain( e0 );
2494             p00.addProteinDomain( b0 );
2495             p00.addProteinDomain( c0 );
2496             p00.addProteinDomain( d0 );
2497             p00.addProteinDomain( a0 );
2498             p00.addProteinDomain( x0 );
2499             p00.addProteinDomain( y1 );
2500             p00.addProteinDomain( y2 );
2501             p00.addProteinDomain( y3 );
2502             p00.addProteinDomain( e1 );
2503             p00.addProteinDomain( e2 );
2504             p00.addProteinDomain( e3 );
2505             p00.addProteinDomain( e4 );
2506             p00.addProteinDomain( e5 );
2507             p00.addProteinDomain( z0 );
2508             p00.addProteinDomain( z1 );
2509             p00.addProteinDomain( z2 );
2510             p00.addProteinDomain( zz0 );
2511             p00.addProteinDomain( zz1 );
2512             if ( !p00.toDomainArchitectureString( "~", 3, "" ).equals( "a~b~c~d~eee~x~yyy~zzz~Z~Z" ) ) {
2513                 return false;
2514             }
2515             if ( !p00.toDomainArchitectureString( "~", 4, "" ).equals( "a~b~c~d~eee~x~yyy~z~z~z~Z~Z" ) ) {
2516                 return false;
2517             }
2518             if ( !p00.toDomainArchitectureString( "~", 5, "" ).equals( "a~b~c~d~eee~x~y~y~y~y~z~z~z~Z~Z" ) ) {
2519                 return false;
2520             }
2521             if ( !p00.toDomainArchitectureString( "~", 6, "" ).equals( "a~b~c~d~eee~x~y~y~y~y~z~z~z~Z~Z" ) ) {
2522                 return false;
2523             }
2524             if ( !p00.toDomainArchitectureString( "~", 7, "" ).equals( "a~b~c~d~e~e~e~e~e~e~x~y~y~y~y~z~z~z~Z~Z" ) ) {
2525                 return false;
2526             }
2527             // A0  A10  B15  A20  B25  A30  B35  B40  C50  A60  C70  D80
2528             final Domain A0 = new BasicDomain( "A", 0, 25, ( short ) 1, ( short ) 4, 0.1, -12 );
2529             final Domain A10 = new BasicDomain( "A", 10, 11, ( short ) 1, ( short ) 4, 0.1, -12 );
2530             final Domain B15 = new BasicDomain( "B", 11, 16, ( short ) 1, ( short ) 4, 0.1, -12 );
2531             final Domain A20 = new BasicDomain( "A", 20, 100, ( short ) 1, ( short ) 4, 0.1, -12 );
2532             final Domain B25 = new BasicDomain( "B", 25, 26, ( short ) 1, ( short ) 4, 0.1, -12 );
2533             final Domain A30 = new BasicDomain( "A", 30, 31, ( short ) 1, ( short ) 4, 0.1, -12 );
2534             final Domain B35 = new BasicDomain( "B", 31, 40, ( short ) 1, ( short ) 4, 0.1, -12 );
2535             final Domain B40 = new BasicDomain( "B", 40, 600, ( short ) 1, ( short ) 4, 0.1, -12 );
2536             final Domain C50 = new BasicDomain( "C", 50, 59, ( short ) 1, ( short ) 4, 0.1, -12 );
2537             final Domain A60 = new BasicDomain( "A", 60, 395, ( short ) 1, ( short ) 4, 0.1, -12 );
2538             final Domain C70 = new BasicDomain( "C", 70, 71, ( short ) 1, ( short ) 4, 0.1, -12 );
2539             final Domain D80 = new BasicDomain( "D", 80, 81, ( short ) 1, ( short ) 4, 0.1, -12 );
2540             final BasicProtein p = new BasicProtein( "p", "owl", 0 );
2541             p.addProteinDomain( B15 );
2542             p.addProteinDomain( C50 );
2543             p.addProteinDomain( A60 );
2544             p.addProteinDomain( A30 );
2545             p.addProteinDomain( C70 );
2546             p.addProteinDomain( B35 );
2547             p.addProteinDomain( B40 );
2548             p.addProteinDomain( A0 );
2549             p.addProteinDomain( A10 );
2550             p.addProteinDomain( A20 );
2551             p.addProteinDomain( B25 );
2552             p.addProteinDomain( D80 );
2553             List<String> domains_ids = new ArrayList<String>();
2554             domains_ids.add( "A" );
2555             domains_ids.add( "B" );
2556             domains_ids.add( "C" );
2557             if ( !p.contains( domains_ids, false ) ) {
2558                 return false;
2559             }
2560             if ( !p.contains( domains_ids, true ) ) {
2561                 return false;
2562             }
2563             domains_ids.add( "X" );
2564             if ( p.contains( domains_ids, false ) ) {
2565                 return false;
2566             }
2567             if ( p.contains( domains_ids, true ) ) {
2568                 return false;
2569             }
2570             domains_ids = new ArrayList<String>();
2571             domains_ids.add( "A" );
2572             domains_ids.add( "C" );
2573             domains_ids.add( "D" );
2574             if ( !p.contains( domains_ids, false ) ) {
2575                 return false;
2576             }
2577             if ( !p.contains( domains_ids, true ) ) {
2578                 return false;
2579             }
2580             domains_ids = new ArrayList<String>();
2581             domains_ids.add( "A" );
2582             domains_ids.add( "D" );
2583             domains_ids.add( "C" );
2584             if ( !p.contains( domains_ids, false ) ) {
2585                 return false;
2586             }
2587             if ( p.contains( domains_ids, true ) ) {
2588                 return false;
2589             }
2590             domains_ids = new ArrayList<String>();
2591             domains_ids.add( "A" );
2592             domains_ids.add( "A" );
2593             domains_ids.add( "B" );
2594             if ( !p.contains( domains_ids, false ) ) {
2595                 return false;
2596             }
2597             if ( !p.contains( domains_ids, true ) ) {
2598                 return false;
2599             }
2600             domains_ids = new ArrayList<String>();
2601             domains_ids.add( "A" );
2602             domains_ids.add( "A" );
2603             domains_ids.add( "A" );
2604             domains_ids.add( "B" );
2605             domains_ids.add( "B" );
2606             if ( !p.contains( domains_ids, false ) ) {
2607                 return false;
2608             }
2609             if ( !p.contains( domains_ids, true ) ) {
2610                 return false;
2611             }
2612             domains_ids = new ArrayList<String>();
2613             domains_ids.add( "A" );
2614             domains_ids.add( "A" );
2615             domains_ids.add( "B" );
2616             domains_ids.add( "A" );
2617             domains_ids.add( "B" );
2618             domains_ids.add( "B" );
2619             domains_ids.add( "A" );
2620             domains_ids.add( "B" );
2621             domains_ids.add( "C" );
2622             domains_ids.add( "A" );
2623             domains_ids.add( "C" );
2624             domains_ids.add( "D" );
2625             if ( !p.contains( domains_ids, false ) ) {
2626                 return false;
2627             }
2628             if ( p.contains( domains_ids, true ) ) {
2629                 return false;
2630             }
2631         }
2632         catch ( final Exception e ) {
2633             e.printStackTrace( System.out );
2634             return false;
2635         }
2636         return true;
2637     }
2638
2639     private static boolean testBasicTable() {
2640         try {
2641             final BasicTable<String> t0 = new BasicTable<String>();
2642             if ( t0.getNumberOfColumns() != 0 ) {
2643                 return false;
2644             }
2645             if ( t0.getNumberOfRows() != 0 ) {
2646                 return false;
2647             }
2648             t0.setValue( 3, 2, "23" );
2649             t0.setValue( 10, 1, "error" );
2650             t0.setValue( 10, 1, "110" );
2651             t0.setValue( 9, 1, "19" );
2652             t0.setValue( 1, 10, "101" );
2653             t0.setValue( 10, 10, "1010" );
2654             t0.setValue( 100, 10, "10100" );
2655             t0.setValue( 0, 0, "00" );
2656             if ( !t0.getValue( 3, 2 ).equals( "23" ) ) {
2657                 return false;
2658             }
2659             if ( !t0.getValue( 10, 1 ).equals( "110" ) ) {
2660                 return false;
2661             }
2662             if ( !t0.getValueAsString( 1, 10 ).equals( "101" ) ) {
2663                 return false;
2664             }
2665             if ( !t0.getValueAsString( 10, 10 ).equals( "1010" ) ) {
2666                 return false;
2667             }
2668             if ( !t0.getValueAsString( 100, 10 ).equals( "10100" ) ) {
2669                 return false;
2670             }
2671             if ( !t0.getValueAsString( 9, 1 ).equals( "19" ) ) {
2672                 return false;
2673             }
2674             if ( !t0.getValueAsString( 0, 0 ).equals( "00" ) ) {
2675                 return false;
2676             }
2677             if ( t0.getNumberOfColumns() != 101 ) {
2678                 return false;
2679             }
2680             if ( t0.getNumberOfRows() != 11 ) {
2681                 return false;
2682             }
2683             if ( t0.getValueAsString( 49, 4 ) != null ) {
2684                 return false;
2685             }
2686             final String l = ForesterUtil.getLineSeparator();
2687             final StringBuffer source = new StringBuffer();
2688             source.append( "" + l );
2689             source.append( "# 1 1 1 1 1 1 1 1" + l );
2690             source.append( " 00 01 02 03" + l );
2691             source.append( "   10 11 12 13  " + l );
2692             source.append( "20 21 22 23 " + l );
2693             source.append( "    30  31    32 33" + l );
2694             source.append( "40 41 42 43" + l );
2695             source.append( "  # 1 1 1 1 1 " + l );
2696             source.append( "50 51 52 53 54" + l );
2697             final BasicTable<String> t1 = BasicTableParser.parse( source.toString(), ' ' );
2698             if ( t1.getNumberOfColumns() != 5 ) {
2699                 return false;
2700             }
2701             if ( t1.getNumberOfRows() != 6 ) {
2702                 return false;
2703             }
2704             if ( !t1.getValueAsString( 0, 0 ).equals( "00" ) ) {
2705                 return false;
2706             }
2707             if ( !t1.getValueAsString( 1, 0 ).equals( "01" ) ) {
2708                 return false;
2709             }
2710             if ( !t1.getValueAsString( 3, 0 ).equals( "03" ) ) {
2711                 return false;
2712             }
2713             if ( !t1.getValueAsString( 4, 5 ).equals( "54" ) ) {
2714                 return false;
2715             }
2716             final StringBuffer source1 = new StringBuffer();
2717             source1.append( "" + l );
2718             source1.append( "# 1; 1; 1; 1 ;1 ;1; 1 ;1;" + l );
2719             source1.append( " 00; 01 ;02;03" + l );
2720             source1.append( "   10; 11; 12; 13  " + l );
2721             source1.append( "20; 21; 22; 23 " + l );
2722             source1.append( "    30;  31;    32; 33" + l );
2723             source1.append( "40;41;42;43" + l );
2724             source1.append( "  # 1 1 1 1 1 " + l );
2725             source1.append( ";;;50  ;  ;52; 53;;54   " + l );
2726             final BasicTable<String> t2 = BasicTableParser.parse( source1.toString(), ';' );
2727             if ( t2.getNumberOfColumns() != 5 ) {
2728                 return false;
2729             }
2730             if ( t2.getNumberOfRows() != 6 ) {
2731                 return false;
2732             }
2733             if ( !t2.getValueAsString( 0, 0 ).equals( "00" ) ) {
2734                 return false;
2735             }
2736             if ( !t2.getValueAsString( 1, 0 ).equals( "01" ) ) {
2737                 return false;
2738             }
2739             if ( !t2.getValueAsString( 3, 0 ).equals( "03" ) ) {
2740                 return false;
2741             }
2742             if ( !t2.getValueAsString( 3, 3 ).equals( "33" ) ) {
2743                 return false;
2744             }
2745             if ( !t2.getValueAsString( 3, 5 ).equals( "53" ) ) {
2746                 return false;
2747             }
2748             if ( !t2.getValueAsString( 1, 5 ).equals( "" ) ) {
2749                 return false;
2750             }
2751             final StringBuffer source2 = new StringBuffer();
2752             source2.append( "" + l );
2753             source2.append( "comment: 1; 1; 1; 1 ;1 ;1; 1 ;1;" + l );
2754             source2.append( " 00; 01 ;02;03" + l );
2755             source2.append( "   10; 11; 12; 13  " + l );
2756             source2.append( "20; 21; 22; 23 " + l );
2757             source2.append( "                     " + l );
2758             source2.append( "    30;  31;    32; 33" + l );
2759             source2.append( "40;41;42;43" + l );
2760             source2.append( "  comment: 1 1 1 1 1 " + l );
2761             source2.append( ";;;50  ;   52; 53;;54   " + l );
2762             final List<BasicTable<String>> tl = BasicTableParser.parse( source2.toString(),
2763                                                                         ';',
2764                                                                         false,
2765                                                                         false,
2766                                                                         "comment:",
2767                                                                         false );
2768             if ( tl.size() != 2 ) {
2769                 return false;
2770             }
2771             final BasicTable<String> t3 = tl.get( 0 );
2772             final BasicTable<String> t4 = tl.get( 1 );
2773             if ( t3.getNumberOfColumns() != 4 ) {
2774                 return false;
2775             }
2776             if ( t3.getNumberOfRows() != 3 ) {
2777                 return false;
2778             }
2779             if ( t4.getNumberOfColumns() != 4 ) {
2780                 return false;
2781             }
2782             if ( t4.getNumberOfRows() != 3 ) {
2783                 return false;
2784             }
2785             if ( !t3.getValueAsString( 0, 0 ).equals( "00" ) ) {
2786                 return false;
2787             }
2788             if ( !t4.getValueAsString( 0, 0 ).equals( "30" ) ) {
2789                 return false;
2790             }
2791         }
2792         catch ( final Exception e ) {
2793             e.printStackTrace( System.out );
2794             return false;
2795         }
2796         return true;
2797     }
2798
2799     private static boolean testBasicTolXMLparsing() {
2800         try {
2801             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
2802             final TolParser parser = new TolParser();
2803             final Phylogeny[] phylogenies_0 = factory.create( Test.PATH_TO_TEST_DATA + "tol_2484.tol", parser );
2804             if ( parser.getErrorCount() > 0 ) {
2805                 System.out.println( parser.getErrorMessages().toString() );
2806                 return false;
2807             }
2808             if ( phylogenies_0.length != 1 ) {
2809                 return false;
2810             }
2811             final Phylogeny t1 = phylogenies_0[ 0 ];
2812             if ( t1.getNumberOfExternalNodes() != 5 ) {
2813                 return false;
2814             }
2815             if ( !t1.isRooted() ) {
2816                 return false;
2817             }
2818             if ( !t1.getRoot().getNodeData().getTaxonomy().getScientificName().equals( "Mesozoa" ) ) {
2819                 return false;
2820             }
2821             if ( !t1.getRoot().getNodeData().getTaxonomy().getIdentifier().getValue().equals( "2484" ) ) {
2822                 return false;
2823             }
2824             if ( !t1.getRoot().getChildNode( 0 ).getNodeData().getTaxonomy().getScientificName().equals( "Rhombozoa" ) ) {
2825                 return false;
2826             }
2827             if ( t1.getRoot().getChildNode( 0 ).getNumberOfDescendants() != 3 ) {
2828                 return false;
2829             }
2830             final Phylogeny[] phylogenies_1 = factory.create( Test.PATH_TO_TEST_DATA + "tol_2.tol", parser );
2831             if ( parser.getErrorCount() > 0 ) {
2832                 System.out.println( parser.getErrorMessages().toString() );
2833                 return false;
2834             }
2835             if ( phylogenies_1.length != 1 ) {
2836                 return false;
2837             }
2838             final Phylogeny t2 = phylogenies_1[ 0 ];
2839             if ( t2.getNumberOfExternalNodes() != 664 ) {
2840                 return false;
2841             }
2842             if ( !t2.isRooted() ) {
2843                 return false;
2844             }
2845             if ( !t2.getRoot().getNodeData().getTaxonomy().getScientificName().equals( "Eubacteria" ) ) {
2846                 return false;
2847             }
2848             if ( !t2.getRoot().getNodeData().getTaxonomy().getIdentifier().getValue().equals( "2" ) ) {
2849                 return false;
2850             }
2851             if ( t2.getRoot().getNumberOfDescendants() != 24 ) {
2852                 return false;
2853             }
2854             if ( t2.getRoot().getNumberOfDescendants() != 24 ) {
2855                 return false;
2856             }
2857             if ( !t2.getRoot().getChildNode( 0 ).getNodeData().getTaxonomy().getScientificName().equals( "Aquificae" ) ) {
2858                 return false;
2859             }
2860             if ( !t2.getRoot().getChildNode( 0 ).getChildNode( 0 ).getNodeData().getTaxonomy().getScientificName()
2861                     .equals( "Aquifex" ) ) {
2862                 return false;
2863             }
2864             final Phylogeny[] phylogenies_2 = factory.create( Test.PATH_TO_TEST_DATA + "tol_5.tol", parser );
2865             if ( parser.getErrorCount() > 0 ) {
2866                 System.out.println( parser.getErrorMessages().toString() );
2867                 return false;
2868             }
2869             if ( phylogenies_2.length != 1 ) {
2870                 return false;
2871             }
2872             final Phylogeny t3 = phylogenies_2[ 0 ];
2873             if ( t3.getNumberOfExternalNodes() != 184 ) {
2874                 return false;
2875             }
2876             if ( !t3.getRoot().getNodeData().getTaxonomy().getScientificName().equals( "Viruses" ) ) {
2877                 return false;
2878             }
2879             if ( !t3.getRoot().getNodeData().getTaxonomy().getIdentifier().getValue().equals( "5" ) ) {
2880                 return false;
2881             }
2882             if ( t3.getRoot().getNumberOfDescendants() != 6 ) {
2883                 return false;
2884             }
2885             final Phylogeny[] phylogenies_3 = factory.create( Test.PATH_TO_TEST_DATA + "tol_4567.tol", parser );
2886             if ( parser.getErrorCount() > 0 ) {
2887                 System.out.println( parser.getErrorMessages().toString() );
2888                 return false;
2889             }
2890             if ( phylogenies_3.length != 1 ) {
2891                 return false;
2892             }
2893             final Phylogeny t4 = phylogenies_3[ 0 ];
2894             if ( t4.getNumberOfExternalNodes() != 1 ) {
2895                 return false;
2896             }
2897             if ( !t4.getRoot().getNodeData().getTaxonomy().getScientificName().equals( "Marpissa decorata" ) ) {
2898                 return false;
2899             }
2900             if ( !t4.getRoot().getNodeData().getTaxonomy().getIdentifier().getValue().equals( "4567" ) ) {
2901                 return false;
2902             }
2903             if ( t4.getRoot().getNumberOfDescendants() != 0 ) {
2904                 return false;
2905             }
2906             final Phylogeny[] phylogenies_4 = factory.create( Test.PATH_TO_TEST_DATA + "tol_16299.tol", parser );
2907             if ( parser.getErrorCount() > 0 ) {
2908                 System.out.println( parser.getErrorMessages().toString() );
2909                 return false;
2910             }
2911             if ( phylogenies_4.length != 1 ) {
2912                 return false;
2913             }
2914             final Phylogeny t5 = phylogenies_4[ 0 ];
2915             if ( t5.getNumberOfExternalNodes() != 13 ) {
2916                 return false;
2917             }
2918             if ( !t5.getRoot().getNodeData().getTaxonomy().getScientificName().equals( "Hominidae" ) ) {
2919                 return false;
2920             }
2921             if ( !t5.getRoot().getNodeData().getTaxonomy().getIdentifier().getValue().equals( "16299" ) ) {
2922                 return false;
2923             }
2924             if ( t5.getRoot().getNumberOfDescendants() != 2 ) {
2925                 return false;
2926             }
2927         }
2928         catch ( final Exception e ) {
2929             e.printStackTrace( System.out );
2930             return false;
2931         }
2932         return true;
2933     }
2934
2935     private static boolean testBasicTreeMethods() {
2936         try {
2937             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
2938             final Phylogeny t2 = factory.create( "((A:1,B:2)AB:1,(C:3,D:5)CD:3)ABCD:0.5", new NHXParser() )[ 0 ];
2939             if ( t2.getNumberOfExternalNodes() != 4 ) {
2940                 return false;
2941             }
2942             if ( t2.getHeight() != 8.5 ) {
2943                 return false;
2944             }
2945             if ( !t2.isCompletelyBinary() ) {
2946                 return false;
2947             }
2948             if ( t2.isEmpty() ) {
2949                 return false;
2950             }
2951             final Phylogeny t3 = factory.create( "((A:1,B:2,C:10)ABC:1,(D:3,E:5)DE:3)", new NHXParser() )[ 0 ];
2952             if ( t3.getNumberOfExternalNodes() != 5 ) {
2953                 return false;
2954             }
2955             if ( t3.getHeight() != 11 ) {
2956                 return false;
2957             }
2958             if ( t3.isCompletelyBinary() ) {
2959                 return false;
2960             }
2961             final PhylogenyNode n = t3.getNode( "ABC" );
2962             final Phylogeny t4 = factory.create( "((A:1,B:2,C:10)ABC:1,(D:3,E:5)DE:3,(F,G,H,I))", new NHXParser() )[ 0 ];
2963             if ( t4.getNumberOfExternalNodes() != 9 ) {
2964                 return false;
2965             }
2966             if ( t4.getHeight() != 11 ) {
2967                 return false;
2968             }
2969             if ( t4.isCompletelyBinary() ) {
2970                 return false;
2971             }
2972             final StringBuffer sb5 = new StringBuffer( "(((A11:2)A1:2,(A21:1,A22:2,A23)A2:11,A3:2)A:2,B:10,C:3,D:8)" );
2973             final Phylogeny t5 = factory.create( sb5, new NHXParser() )[ 0 ];
2974             if ( t5.getNumberOfExternalNodes() != 8 ) {
2975                 return false;
2976             }
2977             if ( t5.getHeight() != 15 ) {
2978                 return false;
2979             }
2980             final StringBuffer sb6 = new StringBuffer( "(X,Y,Z,(((A111)A11:2)A1:2,(X,Y,Z,A21:1,A22:2,A23)A2:11,A3:2)A:2,B:10,C:3,D:8)" );
2981             final Phylogeny t6 = factory.create( sb6, new NHXParser() )[ 0 ];
2982             if ( t6.getHeight() != 15 ) {
2983                 return false;
2984             }
2985             final StringBuffer sb7 = new StringBuffer( "(((A11:2)A1:2,(A21:1,A22:2,A23)A2:11,A3:2)A:2,B:10,C:15,D:8)" );
2986             final Phylogeny t7 = factory.create( sb7, new NHXParser() )[ 0 ];
2987             if ( t7.getHeight() != 15 ) {
2988                 return false;
2989             }
2990             final StringBuffer sb8 = new StringBuffer( "(((A11:11)A1:2,(A21:2,A22:2,A23,A24,AA:)A2:11,A3:2)A:2,B:15,C:15,D:15)" );
2991             final Phylogeny t8 = factory.create( sb8, new NHXParser() )[ 0 ];
2992             if ( t8.getNumberOfExternalNodes() != 10 ) {
2993                 return false;
2994             }
2995             if ( t8.getHeight() != 15 ) {
2996                 return false;
2997             }
2998             final char[] a9 = new char[] { 'a' };
2999             final Phylogeny t9 = factory.create( a9, new NHXParser() )[ 0 ];
3000             if ( t9.getHeight() != 0 ) {
3001                 return false;
3002             }
3003             final char[] a10 = new char[] { 'a', ':', '6' };
3004             final Phylogeny t10 = factory.create( a10, new NHXParser() )[ 0 ];
3005             if ( t10.getHeight() != 6 ) {
3006                 return false;
3007             }
3008         }
3009         catch ( final Exception e ) {
3010             e.printStackTrace( System.out );
3011             return false;
3012         }
3013         return true;
3014     }
3015
3016     private static boolean testConfidenceAssessor() {
3017         try {
3018             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
3019             final Phylogeny t0 = factory.create( "((((A,B)ab,C)abc,D)abcd,E)abcde", new NHXParser() )[ 0 ];
3020             final Phylogeny[] ev0 = factory
3021                     .create( "((((A,B),C),D),E);((((A,B),C),D),E);((((A,B),C),D),E);((((A,B),C),D),E);",
3022                              new NHXParser() );
3023             ConfidenceAssessor.evaluate( "bootstrap", ev0, t0, false, 1, 0, 2 );
3024             if ( !isEqual( t0.getNode( "ab" ).getBranchData().getConfidence( 0 ).getValue(), 3 ) ) {
3025                 return false;
3026             }
3027             if ( !isEqual( t0.getNode( "abc" ).getBranchData().getConfidence( 0 ).getValue(), 3 ) ) {
3028                 return false;
3029             }
3030             final Phylogeny t1 = factory.create( "((((A,B)ab[&&NHX:B=50],C)abc,D)abcd,E)abcde", new NHXParser() )[ 0 ];
3031             final Phylogeny[] ev1 = factory
3032                     .create( "((((A,B),C),D),E);((A,B),((E,D),C));(((A,B),C),(E,D));(A,(((E,D),C),B));(B,(A,((E,D),C)));(C,((E,D),(A,B)));(D,(E,((A,B),C)));",
3033                              new NHXParser() );
3034             ConfidenceAssessor.evaluate( "bootstrap", ev1, t1, false, 1 );
3035             if ( !isEqual( t1.getNode( "ab" ).getBranchData().getConfidence( 1 ).getValue(), 7 ) ) {
3036                 return false;
3037             }
3038             if ( !isEqual( t1.getNode( "abc" ).getBranchData().getConfidence( 0 ).getValue(), 7 ) ) {
3039                 return false;
3040             }
3041             final Phylogeny t_b = factory.create( "((((A,C)ac,D)acd,E)acde,B)abcde", new NHXParser() )[ 0 ];
3042             final Phylogeny[] ev_b = factory
3043                     .create( "((A,C),X);((A,X),C);(A,C);((((A,B),C),D),E);((A,B),((E,D),C));(((A,B),C),(E,D));(A,(((E,D),C),B));(B,(A,((E,D),C)));(C,((E,D),(A,B)));(D,(E,((A,B),C)));((((A,C)ac,D)acd,E)acde,B)abcd",
3044                              new NHXParser() );
3045             ConfidenceAssessor.evaluate( "bootstrap", ev_b, t_b, false, 1 );
3046             if ( !isEqual( t_b.getNode( "ac" ).getBranchData().getConfidence( 0 ).getValue(), 4 ) ) {
3047                 return false;
3048             }
3049             if ( !isEqual( t_b.getNode( "acd" ).getBranchData().getConfidence( 0 ).getValue(), 1 ) ) {
3050                 return false;
3051             }
3052             //
3053             final Phylogeny t1x = factory.create( "((((A,B)ab,C)abc,D)abcd,E)abcde", new NHXParser() )[ 0 ];
3054             final Phylogeny[] ev1x = factory
3055                     .create( "((((A,B),C),D),E);((A,B),((E,D),C));(((A,B),C),(E,D));(A,(((E,D),C),B));(B,(A,((E,D),C)));(C,((E,D),(A,B)));(D,(E,((A,B),C)));",
3056                              new NHXParser() );
3057             ConfidenceAssessor.evaluate( "bootstrap", ev1x, t1x, true, 1 );
3058             if ( !isEqual( t1x.getNode( "ab" ).getBranchData().getConfidence( 0 ).getValue(), 7 ) ) {
3059                 return false;
3060             }
3061             if ( !isEqual( t1x.getNode( "abc" ).getBranchData().getConfidence( 0 ).getValue(), 7 ) ) {
3062                 return false;
3063             }
3064             final Phylogeny t_bx = factory.create( "((((A,C)ac,D)acd,E)acde,B)abcde", new NHXParser() )[ 0 ];
3065             final Phylogeny[] ev_bx = factory
3066                     .create( "((((A,B),C),D),E);((A,B),((E,D),C));(((A,B),C),(E,D));(A,(((E,D),C),B));(B,(A,((E,D),C)));(C,((E,D),(A,B)));(D,(E,((A,B),C)));((((A,C)ac,D)acd,E)acde,B)abcd",
3067                              new NHXParser() );
3068             ConfidenceAssessor.evaluate( "bootstrap", ev_bx, t_bx, true, 1 );
3069             if ( !isEqual( t_bx.getNode( "ac" ).getBranchData().getConfidence( 0 ).getValue(), 1 ) ) {
3070                 return false;
3071             }
3072             if ( !isEqual( t_bx.getNode( "acd" ).getBranchData().getConfidence( 0 ).getValue(), 1 ) ) {
3073                 return false;
3074             }
3075             final Phylogeny[] t2 = factory
3076                     .create( "((((a,b),c),d),e);(((a,b),c),(d,e));(((((a,b),c),d),e),f);((((a,b),c),(d,e)),f);(((a,b),c),d,e);((a,b,c),d,e);",
3077                              new NHXParser() );
3078             final Phylogeny[] ev2 = factory
3079                     .create( "((((a,b),c),d),e);((((a,b),c),d),e);((((a,b),e),d),c);((((a,b),e),d),c);(((a,b),(c,d)),e);((a,b),x);((a,b),(x,y));(a,b);(a,e);(a,b,c);",
3080                              new NHXParser() );
3081             for( final Phylogeny target : t2 ) {
3082                 ConfidenceAssessor.evaluate( "bootstrap", ev2, target, false, 1 );
3083             }
3084             final Phylogeny t4 = factory.create( "((((((A,B)ab,C)abc,D)abcd,E)abcde,F)abcdef,G)abcdefg",
3085                                                  new NHXParser() )[ 0 ];
3086             final Phylogeny[] ev4 = factory.create( "(((A,B),C),(X,Y));((F,G),((A,B,C),(D,E)))", new NHXParser() );
3087             ConfidenceAssessor.evaluate( "bootstrap", ev4, t4, false, 1 );
3088             if ( !isEqual( t4.getNode( "ab" ).getBranchData().getConfidence( 0 ).getValue(), 1 ) ) {
3089                 return false;
3090             }
3091             if ( !isEqual( t4.getNode( "abc" ).getBranchData().getConfidence( 0 ).getValue(), 2 ) ) {
3092                 return false;
3093             }
3094             if ( !isEqual( t4.getNode( "abcde" ).getBranchData().getConfidence( 0 ).getValue(), 1 ) ) {
3095                 return false;
3096             }
3097         }
3098         catch ( final Exception e ) {
3099             e.printStackTrace();
3100             return false;
3101         }
3102         return true;
3103     }
3104
3105     private static boolean testCopyOfNodeData() {
3106         try {
3107             final PhylogenyNode n1 = PhylogenyNode
3108                     .createInstanceFromNhxString( "n5:0.1[&&NHX:S=Ecoli:E=1.1.1.1:D=Y:Co=Y:B=56:T=1:O=22:SO=33:SN=44:W=2:C=10.20.30:XN=S=tag1=value1=unit1]" );
3109             final PhylogenyNode n2 = n1.copyNodeData();
3110             if ( !n1.toNewHampshireX().equals( n2.toNewHampshireX() ) ) {
3111                 return false;
3112             }
3113         }
3114         catch ( final Exception e ) {
3115             e.printStackTrace();
3116             return false;
3117         }
3118         return true;
3119     }
3120
3121     private static boolean testCreateBalancedPhylogeny() {
3122         try {
3123             final Phylogeny p0 = DevelopmentTools.createBalancedPhylogeny( 6, 5 );
3124             if ( p0.getRoot().getNumberOfDescendants() != 5 ) {
3125                 return false;
3126             }
3127             if ( p0.getNumberOfExternalNodes() != 15625 ) {
3128                 return false;
3129             }
3130             final Phylogeny p1 = DevelopmentTools.createBalancedPhylogeny( 2, 10 );
3131             if ( p1.getRoot().getNumberOfDescendants() != 10 ) {
3132                 return false;
3133             }
3134             if ( p1.getNumberOfExternalNodes() != 100 ) {
3135                 return false;
3136             }
3137         }
3138         catch ( final Exception e ) {
3139             e.printStackTrace();
3140             return false;
3141         }
3142         return true;
3143     }
3144
3145     private static boolean testCreateUriForSeqWeb() {
3146         try {
3147             final PhylogenyNode n = new PhylogenyNode();
3148             n.setName( "tr|B3RJ64" );
3149             if ( !TreePanelUtil.createUriForSeqWeb( n, null, null ).equals( ForesterUtil.UNIPROT_KB + "B3RJ64" ) ) {
3150                 return false;
3151             }
3152             n.setName( "B0LM41_HUMAN" );
3153             if ( !TreePanelUtil.createUriForSeqWeb( n, null, null ).equals( ForesterUtil.UNIPROT_KB + "B0LM41_HUMAN" ) ) {
3154                 return false;
3155             }
3156             n.setName( "NP_001025424" );
3157             if ( !TreePanelUtil.createUriForSeqWeb( n, null, null ).equals( ForesterUtil.NCBI_PROTEIN + "NP_001025424" ) ) {
3158                 return false;
3159             }
3160             n.setName( "_NM_001030253-" );
3161             if ( !TreePanelUtil.createUriForSeqWeb( n, null, null ).equals( ForesterUtil.NCBI_NUCCORE + "NM_001030253" ) ) {
3162                 return false;
3163             }
3164             n.setName( "XM_002122186" );
3165             if ( !TreePanelUtil.createUriForSeqWeb( n, null, null ).equals( ForesterUtil.NCBI_NUCCORE + "XM_002122186" ) ) {
3166                 return false;
3167             }
3168             n.setName( "dgh_AAA34956_gdg" );
3169             if ( !TreePanelUtil.createUriForSeqWeb( n, null, null ).equals( ForesterUtil.NCBI_PROTEIN + "AAA34956" ) ) {
3170                 return false;
3171             }
3172             n.setName( "AAA34956" );
3173             if ( !TreePanelUtil.createUriForSeqWeb( n, null, null ).equals( ForesterUtil.NCBI_PROTEIN + "AAA34956" ) ) {
3174                 return false;
3175             }
3176             n.setName( "GI:394892" );
3177             if ( !TreePanelUtil.createUriForSeqWeb( n, null, null ).equals( ForesterUtil.NCBI_GI + "394892" ) ) {
3178                 System.out.println( TreePanelUtil.createUriForSeqWeb( n, null, null ) );
3179                 return false;
3180             }
3181             n.setName( "gi_394892" );
3182             if ( !TreePanelUtil.createUriForSeqWeb( n, null, null ).equals( ForesterUtil.NCBI_GI + "394892" ) ) {
3183                 System.out.println( TreePanelUtil.createUriForSeqWeb( n, null, null ) );
3184                 return false;
3185             }
3186             n.setName( "gi6335_gi_394892_56635_Gi_43" );
3187             if ( !TreePanelUtil.createUriForSeqWeb( n, null, null ).equals( ForesterUtil.NCBI_GI + "394892" ) ) {
3188                 System.out.println( TreePanelUtil.createUriForSeqWeb( n, null, null ) );
3189                 return false;
3190             }
3191             n.setName( "P12345" );
3192             if ( !TreePanelUtil.createUriForSeqWeb( n, null, null ).equals( ForesterUtil.UNIPROT_KB + "P12345" ) ) {
3193                 System.out.println( TreePanelUtil.createUriForSeqWeb( n, null, null ) );
3194                 return false;
3195             }
3196             n.setName( "gi_fdgjmn-3jk5-243 mnefmn fg023-0 P12345 4395jtmnsrg02345m1ggi92450jrg890j4t0j240" );
3197             if ( !TreePanelUtil.createUriForSeqWeb( n, null, null ).equals( ForesterUtil.UNIPROT_KB + "P12345" ) ) {
3198                 System.out.println( TreePanelUtil.createUriForSeqWeb( n, null, null ) );
3199                 return false;
3200             }
3201         }
3202         catch ( final Exception e ) {
3203             e.printStackTrace( System.out );
3204             return false;
3205         }
3206         return true;
3207     }
3208
3209     private static boolean testDataObjects() {
3210         try {
3211             final Confidence s0 = new Confidence();
3212             final Confidence s1 = new Confidence();
3213             if ( !s0.isEqual( s1 ) ) {
3214                 return false;
3215             }
3216             final Confidence s2 = new Confidence( 0.23, "bootstrap" );
3217             final Confidence s3 = new Confidence( 0.23, "bootstrap" );
3218             if ( s2.isEqual( s1 ) ) {
3219                 return false;
3220             }
3221             if ( !s2.isEqual( s3 ) ) {
3222                 return false;
3223             }
3224             final Confidence s4 = ( Confidence ) s3.copy();
3225             if ( !s4.isEqual( s3 ) ) {
3226                 return false;
3227             }
3228             s3.asSimpleText();
3229             s3.asText();
3230             // Taxonomy
3231             // ----------
3232             final Taxonomy t1 = new Taxonomy();
3233             final Taxonomy t2 = new Taxonomy();
3234             final Taxonomy t3 = new Taxonomy();
3235             final Taxonomy t4 = new Taxonomy();
3236             final Taxonomy t5 = new Taxonomy();
3237             t1.setIdentifier( new Identifier( "ecoli" ) );
3238             t1.setTaxonomyCode( "ECOLI" );
3239             t1.setScientificName( "E. coli" );
3240             t1.setCommonName( "coli" );
3241             final Taxonomy t0 = ( Taxonomy ) t1.copy();
3242             if ( !t1.isEqual( t0 ) ) {
3243                 return false;
3244             }
3245             t2.setIdentifier( new Identifier( "ecoli" ) );
3246             t2.setTaxonomyCode( "OTHER" );
3247             t2.setScientificName( "what" );
3248             t2.setCommonName( "something" );
3249             if ( !t1.isEqual( t2 ) ) {
3250                 return false;
3251             }
3252             t2.setIdentifier( new Identifier( "nemve" ) );
3253             if ( t1.isEqual( t2 ) ) {
3254                 return false;
3255             }
3256             t1.setIdentifier( null );
3257             t3.setTaxonomyCode( "ECOLI" );
3258             t3.setScientificName( "what" );
3259             t3.setCommonName( "something" );
3260             if ( !t1.isEqual( t3 ) ) {
3261                 return false;
3262             }
3263             t1.setIdentifier( null );
3264             t1.setTaxonomyCode( "" );
3265             t4.setScientificName( "E. ColI" );
3266             t4.setCommonName( "something" );
3267             if ( !t1.isEqual( t4 ) ) {
3268                 return false;
3269             }
3270             t4.setScientificName( "B. subtilis" );
3271             t4.setCommonName( "something" );
3272             if ( t1.isEqual( t4 ) ) {
3273                 return false;
3274             }
3275             t1.setIdentifier( null );
3276             t1.setTaxonomyCode( "" );
3277             t1.setScientificName( "" );
3278             t5.setCommonName( "COLI" );
3279             if ( !t1.isEqual( t5 ) ) {
3280                 return false;
3281             }
3282             t5.setCommonName( "vibrio" );
3283             if ( t1.isEqual( t5 ) ) {
3284                 return false;
3285             }
3286             // Identifier
3287             // ----------
3288             final Identifier id0 = new Identifier( "123", "pfam" );
3289             final Identifier id1 = ( Identifier ) id0.copy();
3290             if ( !id1.isEqual( id1 ) ) {
3291                 return false;
3292             }
3293             if ( !id1.isEqual( id0 ) ) {
3294                 return false;
3295             }
3296             if ( !id0.isEqual( id1 ) ) {
3297                 return false;
3298             }
3299             id1.asSimpleText();
3300             id1.asText();
3301             // ProteinDomain
3302             // ---------------
3303             final ProteinDomain pd0 = new ProteinDomain( "abc", 100, 200 );
3304             final ProteinDomain pd1 = ( ProteinDomain ) pd0.copy();
3305             if ( !pd1.isEqual( pd1 ) ) {
3306                 return false;
3307             }
3308             if ( !pd1.isEqual( pd0 ) ) {
3309                 return false;
3310             }
3311             pd1.asSimpleText();
3312             pd1.asText();
3313             final ProteinDomain pd2 = new ProteinDomain( pd0.getName(), pd0.getFrom(), pd0.getTo(), "id" );
3314             final ProteinDomain pd3 = ( ProteinDomain ) pd2.copy();
3315             if ( !pd3.isEqual( pd3 ) ) {
3316                 return false;
3317             }
3318             if ( !pd2.isEqual( pd3 ) ) {
3319                 return false;
3320             }
3321             if ( !pd0.isEqual( pd3 ) ) {
3322                 return false;
3323             }
3324             pd3.asSimpleText();
3325             pd3.asText();
3326             // DomainArchitecture
3327             // ------------------
3328             final ProteinDomain d0 = new ProteinDomain( "domain0", 10, 20 );
3329             final ProteinDomain d1 = new ProteinDomain( "domain1", 30, 40 );
3330             final ProteinDomain d2 = new ProteinDomain( "domain2", 50, 60 );
3331             final ProteinDomain d3 = new ProteinDomain( "domain3", 70, 80 );
3332             final ProteinDomain d4 = new ProteinDomain( "domain4", 90, 100 );
3333             final ArrayList<PhylogenyData> domains0 = new ArrayList<PhylogenyData>();
3334             domains0.add( d2 );
3335             domains0.add( d0 );
3336             domains0.add( d3 );
3337             domains0.add( d1 );
3338             final DomainArchitecture ds0 = new DomainArchitecture( domains0, 110 );
3339             if ( ds0.getNumberOfDomains() != 4 ) {
3340                 return false;
3341             }
3342             final DomainArchitecture ds1 = ( DomainArchitecture ) ds0.copy();
3343             if ( !ds0.isEqual( ds0 ) ) {
3344                 return false;
3345             }
3346             if ( !ds0.isEqual( ds1 ) ) {
3347                 return false;
3348             }
3349             if ( ds1.getNumberOfDomains() != 4 ) {
3350                 return false;
3351             }
3352             final ArrayList<PhylogenyData> domains1 = new ArrayList<PhylogenyData>();
3353             domains1.add( d1 );
3354             domains1.add( d2 );
3355             domains1.add( d4 );
3356             domains1.add( d0 );
3357             final DomainArchitecture ds2 = new DomainArchitecture( domains1, 200 );
3358             if ( ds0.isEqual( ds2 ) ) {
3359                 return false;
3360             }
3361             ds1.asSimpleText();
3362             ds1.asText();
3363             ds1.toNHX();
3364             final DomainArchitecture ds3 = new DomainArchitecture( "120>30>40>0.9>b>50>60>0.4>c>10>20>0.1>a" );
3365             if ( !ds3.toNHX().toString().equals( ":DS=120>10>20>0.1>a>30>40>0.9>b>50>60>0.4>c" ) ) {
3366                 System.out.println( ds3.toNHX() );
3367                 return false;
3368             }
3369             if ( ds3.getNumberOfDomains() != 3 ) {
3370                 return false;
3371             }
3372             // Event
3373             // -----
3374             final Event e1 = new Event( Event.EventType.fusion );
3375             if ( e1.isDuplication() ) {
3376                 return false;
3377             }
3378             if ( !e1.isFusion() ) {
3379                 return false;
3380             }
3381             if ( !e1.asText().toString().equals( "fusion" ) ) {
3382                 return false;
3383             }
3384             if ( !e1.asSimpleText().toString().equals( "fusion" ) ) {
3385                 return false;
3386             }
3387             final Event e11 = new Event( Event.EventType.fusion );
3388             if ( !e11.isEqual( e1 ) ) {
3389                 return false;
3390             }
3391             if ( !e11.toNHX().toString().equals( "" ) ) {
3392                 return false;
3393             }
3394             final Event e2 = new Event( Event.EventType.speciation_or_duplication );
3395             if ( e2.isDuplication() ) {
3396                 return false;
3397             }
3398             if ( !e2.isSpeciationOrDuplication() ) {
3399                 return false;
3400             }
3401             if ( !e2.asText().toString().equals( "speciation_or_duplication" ) ) {
3402                 return false;
3403             }
3404             if ( !e2.asSimpleText().toString().equals( "?" ) ) {
3405                 return false;
3406             }
3407             if ( !e2.toNHX().toString().equals( ":D=?" ) ) {
3408                 return false;
3409             }
3410             if ( e11.isEqual( e2 ) ) {
3411                 return false;
3412             }
3413             final Event e2c = ( Event ) e2.copy();
3414             if ( !e2c.isEqual( e2 ) ) {
3415                 return false;
3416             }
3417             Event e3 = new Event( 1, 2, 3 );
3418             if ( e3.isDuplication() ) {
3419                 return false;
3420             }
3421             if ( e3.isSpeciation() ) {
3422                 return false;
3423             }
3424             if ( e3.isGeneLoss() ) {
3425                 return false;
3426             }
3427             if ( !e3.asText().toString().equals( "duplications [1] speciations [2] gene-losses [3]" ) ) {
3428                 return false;
3429             }
3430             final Event e3c = ( Event ) e3.copy();
3431             final Event e3cc = ( Event ) e3c.copy();
3432             if ( !e3c.asSimpleText().toString().equals( "D2S3L" ) ) {
3433                 return false;
3434             }
3435             e3 = null;
3436             if ( !e3c.isEqual( e3cc ) ) {
3437                 return false;
3438             }
3439             Event e4 = new Event( 1, 2, 3 );
3440             if ( !e4.asText().toString().equals( "duplications [1] speciations [2] gene-losses [3]" ) ) {
3441                 return false;
3442             }
3443             if ( !e4.asSimpleText().toString().equals( "D2S3L" ) ) {
3444                 return false;
3445             }
3446             final Event e4c = ( Event ) e4.copy();
3447             e4 = null;
3448             final Event e4cc = ( Event ) e4c.copy();
3449             if ( !e4cc.asText().toString().equals( "duplications [1] speciations [2] gene-losses [3]" ) ) {
3450                 return false;
3451             }
3452             if ( !e4c.isEqual( e4cc ) ) {
3453                 return false;
3454             }
3455             final Event e5 = new Event();
3456             if ( !e5.isUnassigned() ) {
3457                 return false;
3458             }
3459             if ( !e5.asText().toString().equals( "unassigned" ) ) {
3460                 return false;
3461             }
3462             if ( !e5.asSimpleText().toString().equals( "" ) ) {
3463                 return false;
3464             }
3465             final Event e6 = new Event( 1, 0, 0 );
3466             if ( !e6.asText().toString().equals( "duplication" ) ) {
3467                 return false;
3468             }
3469             if ( !e6.asSimpleText().toString().equals( "D" ) ) {
3470                 return false;
3471             }
3472             final Event e7 = new Event( 0, 1, 0 );
3473             if ( !e7.asText().toString().equals( "speciation" ) ) {
3474                 return false;
3475             }
3476             if ( !e7.asSimpleText().toString().equals( "S" ) ) {
3477                 return false;
3478             }
3479             final Event e8 = new Event( 0, 0, 1 );
3480             if ( !e8.asText().toString().equals( "gene-loss" ) ) {
3481                 return false;
3482             }
3483             if ( !e8.asSimpleText().toString().equals( "L" ) ) {
3484                 return false;
3485             }
3486         }
3487         catch ( final Exception e ) {
3488             e.printStackTrace( System.out );
3489             return false;
3490         }
3491         return true;
3492     }
3493
3494     private static boolean testDeletionOfExternalNodes() {
3495         try {
3496             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
3497             final Phylogeny t0 = factory.create( "A", new NHXParser() )[ 0 ];
3498             final PhylogenyWriter w = new PhylogenyWriter();
3499             if ( t0.isEmpty() ) {
3500                 return false;
3501             }
3502             if ( t0.getNumberOfExternalNodes() != 1 ) {
3503                 return false;
3504             }
3505             t0.deleteSubtree( t0.getNode( "A" ), false );
3506             if ( t0.getNumberOfExternalNodes() != 0 ) {
3507                 return false;
3508             }
3509             if ( !t0.isEmpty() ) {
3510                 return false;
3511             }
3512             final Phylogeny t1 = factory.create( "(A,B)r", new NHXParser() )[ 0 ];
3513             if ( t1.getNumberOfExternalNodes() != 2 ) {
3514                 return false;
3515             }
3516             t1.deleteSubtree( t1.getNode( "A" ), false );
3517             if ( t1.getNumberOfExternalNodes() != 1 ) {
3518                 return false;
3519             }
3520             if ( !t1.getNode( "B" ).getName().equals( "B" ) ) {
3521                 return false;
3522             }
3523             t1.deleteSubtree( t1.getNode( "B" ), false );
3524             if ( t1.getNumberOfExternalNodes() != 1 ) {
3525                 return false;
3526             }
3527             t1.deleteSubtree( t1.getNode( "r" ), false );
3528             if ( !t1.isEmpty() ) {
3529                 return false;
3530             }
3531             final Phylogeny t2 = factory.create( "((A,B),C)", new NHXParser() )[ 0 ];
3532             if ( t2.getNumberOfExternalNodes() != 3 ) {
3533                 return false;
3534             }
3535             t2.deleteSubtree( t2.getNode( "B" ), false );
3536             if ( t2.getNumberOfExternalNodes() != 2 ) {
3537                 return false;
3538             }
3539             t2.toNewHampshireX();
3540             PhylogenyNode n = t2.getNode( "A" );
3541             if ( !n.getNextExternalNode().getName().equals( "C" ) ) {
3542                 return false;
3543             }
3544             t2.deleteSubtree( t2.getNode( "A" ), false );
3545             if ( t2.getNumberOfExternalNodes() != 2 ) {
3546                 return false;
3547             }
3548             t2.deleteSubtree( t2.getNode( "C" ), true );
3549             if ( t2.getNumberOfExternalNodes() != 1 ) {
3550                 return false;
3551             }
3552             final Phylogeny t3 = factory.create( "((A,B),(C,D))", new NHXParser() )[ 0 ];
3553             if ( t3.getNumberOfExternalNodes() != 4 ) {
3554                 return false;
3555             }
3556             t3.deleteSubtree( t3.getNode( "B" ), true );
3557             if ( t3.getNumberOfExternalNodes() != 3 ) {
3558                 return false;
3559             }
3560             n = t3.getNode( "A" );
3561             if ( !n.getNextExternalNode().getName().equals( "C" ) ) {
3562                 return false;
3563             }
3564             n = n.getNextExternalNode();
3565             if ( !n.getNextExternalNode().getName().equals( "D" ) ) {
3566                 return false;
3567             }
3568             t3.deleteSubtree( t3.getNode( "A" ), true );
3569             if ( t3.getNumberOfExternalNodes() != 2 ) {
3570                 return false;
3571             }
3572             n = t3.getNode( "C" );
3573             if ( !n.getNextExternalNode().getName().equals( "D" ) ) {
3574                 return false;
3575             }
3576             t3.deleteSubtree( t3.getNode( "C" ), true );
3577             if ( t3.getNumberOfExternalNodes() != 1 ) {
3578                 return false;
3579             }
3580             t3.deleteSubtree( t3.getNode( "D" ), true );
3581             if ( t3.getNumberOfExternalNodes() != 0 ) {
3582                 return false;
3583             }
3584             final Phylogeny t4 = factory.create( "((A,((B11,B12),B2)),(C,D))", new NHXParser() )[ 0 ];
3585             if ( t4.getNumberOfExternalNodes() != 6 ) {
3586                 return false;
3587             }
3588             t4.deleteSubtree( t4.getNode( "B2" ), true );
3589             if ( t4.getNumberOfExternalNodes() != 5 ) {
3590                 return false;
3591             }
3592             String s = w.toNewHampshire( t4, true ).toString();
3593             if ( !s.equals( "((A,(B11,B12)),(C,D));" ) ) {
3594                 return false;
3595             }
3596             t4.deleteSubtree( t4.getNode( "B11" ), true );
3597             if ( t4.getNumberOfExternalNodes() != 4 ) {
3598                 return false;
3599             }
3600             t4.deleteSubtree( t4.getNode( "C" ), true );
3601             if ( t4.getNumberOfExternalNodes() != 3 ) {
3602                 return false;
3603             }
3604             n = t4.getNode( "A" );
3605             n = n.getNextExternalNode();
3606             if ( !n.getName().equals( "B12" ) ) {
3607                 return false;
3608             }
3609             n = n.getNextExternalNode();
3610             if ( !n.getName().equals( "D" ) ) {
3611                 return false;
3612             }
3613             s = w.toNewHampshire( t4, true ).toString();
3614             if ( !s.equals( "((A,B12),D);" ) ) {
3615                 return false;
3616             }
3617             final Phylogeny t5 = factory.create( "((A,((B11,B12),B2)),(C,D))", new NHXParser() )[ 0 ];
3618             t5.deleteSubtree( t5.getNode( "A" ), true );
3619             if ( t5.getNumberOfExternalNodes() != 5 ) {
3620                 return false;
3621             }
3622             s = w.toNewHampshire( t5, true ).toString();
3623             if ( !s.equals( "(((B11,B12),B2),(C,D));" ) ) {
3624                 return false;
3625             }
3626             final Phylogeny t6 = factory.create( "((A,((B11,B12),B2)),(C,D))", new NHXParser() )[ 0 ];
3627             t6.deleteSubtree( t6.getNode( "B11" ), true );
3628             if ( t6.getNumberOfExternalNodes() != 5 ) {
3629                 return false;
3630             }
3631             s = w.toNewHampshire( t6, false ).toString();
3632             if ( !s.equals( "((A,(B12,B2)),(C,D));" ) ) {
3633                 return false;
3634             }
3635             final Phylogeny t7 = factory.create( "((A,((B11,B12),B2)),(C,D))", new NHXParser() )[ 0 ];
3636             t7.deleteSubtree( t7.getNode( "B12" ), true );
3637             if ( t7.getNumberOfExternalNodes() != 5 ) {
3638                 return false;
3639             }
3640             s = w.toNewHampshire( t7, true ).toString();
3641             if ( !s.equals( "((A,(B11,B2)),(C,D));" ) ) {
3642                 return false;
3643             }
3644             final Phylogeny t8 = factory.create( "((A,((B11,B12),B2)),(C,D))", new NHXParser() )[ 0 ];
3645             t8.deleteSubtree( t8.getNode( "B2" ), true );
3646             if ( t8.getNumberOfExternalNodes() != 5 ) {
3647                 return false;
3648             }
3649             s = w.toNewHampshire( t8, false ).toString();
3650             if ( !s.equals( "((A,(B11,B12)),(C,D));" ) ) {
3651                 return false;
3652             }
3653             final Phylogeny t9 = factory.create( "((A,((B11,B12),B2)),(C,D))", new NHXParser() )[ 0 ];
3654             t9.deleteSubtree( t9.getNode( "C" ), true );
3655             if ( t9.getNumberOfExternalNodes() != 5 ) {
3656                 return false;
3657             }
3658             s = w.toNewHampshire( t9, true ).toString();
3659             if ( !s.equals( "((A,((B11,B12),B2)),D);" ) ) {
3660                 return false;
3661             }
3662             final Phylogeny t10 = factory.create( "((A,((B11,B12),B2)),(C,D))", new NHXParser() )[ 0 ];
3663             t10.deleteSubtree( t10.getNode( "D" ), true );
3664             if ( t10.getNumberOfExternalNodes() != 5 ) {
3665                 return false;
3666             }
3667             s = w.toNewHampshire( t10, true ).toString();
3668             if ( !s.equals( "((A,((B11,B12),B2)),C);" ) ) {
3669                 return false;
3670             }
3671             final Phylogeny t11 = factory.create( "(A,B,C)", new NHXParser() )[ 0 ];
3672             t11.deleteSubtree( t11.getNode( "A" ), true );
3673             if ( t11.getNumberOfExternalNodes() != 2 ) {
3674                 return false;
3675             }
3676             s = w.toNewHampshire( t11, true ).toString();
3677             if ( !s.equals( "(B,C);" ) ) {
3678                 return false;
3679             }
3680             t11.deleteSubtree( t11.getNode( "C" ), true );
3681             if ( t11.getNumberOfExternalNodes() != 1 ) {
3682                 return false;
3683             }
3684             s = w.toNewHampshire( t11, false ).toString();
3685             if ( !s.equals( "B;" ) ) {
3686                 return false;
3687             }
3688             final Phylogeny t12 = factory.create( "((A1,A2,A3),(B1,B2,B3),(C1,C2,C3))", new NHXParser() )[ 0 ];
3689             t12.deleteSubtree( t12.getNode( "B2" ), true );
3690             if ( t12.getNumberOfExternalNodes() != 8 ) {
3691                 return false;
3692             }
3693             s = w.toNewHampshire( t12, true ).toString();
3694             if ( !s.equals( "((A1,A2,A3),(B1,B3),(C1,C2,C3));" ) ) {
3695                 return false;
3696             }
3697             t12.deleteSubtree( t12.getNode( "B3" ), true );
3698             if ( t12.getNumberOfExternalNodes() != 7 ) {
3699                 return false;
3700             }
3701             s = w.toNewHampshire( t12, true ).toString();
3702             if ( !s.equals( "((A1,A2,A3),B1,(C1,C2,C3));" ) ) {
3703                 return false;
3704             }
3705             t12.deleteSubtree( t12.getNode( "C3" ), true );
3706             if ( t12.getNumberOfExternalNodes() != 6 ) {
3707                 return false;
3708             }
3709             s = w.toNewHampshire( t12, true ).toString();
3710             if ( !s.equals( "((A1,A2,A3),B1,(C1,C2));" ) ) {
3711                 return false;
3712             }
3713             t12.deleteSubtree( t12.getNode( "A1" ), true );
3714             if ( t12.getNumberOfExternalNodes() != 5 ) {
3715                 return false;
3716             }
3717             s = w.toNewHampshire( t12, true ).toString();
3718             if ( !s.equals( "((A2,A3),B1,(C1,C2));" ) ) {
3719                 return false;
3720             }
3721             t12.deleteSubtree( t12.getNode( "B1" ), true );
3722             if ( t12.getNumberOfExternalNodes() != 4 ) {
3723                 return false;
3724             }
3725             s = w.toNewHampshire( t12, true ).toString();
3726             if ( !s.equals( "((A2,A3),(C1,C2));" ) ) {
3727                 return false;
3728             }
3729             t12.deleteSubtree( t12.getNode( "A3" ), true );
3730             if ( t12.getNumberOfExternalNodes() != 3 ) {
3731                 return false;
3732             }
3733             s = w.toNewHampshire( t12, true ).toString();
3734             if ( !s.equals( "(A2,(C1,C2));" ) ) {
3735                 return false;
3736             }
3737             t12.deleteSubtree( t12.getNode( "A2" ), true );
3738             if ( t12.getNumberOfExternalNodes() != 2 ) {
3739                 return false;
3740             }
3741             s = w.toNewHampshire( t12, true ).toString();
3742             if ( !s.equals( "(C1,C2);" ) ) {
3743                 return false;
3744             }
3745             final Phylogeny t13 = factory.create( "(A,B,C,(D:1.0,E:2.0):3.0)", new NHXParser() )[ 0 ];
3746             t13.deleteSubtree( t13.getNode( "D" ), true );
3747             if ( t13.getNumberOfExternalNodes() != 4 ) {
3748                 return false;
3749             }
3750             s = w.toNewHampshire( t13, true ).toString();
3751             if ( !s.equals( "(A,B,C,E:5.0);" ) ) {
3752                 return false;
3753             }
3754             final Phylogeny t14 = factory.create( "((A,B,C,(D:0.1,E:0.4):1.0),F)", new NHXParser() )[ 0 ];
3755             t14.deleteSubtree( t14.getNode( "E" ), true );
3756             if ( t14.getNumberOfExternalNodes() != 5 ) {
3757                 return false;
3758             }
3759             s = w.toNewHampshire( t14, true ).toString();
3760             if ( !s.equals( "((A,B,C,D:1.1),F);" ) ) {
3761                 return false;
3762             }
3763             final Phylogeny t15 = factory.create( "((A1,A2,A3,A4),(B1,B2,B3,B4),(C1,C2,C3,C4))", new NHXParser() )[ 0 ];
3764             t15.deleteSubtree( t15.getNode( "B2" ), true );
3765             if ( t15.getNumberOfExternalNodes() != 11 ) {
3766                 return false;
3767             }
3768             t15.deleteSubtree( t15.getNode( "B1" ), true );
3769             if ( t15.getNumberOfExternalNodes() != 10 ) {
3770                 return false;
3771             }
3772             t15.deleteSubtree( t15.getNode( "B3" ), true );
3773             if ( t15.getNumberOfExternalNodes() != 9 ) {
3774                 return false;
3775             }
3776             t15.deleteSubtree( t15.getNode( "B4" ), true );
3777             if ( t15.getNumberOfExternalNodes() != 8 ) {
3778                 return false;
3779             }
3780             t15.deleteSubtree( t15.getNode( "A1" ), true );
3781             if ( t15.getNumberOfExternalNodes() != 7 ) {
3782                 return false;
3783             }
3784             t15.deleteSubtree( t15.getNode( "C4" ), true );
3785             if ( t15.getNumberOfExternalNodes() != 6 ) {
3786                 return false;
3787             }
3788         }
3789         catch ( final Exception e ) {
3790             e.printStackTrace( System.out );
3791             return false;
3792         }
3793         return true;
3794     }
3795
3796     private static boolean testDescriptiveStatistics() {
3797         try {
3798             final DescriptiveStatistics dss1 = new BasicDescriptiveStatistics();
3799             dss1.addValue( 82 );
3800             dss1.addValue( 78 );
3801             dss1.addValue( 70 );
3802             dss1.addValue( 58 );
3803             dss1.addValue( 42 );
3804             if ( dss1.getN() != 5 ) {
3805                 return false;
3806             }
3807             if ( !Test.isEqual( dss1.getMin(), 42 ) ) {
3808                 return false;
3809             }
3810             if ( !Test.isEqual( dss1.getMax(), 82 ) ) {
3811                 return false;
3812             }
3813             if ( !Test.isEqual( dss1.arithmeticMean(), 66 ) ) {
3814                 return false;
3815             }
3816             if ( !Test.isEqual( dss1.sampleStandardDeviation(), 16.24807680927192 ) ) {
3817                 return false;
3818             }
3819             if ( !Test.isEqual( dss1.median(), 70 ) ) {
3820                 return false;
3821             }
3822             if ( !Test.isEqual( dss1.midrange(), 62 ) ) {
3823                 return false;
3824             }
3825             if ( !Test.isEqual( dss1.sampleVariance(), 264 ) ) {
3826                 return false;
3827             }
3828             if ( !Test.isEqual( dss1.pearsonianSkewness(), -0.7385489458759964 ) ) {
3829                 return false;
3830             }
3831             if ( !Test.isEqual( dss1.coefficientOfVariation(), 0.24618298195866547 ) ) {
3832                 return false;
3833             }
3834             if ( !Test.isEqual( dss1.sampleStandardUnit( 66 - 16.24807680927192 ), -1.0 ) ) {
3835                 return false;
3836             }
3837             if ( !Test.isEqual( dss1.getValue( 1 ), 78 ) ) {
3838                 return false;
3839             }
3840             dss1.addValue( 123 );
3841             if ( !Test.isEqual( dss1.arithmeticMean(), 75.5 ) ) {
3842                 return false;
3843             }
3844             if ( !Test.isEqual( dss1.getMax(), 123 ) ) {
3845                 return false;
3846             }
3847             if ( !Test.isEqual( dss1.standardErrorOfMean(), 11.200446419674531 ) ) {
3848                 return false;
3849             }
3850             final DescriptiveStatistics dss2 = new BasicDescriptiveStatistics();
3851             dss2.addValue( -1.85 );
3852             dss2.addValue( 57.5 );
3853             dss2.addValue( 92.78 );
3854             dss2.addValue( 57.78 );
3855             if ( !Test.isEqual( dss2.median(), 57.64 ) ) {
3856                 return false;
3857             }
3858             if ( !Test.isEqual( dss2.sampleStandardDeviation(), 39.266984753946495 ) ) {
3859                 return false;
3860             }
3861             final double[] a = dss2.getDataAsDoubleArray();
3862             if ( !Test.isEqual( a[ 3 ], 57.78 ) ) {
3863                 return false;
3864             }
3865             dss2.addValue( -100 );
3866             if ( !Test.isEqual( dss2.sampleStandardDeviation(), 75.829111296388 ) ) {
3867                 return false;
3868             }
3869             if ( !Test.isEqual( dss2.sampleVariance(), 5750.05412 ) ) {
3870                 return false;
3871             }
3872             final double[] ds = new double[ 14 ];
3873             ds[ 0 ] = 34;
3874             ds[ 1 ] = 23;
3875             ds[ 2 ] = 1;
3876             ds[ 3 ] = 32;
3877             ds[ 4 ] = 11;
3878             ds[ 5 ] = 2;
3879             ds[ 6 ] = 12;
3880             ds[ 7 ] = 33;
3881             ds[ 8 ] = 13;
3882             ds[ 9 ] = 22;
3883             ds[ 10 ] = 21;
3884             ds[ 11 ] = 35;
3885             ds[ 12 ] = 24;
3886             ds[ 13 ] = 31;
3887             final int[] bins = BasicDescriptiveStatistics.performBinning( ds, 0, 40, 4 );
3888             if ( bins.length != 4 ) {
3889                 return false;
3890             }
3891             if ( bins[ 0 ] != 2 ) {
3892                 return false;
3893             }
3894             if ( bins[ 1 ] != 3 ) {
3895                 return false;
3896             }
3897             if ( bins[ 2 ] != 4 ) {
3898                 return false;
3899             }
3900             if ( bins[ 3 ] != 5 ) {
3901                 return false;
3902             }
3903             final double[] ds1 = new double[ 9 ];
3904             ds1[ 0 ] = 10.0;
3905             ds1[ 1 ] = 19.0;
3906             ds1[ 2 ] = 9.999;
3907             ds1[ 3 ] = 0.0;
3908             ds1[ 4 ] = 39.9;
3909             ds1[ 5 ] = 39.999;
3910             ds1[ 6 ] = 30.0;
3911             ds1[ 7 ] = 19.999;
3912             ds1[ 8 ] = 30.1;
3913             final int[] bins1 = BasicDescriptiveStatistics.performBinning( ds1, 0, 40, 4 );
3914             if ( bins1.length != 4 ) {
3915                 return false;
3916             }
3917             if ( bins1[ 0 ] != 2 ) {
3918                 return false;
3919             }
3920             if ( bins1[ 1 ] != 3 ) {
3921                 return false;
3922             }
3923             if ( bins1[ 2 ] != 0 ) {
3924                 return false;
3925             }
3926             if ( bins1[ 3 ] != 4 ) {
3927                 return false;
3928             }
3929             final int[] bins1_1 = BasicDescriptiveStatistics.performBinning( ds1, 0, 40, 3 );
3930             if ( bins1_1.length != 3 ) {
3931                 return false;
3932             }
3933             if ( bins1_1[ 0 ] != 3 ) {
3934                 return false;
3935             }
3936             if ( bins1_1[ 1 ] != 2 ) {
3937                 return false;
3938             }
3939             if ( bins1_1[ 2 ] != 4 ) {
3940                 return false;
3941             }
3942             final int[] bins1_2 = BasicDescriptiveStatistics.performBinning( ds1, 1, 39, 3 );
3943             if ( bins1_2.length != 3 ) {
3944                 return false;
3945             }
3946             if ( bins1_2[ 0 ] != 2 ) {
3947                 return false;
3948             }
3949             if ( bins1_2[ 1 ] != 2 ) {
3950                 return false;
3951             }
3952             if ( bins1_2[ 2 ] != 2 ) {
3953                 return false;
3954             }
3955             final DescriptiveStatistics dss3 = new BasicDescriptiveStatistics();
3956             dss3.addValue( 1 );
3957             dss3.addValue( 1 );
3958             dss3.addValue( 1 );
3959             dss3.addValue( 2 );
3960             dss3.addValue( 3 );
3961             dss3.addValue( 4 );
3962             dss3.addValue( 5 );
3963             dss3.addValue( 5 );
3964             dss3.addValue( 5 );
3965             dss3.addValue( 6 );
3966             dss3.addValue( 7 );
3967             dss3.addValue( 8 );
3968             dss3.addValue( 9 );
3969             dss3.addValue( 10 );
3970             dss3.addValue( 10 );
3971             dss3.addValue( 10 );
3972             final AsciiHistogram histo = new AsciiHistogram( dss3 );
3973             histo.toStringBuffer( 10, '=', 40, 5 );
3974             histo.toStringBuffer( 3, 8, 10, '=', 40, 5, null );
3975         }
3976         catch ( final Exception e ) {
3977             e.printStackTrace( System.out );
3978             return false;
3979         }
3980         return true;
3981     }
3982
3983     private static boolean testDir( final String file ) {
3984         try {
3985             final File f = new File( file );
3986             if ( !f.exists() ) {
3987                 return false;
3988             }
3989             if ( !f.isDirectory() ) {
3990                 return false;
3991             }
3992             if ( !f.canRead() ) {
3993                 return false;
3994             }
3995         }
3996         catch ( final Exception e ) {
3997             return false;
3998         }
3999         return true;
4000     }
4001
4002     private static boolean testEbiEntryRetrieval() {
4003         try {
4004             final SequenceDatabaseEntry entry = SequenceDbWsTools.obtainEntry( "AAK41263" );
4005             if ( !entry.getAccession().equals( "AAK41263" ) ) {
4006                 System.out.println( entry.getAccession() );
4007                 return false;
4008             }
4009             if ( !entry.getTaxonomyScientificName().equals( "Sulfolobus solfataricus P2" ) ) {
4010                 System.out.println( entry.getTaxonomyScientificName() );
4011                 return false;
4012             }
4013             if ( !entry.getSequenceName()
4014                     .equals( "Sulfolobus solfataricus P2 Glycogen debranching enzyme, hypothetical (treX-like)" ) ) {
4015                 System.out.println( entry.getSequenceName() );
4016                 return false;
4017             }
4018             if ( !entry.getGeneName().equals( "treX-like" ) ) {
4019                 System.out.println( entry.getGeneName() );
4020                 return false;
4021             }
4022             if ( !entry.getTaxonomyIdentifier().equals( "273057" ) ) {
4023                 System.out.println( entry.getTaxonomyIdentifier() );
4024                 return false;
4025             }
4026             if ( !entry.getAnnotations().first().getRefValue().equals( "3.2.1.33" ) ) {
4027                 System.out.println( entry.getAnnotations().first().getRefValue() );
4028                 return false;
4029             }
4030             if ( !entry.getAnnotations().first().getRefSource().equals( "EC" ) ) {
4031                 System.out.println( entry.getAnnotations().first().getRefSource() );
4032                 return false;
4033             }
4034             if ( entry.getCrossReferences().size() != 5 ) {
4035                 return false;
4036             }
4037             final SequenceDatabaseEntry entry1 = SequenceDbWsTools.obtainEntry( "ABJ16409" );
4038             if ( !entry1.getAccession().equals( "ABJ16409" ) ) {
4039                 return false;
4040             }
4041             if ( !entry1.getTaxonomyScientificName().equals( "Felis catus" ) ) {
4042                 System.out.println( entry1.getTaxonomyScientificName() );
4043                 return false;
4044             }
4045             if ( !entry1.getSequenceName().equals( "Felis catus (domestic cat) partial BCL2" ) ) {
4046                 System.out.println( entry1.getSequenceName() );
4047                 return false;
4048             }
4049             if ( !entry1.getTaxonomyIdentifier().equals( "9685" ) ) {
4050                 System.out.println( entry1.getTaxonomyIdentifier() );
4051                 return false;
4052             }
4053             if ( !entry1.getGeneName().equals( "BCL2" ) ) {
4054                 System.out.println( entry1.getGeneName() );
4055                 return false;
4056             }
4057             if ( entry1.getCrossReferences().size() != 6 ) {
4058                 return false;
4059             }
4060             final SequenceDatabaseEntry entry2 = SequenceDbWsTools.obtainEntry( "NM_184234" );
4061             if ( !entry2.getAccession().equals( "NM_184234" ) ) {
4062                 return false;
4063             }
4064             if ( !entry2.getTaxonomyScientificName().equals( "Homo sapiens" ) ) {
4065                 System.out.println( entry2.getTaxonomyScientificName() );
4066                 return false;
4067             }
4068             if ( !entry2.getSequenceName()
4069                     .equals( "Homo sapiens RNA binding motif protein 39 (RBM39), transcript variant 1, mRNA" ) ) {
4070                 System.out.println( entry2.getSequenceName() );
4071                 return false;
4072             }
4073             if ( !entry2.getTaxonomyIdentifier().equals( "9606" ) ) {
4074                 System.out.println( entry2.getTaxonomyIdentifier() );
4075                 return false;
4076             }
4077             if ( !entry2.getGeneName().equals( "RBM39" ) ) {
4078                 System.out.println( entry2.getGeneName() );
4079                 return false;
4080             }
4081             if ( entry2.getCrossReferences().size() != 3 ) {
4082                 return false;
4083             }
4084             //
4085             final SequenceDatabaseEntry entry3 = SequenceDbWsTools.obtainEntry( "HM043801" );
4086             if ( !entry3.getAccession().equals( "HM043801" ) ) {
4087                 return false;
4088             }
4089             if ( !entry3.getTaxonomyScientificName().equals( "Bursaphelenchus xylophilus" ) ) {
4090                 System.out.println( entry3.getTaxonomyScientificName() );
4091                 return false;
4092             }
4093             if ( !entry3.getSequenceName().equals( "Bursaphelenchus xylophilus RAF gene, complete cds" ) ) {
4094                 System.out.println( entry3.getSequenceName() );
4095                 return false;
4096             }
4097             if ( !entry3.getTaxonomyIdentifier().equals( "6326" ) ) {
4098                 System.out.println( entry3.getTaxonomyIdentifier() );
4099                 return false;
4100             }
4101             if ( !entry3.getSequenceSymbol().equals( "RAF" ) ) {
4102                 System.out.println( entry3.getSequenceSymbol() );
4103                 return false;
4104             }
4105             if ( !ForesterUtil.isEmpty( entry3.getGeneName() ) ) {
4106                 return false;
4107             }
4108             if ( entry3.getCrossReferences().size() < 7 ) {
4109                 return false;
4110             }
4111             final SequenceDatabaseEntry entry4 = SequenceDbWsTools.obtainEntry( "AAA36557.1" );
4112             if ( !entry4.getAccession().equals( "AAA36557" ) ) {
4113                 return false;
4114             }
4115             if ( !entry4.getTaxonomyScientificName().equals( "Homo sapiens" ) ) {
4116                 System.out.println( entry4.getTaxonomyScientificName() );
4117                 return false;
4118             }
4119             if ( !entry4.getSequenceName().equals( "Homo sapiens (human) ras protein" ) ) {
4120                 System.out.println( entry4.getSequenceName() );
4121                 return false;
4122             }
4123             if ( !entry4.getTaxonomyIdentifier().equals( "9606" ) ) {
4124                 System.out.println( entry4.getTaxonomyIdentifier() );
4125                 return false;
4126             }
4127             if ( !entry4.getGeneName().equals( "ras" ) ) {
4128                 System.out.println( entry4.getGeneName() );
4129                 return false;
4130             }
4131             //   if ( !entry4.getChromosome().equals( "ras" ) ) {
4132             //     System.out.println( entry4.getChromosome() );
4133             //     return false;
4134             // }
4135             // if ( !entry4.getMap().equals( "ras" ) ) {
4136             //     System.out.println( entry4.getMap() );
4137             //     return false;
4138             // }
4139             //TODO FIXME gi...
4140             //
4141             //TODO fails:
4142             //            final SequenceDatabaseEntry entry5 = SequenceDbWsTools.obtainEntry( "M30539" );
4143             //            if ( !entry5.getAccession().equals( "HM043801" ) ) {
4144             //                return false;
4145             //            }
4146             final SequenceDatabaseEntry entry5 = SequenceDbWsTools.obtainEntry( "AAZ45343.1" );
4147             if ( !entry5.getAccession().equals( "AAZ45343" ) ) {
4148                 return false;
4149             }
4150             if ( !entry5.getTaxonomyScientificName().equals( "Dechloromonas aromatica RCB" ) ) {
4151                 System.out.println( entry5.getTaxonomyScientificName() );
4152                 return false;
4153             }
4154             if ( !entry5.getSequenceName().equals( "Dechloromonas aromatica RCB 1,4-alpha-glucan branching enzyme" ) ) {
4155                 System.out.println( entry5.getSequenceName() );
4156                 return false;
4157             }
4158             if ( !entry5.getTaxonomyIdentifier().equals( "159087" ) ) {
4159                 System.out.println( entry5.getTaxonomyIdentifier() );
4160                 return false;
4161             }
4162         }
4163         catch ( final IOException e ) {
4164             System.out.println();
4165             System.out.println( "the following might be due to absence internet connection:" );
4166             e.printStackTrace( System.out );
4167             return true;
4168         }
4169         catch ( final Exception e ) {
4170             e.printStackTrace();
4171             return false;
4172         }
4173         return true;
4174     }
4175
4176     private static boolean testExternalNodeRelatedMethods() {
4177         try {
4178             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
4179             final Phylogeny t1 = factory.create( "((A,B),(C,D))", new NHXParser() )[ 0 ];
4180             PhylogenyNode n = t1.getNode( "A" );
4181             n = n.getNextExternalNode();
4182             if ( !n.getName().equals( "B" ) ) {
4183                 return false;
4184             }
4185             n = n.getNextExternalNode();
4186             if ( !n.getName().equals( "C" ) ) {
4187                 return false;
4188             }
4189             n = n.getNextExternalNode();
4190             if ( !n.getName().equals( "D" ) ) {
4191                 return false;
4192             }
4193             n = t1.getNode( "B" );
4194             while ( !n.isLastExternalNode() ) {
4195                 n = n.getNextExternalNode();
4196             }
4197             final Phylogeny t2 = factory.create( "(((A,B),C),D)", new NHXParser() )[ 0 ];
4198             n = t2.getNode( "A" );
4199             n = n.getNextExternalNode();
4200             if ( !n.getName().equals( "B" ) ) {
4201                 return false;
4202             }
4203             n = n.getNextExternalNode();
4204             if ( !n.getName().equals( "C" ) ) {
4205                 return false;
4206             }
4207             n = n.getNextExternalNode();
4208             if ( !n.getName().equals( "D" ) ) {
4209                 return false;
4210             }
4211             n = t2.getNode( "B" );
4212             while ( !n.isLastExternalNode() ) {
4213                 n = n.getNextExternalNode();
4214             }
4215             final Phylogeny t3 = factory.create( "(((A,B),(C,D)),((E,F),(G,H)))", new NHXParser() )[ 0 ];
4216             n = t3.getNode( "A" );
4217             n = n.getNextExternalNode();
4218             if ( !n.getName().equals( "B" ) ) {
4219                 return false;
4220             }
4221             n = n.getNextExternalNode();
4222             if ( !n.getName().equals( "C" ) ) {
4223                 return false;
4224             }
4225             n = n.getNextExternalNode();
4226             if ( !n.getName().equals( "D" ) ) {
4227                 return false;
4228             }
4229             n = n.getNextExternalNode();
4230             if ( !n.getName().equals( "E" ) ) {
4231                 return false;
4232             }
4233             n = n.getNextExternalNode();
4234             if ( !n.getName().equals( "F" ) ) {
4235                 return false;
4236             }
4237             n = n.getNextExternalNode();
4238             if ( !n.getName().equals( "G" ) ) {
4239                 return false;
4240             }
4241             n = n.getNextExternalNode();
4242             if ( !n.getName().equals( "H" ) ) {
4243                 return false;
4244             }
4245             n = t3.getNode( "B" );
4246             while ( !n.isLastExternalNode() ) {
4247                 n = n.getNextExternalNode();
4248             }
4249             final Phylogeny t4 = factory.create( "((A,B),(C,D))", new NHXParser() )[ 0 ];
4250             for( final PhylogenyNodeIterator iter = t4.iteratorExternalForward(); iter.hasNext(); ) {
4251                 final PhylogenyNode node = iter.next();
4252             }
4253             final Phylogeny t5 = factory.create( "(((A,B),(C,D)),((E,F),(G,H)))", new NHXParser() )[ 0 ];
4254             for( final PhylogenyNodeIterator iter = t5.iteratorExternalForward(); iter.hasNext(); ) {
4255                 final PhylogenyNode node = iter.next();
4256             }
4257             final Phylogeny t6 = factory.create( "((((((A))),(((B))),((C)),((((D)))),E)),((F)))", new NHXParser() )[ 0 ];
4258             final PhylogenyNodeIterator iter = t6.iteratorExternalForward();
4259             if ( !iter.next().getName().equals( "A" ) ) {
4260                 return false;
4261             }
4262             if ( !iter.next().getName().equals( "B" ) ) {
4263                 return false;
4264             }
4265             if ( !iter.next().getName().equals( "C" ) ) {
4266                 return false;
4267             }
4268             if ( !iter.next().getName().equals( "D" ) ) {
4269                 return false;
4270             }
4271             if ( !iter.next().getName().equals( "E" ) ) {
4272                 return false;
4273             }
4274             if ( !iter.next().getName().equals( "F" ) ) {
4275                 return false;
4276             }
4277             if ( iter.hasNext() ) {
4278                 return false;
4279             }
4280         }
4281         catch ( final Exception e ) {
4282             e.printStackTrace( System.out );
4283             return false;
4284         }
4285         return true;
4286     }
4287
4288     private static boolean testExtractSNFromNodeName() {
4289         try {
4290             if ( !ParserUtils.extractScientificNameFromNodeName( "BCDO2_Mus_musculus" ).equals( "Mus musculus" ) ) {
4291                 return false;
4292             }
4293             if ( !ParserUtils.extractScientificNameFromNodeName( "BCDO2 Mus musculus" ).equals( "Mus musculus" ) ) {
4294                 return false;
4295             }
4296             if ( !ParserUtils.extractScientificNameFromNodeName( "Mus_musculus_BCDO2" ).equals( "Mus musculus" ) ) {
4297                 return false;
4298             }
4299             if ( !ParserUtils.extractScientificNameFromNodeName( "Mus musculus musculus BCDO2" )
4300                     .equals( "Mus musculus musculus" ) ) {
4301                 return false;
4302             }
4303             if ( !ParserUtils.extractScientificNameFromNodeName( "Mus_musculus_musculus_BCDO2" )
4304                     .equals( "Mus musculus musculus" ) ) {
4305                 return false;
4306             }
4307             if ( !ParserUtils.extractScientificNameFromNodeName( "BCDO2 Mus musculus musculus" )
4308                     .equals( "Mus musculus musculus" ) ) {
4309                 return false;
4310             }
4311             if ( !ParserUtils.extractScientificNameFromNodeName( "Bcl Mus musculus musculus" )
4312                     .equals( "Mus musculus musculus" ) ) {
4313                 return false;
4314             }
4315             if ( ParserUtils.extractScientificNameFromNodeName( "vcl Mus musculus musculus" ) != null ) {
4316                 return false;
4317             }
4318             if ( !ParserUtils.extractScientificNameFromNodeName( "could_be_anything_Mus_musculus_musculus_BCDO2" )
4319                     .equals( "Mus musculus musculus" ) ) {
4320                 return false;
4321             }
4322             if ( !ParserUtils.extractScientificNameFromNodeName( "could_be_anything_Mus_musculus_musculus_Musculus" )
4323                     .equals( "Mus musculus musculus" ) ) {
4324                 return false;
4325             }
4326             if ( ParserUtils.extractScientificNameFromNodeName( "could_be_anything_Mus_musculus_musculus_musculus" ) != null ) {
4327                 return false;
4328             }
4329             if ( ParserUtils.extractScientificNameFromNodeName( "musculus" ) != null ) {
4330                 return false;
4331             }
4332             if ( ParserUtils.extractScientificNameFromNodeName( "mus_musculus" ) != null ) {
4333                 return false;
4334             }
4335             if ( ParserUtils.extractScientificNameFromNodeName( "mus_musculus_musculus" ) != null ) {
4336                 return false;
4337             }
4338             if ( !ParserUtils.extractScientificNameFromNodeName( "Mus_musculus_musculus_1" )
4339                     .equals( "Mus musculus musculus" ) ) {
4340                 return false;
4341             }
4342             if ( !ParserUtils.extractScientificNameFromNodeName( "Mus_musculus_1" ).equals( "Mus musculus" ) ) {
4343                 return false;
4344             }
4345             if ( ParserUtils.extractScientificNameFromNodeName( "Mus_musculus_bcl" ) != null ) {
4346                 return false;
4347             }
4348             if ( !ParserUtils.extractScientificNameFromNodeName( "Mus_musculus_BCL" ).equals( "Mus musculus" ) ) {
4349                 return false;
4350             }
4351             if ( ParserUtils.extractScientificNameFromNodeName( "Mus musculus bcl" ) != null ) {
4352                 return false;
4353             }
4354             if ( !ParserUtils.extractScientificNameFromNodeName( "Mus musculus BCL" ).equals( "Mus musculus" ) ) {
4355                 return false;
4356             }
4357             if ( !ParserUtils.extractScientificNameFromNodeName( "Mus musculus xBCL" ).equals( "Mus musculus" ) ) {
4358                 return false;
4359             }
4360             if ( !ParserUtils.extractScientificNameFromNodeName( "Mus musculus x1" ).equals( "Mus musculus" ) ) {
4361                 return false;
4362             }
4363             if ( !ParserUtils.extractScientificNameFromNodeName( " -XS12_Mus_musculus_12" ).equals( "Mus musculus" ) ) {
4364                 return false;
4365             }
4366             if ( !ParserUtils.extractScientificNameFromNodeName( " -1234_Mus_musculus_12 affrre e" )
4367                     .equals( "Mus musculus" ) ) {
4368                 return false;
4369             }
4370             if ( !ParserUtils.extractScientificNameFromNodeName( " -1234_Mus_musculus_12_affrre_e" )
4371                     .equals( "Mus musculus" ) ) {
4372                 return false;
4373             }
4374             if ( !ParserUtils.extractScientificNameFromNodeName( "Mus_musculus" ).equals( "Mus musculus" ) ) {
4375                 return false;
4376             }
4377             if ( !ParserUtils.extractScientificNameFromNodeName( "Mus_musculus_musculus_2bcl2" )
4378                     .equals( "Mus musculus musculus" ) ) {
4379                 return false;
4380             }
4381             if ( !ParserUtils.extractScientificNameFromNodeName( "Mus_musculus_musculus_2bcl2" )
4382                     .equals( "Mus musculus musculus" ) ) {
4383                 return false;
4384             }
4385             if ( !ParserUtils.extractScientificNameFromNodeName( "Mus_musculus_musculus_bcl2" )
4386                     .equals( "Mus musculus musculus" ) ) {
4387                 return false;
4388             }
4389             if ( !ParserUtils.extractScientificNameFromNodeName( "Mus_musculus_123" ).equals( "Mus musculus" ) ) {
4390                 return false;
4391             }
4392             if ( !ParserUtils.extractScientificNameFromNodeName( "Pilostyles mexicana Mexico Breedlove 27233" )
4393                     .equals( "Pilostyles mexicana" ) ) {
4394                 return false;
4395             }
4396             if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia_coli_strain_K12/DH10B" )
4397                     .equals( "Escherichia coli strain K12/DH10B" ) ) {
4398                 return false;
4399             }
4400             if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia_coli_str_K12/DH10B" )
4401                     .equals( "Escherichia coli str. K12/DH10B" ) ) {
4402                 return false;
4403             }
4404             if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia coli str. K12/DH10B" )
4405                     .equals( "Escherichia coli str. K12/DH10B" ) ) {
4406                 return false;
4407             }
4408             if ( !ParserUtils.extractScientificNameFromNodeName( "Arabidopsis_lyrata_subsp_lyrata" )
4409                     .equals( "Arabidopsis lyrata subsp. lyrata" ) ) {
4410                 return false;
4411             }
4412             if ( !ParserUtils.extractScientificNameFromNodeName( "Arabidopsis lyrata subsp. lyrata" )
4413                     .equals( "Arabidopsis lyrata subsp. lyrata" ) ) {
4414                 return false;
4415             }
4416             if ( !ParserUtils.extractScientificNameFromNodeName( "Arabidopsis lyrata subsp. lyrata 395" )
4417                     .equals( "Arabidopsis lyrata subsp. lyrata" ) ) {
4418                 return false;
4419             }
4420             if ( !ParserUtils.extractScientificNameFromNodeName( "Arabidopsis lyrata subsp. lyrata bcl2" )
4421                     .equals( "Arabidopsis lyrata subsp. lyrata" ) ) {
4422                 return false;
4423             }
4424             if ( !ParserUtils.extractScientificNameFromNodeName( "Arabidopsis lyrata subsp lyrata bcl2" )
4425                     .equals( "Arabidopsis lyrata subsp. lyrata" ) ) {
4426                 return false;
4427             }
4428             if ( !ParserUtils.extractScientificNameFromNodeName( "Arabidopsis lyrata subspecies lyrata bcl2" )
4429                     .equals( "Arabidopsis lyrata subspecies lyrata" ) ) {
4430                 return false;
4431             }
4432             if ( !ParserUtils.extractScientificNameFromNodeName( "Verbascum sinuatum var. adenosepalum bcl2" )
4433                     .equals( "Verbascum sinuatum var. adenosepalum" ) ) {
4434                 return false;
4435             }
4436             if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia coli (strain K12)" )
4437                     .equals( "Escherichia coli (strain K12)" ) ) {
4438                 return false;
4439             }
4440             if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia coli (strain K12) bcl2" )
4441                     .equals( "Escherichia coli (strain K12)" ) ) {
4442                 return false;
4443             }
4444             if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia coli (str. K12)" )
4445                     .equals( "Escherichia coli (str. K12)" ) ) {
4446                 return false;
4447             }
4448             if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia coli (str K12)" )
4449                     .equals( "Escherichia coli (str. K12)" ) ) {
4450                 return false;
4451             }
4452             if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia coli (str. K12) bcl2" )
4453                     .equals( "Escherichia coli (str. K12)" ) ) {
4454                 return false;
4455             }
4456             if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia coli (var K12) bcl2" )
4457                     .equals( "Escherichia coli (var. K12)" ) ) {
4458                 return false;
4459             }
4460             if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia coli str. K-12 substr. MG1655star" )
4461                     .equals( "Escherichia coli str. K-12 substr. MG1655star" ) ) {
4462                 return false;
4463             }
4464             if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia coli str K-12 substr MG1655star" )
4465                     .equals( "Escherichia coli str. K-12 substr. MG1655star" ) ) {
4466                 return false;
4467             }
4468             if ( !ParserUtils
4469                     .extractScientificNameFromNodeName( "could be anything Escherichia coli str K-12 substr MG1655star" )
4470                     .equals( "Escherichia coli str. K-12 substr. MG1655star" ) ) {
4471                 return false;
4472             }
4473             if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia coli str K-12 substr MG1655star gene1" )
4474                     .equals( "Escherichia coli str. K-12 substr. MG1655star" ) ) {
4475                 return false;
4476             }
4477             if ( !ParserUtils
4478                     .extractScientificNameFromNodeName( "could be anything Escherichia coli str K-12 substr MG1655star GENE1" )
4479                     .equals( "Escherichia coli str. K-12 substr. MG1655star" ) ) {
4480                 return false;
4481             }
4482             if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia_coli_str_K-12_substr_MG1655star" )
4483                     .equals( "Escherichia coli str. K-12 substr. MG1655star" ) ) {
4484                 return false;
4485             }
4486             if ( !ParserUtils.extractScientificNameFromNodeName( "Escherichia_coli_str_K-12_substr_MG1655star" )
4487                     .equals( "Escherichia coli str. K-12 substr. MG1655star" ) ) {
4488                 return false;
4489             }
4490             if ( !ParserUtils.extractScientificNameFromNodeName( "Macrocera sp." ).equals( "Macrocera sp." ) ) {
4491                 return false;
4492             }
4493             if ( !ParserUtils.extractScientificNameFromNodeName( "Macrocera sp. 123" ).equals( "Macrocera sp." ) ) {
4494                 return false;
4495             }
4496             if ( !ParserUtils.extractScientificNameFromNodeName( "Macrocera sp. K12" ).equals( "Macrocera sp." ) ) {
4497                 return false;
4498             }
4499             if ( !ParserUtils.extractScientificNameFromNodeName( "something Macrocera sp. K12" )
4500                     .equals( "Macrocera sp." ) ) {
4501                 return false;
4502             }
4503             if ( !ParserUtils.extractScientificNameFromNodeName( "Macrocera sp" ).equals( "Macrocera sp." ) ) {
4504                 return false;
4505             }
4506             if ( !ParserUtils.extractScientificNameFromNodeName( "Sesamum rigidum ssp merenskyanum 07 48" )
4507                     .equals( "Sesamum rigidum subsp. merenskyanum" ) ) {
4508                 return false;
4509             }
4510             if ( !ParserUtils.extractScientificNameFromNodeName( "Sesamum rigidum ssp. merenskyanum" )
4511                     .equals( "Sesamum rigidum subsp. merenskyanum" ) ) {
4512                 return false;
4513             }
4514             if ( !ParserUtils.extractScientificNameFromNodeName( "Sesamum rigidum (ssp. merenskyanum)" )
4515                     .equals( "Sesamum rigidum (subsp. merenskyanum)" ) ) {
4516                 return false;
4517             }
4518             if ( !ParserUtils.extractScientificNameFromNodeName( "Sesamum rigidum (ssp merenskyanum)" )
4519                     .equals( "Sesamum rigidum (subsp. merenskyanum)" ) ) {
4520                 return false;
4521             }
4522         }
4523         catch ( final Exception e ) {
4524             e.printStackTrace( System.out );
4525             return false;
4526         }
4527         return true;
4528     }
4529
4530     private static boolean testExtractTaxonomyDataFromNodeName() {
4531         try {
4532             PhylogenyNode n = new PhylogenyNode( "tr|B1AM49|B1AM49_HUMAN" );
4533             if ( !ParserUtils.extractTaxonomyDataFromNodeName( n, TAXONOMY_EXTRACTION.AGGRESSIVE ).equals( "HUMAN" ) ) {
4534                 return false;
4535             }
4536             n = new PhylogenyNode( "tr|B1AM49|B1AM49_HUMAN~1-2" );
4537             if ( !ParserUtils.extractTaxonomyDataFromNodeName( n, TAXONOMY_EXTRACTION.AGGRESSIVE ).equals( "HUMAN" ) ) {
4538                 return false;
4539             }
4540             n = new PhylogenyNode( "tr|B1AM49|HNRPR_HUMAN" );
4541             if ( !ParserUtils.extractTaxonomyDataFromNodeName( n, TAXONOMY_EXTRACTION.AGGRESSIVE ).equals( "HUMAN" ) ) {
4542                 return false;
4543             }
4544             n = new PhylogenyNode( "tr|B1AM49|HNRPR_HUMAN|" );
4545             if ( !ParserUtils.extractTaxonomyDataFromNodeName( n, TAXONOMY_EXTRACTION.AGGRESSIVE ).equals( "HUMAN" ) ) {
4546                 return false;
4547             }
4548             n = new PhylogenyNode( "tr|B1AM49|HNRPR_HUMAN~12" );
4549             if ( !ParserUtils.extractTaxonomyDataFromNodeName( n, TAXONOMY_EXTRACTION.AGGRESSIVE ).equals( "HUMAN" ) ) {
4550                 return false;
4551             }
4552             n = new PhylogenyNode( "HNRPR_HUMAN" );
4553             if ( !ParserUtils.extractTaxonomyDataFromNodeName( n, TAXONOMY_EXTRACTION.AGGRESSIVE ).equals( "HUMAN" ) ) {
4554                 return false;
4555             }
4556             n = new PhylogenyNode( "HNRPR_HUMAN_X" );
4557             if ( !ParserUtils.extractTaxonomyDataFromNodeName( n, TAXONOMY_EXTRACTION.AGGRESSIVE ).equals( "HUMAN" ) ) {
4558                 return false;
4559             }
4560         }
4561         catch ( final Exception e ) {
4562             e.printStackTrace( System.out );
4563             return false;
4564         }
4565         return true;
4566     }
4567
4568     private static boolean testExtractTaxonomyCodeFromNodeName() {
4569         try {
4570             if ( ParserUtils.extractTaxonomyCodeFromNodeName( "MOUSE", TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ) != null ) {
4571                 return false;
4572             }
4573             if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "SOYBN", TAXONOMY_EXTRACTION.AGGRESSIVE )
4574                     .equals( "SOYBN" ) ) {
4575                 return false;
4576             }
4577             if ( !ParserUtils.extractTaxonomyCodeFromNodeName( " ARATH ", TAXONOMY_EXTRACTION.AGGRESSIVE )
4578                     .equals( "ARATH" ) ) {
4579                 return false;
4580             }
4581             if ( !ParserUtils.extractTaxonomyCodeFromNodeName( " ARATH ", TAXONOMY_EXTRACTION.AGGRESSIVE )
4582                     .equals( "ARATH" ) ) {
4583                 return false;
4584             }
4585             if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "RAT", TAXONOMY_EXTRACTION.AGGRESSIVE ).equals( "RAT" ) ) {
4586                 return false;
4587             }
4588             if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "RAT", TAXONOMY_EXTRACTION.AGGRESSIVE ).equals( "RAT" ) ) {
4589                 return false;
4590             }
4591             if ( ParserUtils.extractTaxonomyCodeFromNodeName( "RAT1", TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ) != null ) {
4592                 return false;
4593             }
4594             if ( !ParserUtils.extractTaxonomyCodeFromNodeName( " _SOYBN", TAXONOMY_EXTRACTION.AGGRESSIVE )
4595                     .equals( "SOYBN" ) ) {
4596                 return false;
4597             }
4598             if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "SOYBN", TAXONOMY_EXTRACTION.AGGRESSIVE )
4599                     .equals( "SOYBN" ) ) {
4600                 return false;
4601             }
4602             if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "qwerty SOYBN", TAXONOMY_EXTRACTION.AGGRESSIVE )
4603                     .equals( "SOYBN" ) ) {
4604                 return false;
4605             }
4606             if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "qwerty_SOYBN", TAXONOMY_EXTRACTION.AGGRESSIVE )
4607                     .equals( "SOYBN" ) ) {
4608                 return false;
4609             }
4610             if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "ABCD_SOYBN ", TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED )
4611                     .equals( "SOYBN" ) ) {
4612                 return false;
4613             }
4614             if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "SOYBN", TAXONOMY_EXTRACTION.AGGRESSIVE )
4615                     .equals( "SOYBN" ) ) {
4616                 return false;
4617             }
4618             if ( !ParserUtils.extractTaxonomyCodeFromNodeName( ",SOYBN,", TAXONOMY_EXTRACTION.AGGRESSIVE )
4619                     .equals( "SOYBN" ) ) {
4620                 return false;
4621             }
4622             if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "xxx,SOYBN,xxx", TAXONOMY_EXTRACTION.AGGRESSIVE )
4623                     .equals( "SOYBN" ) ) {
4624                 return false;
4625             }
4626             if ( ParserUtils.extractTaxonomyCodeFromNodeName( "xxxSOYBNxxx", TAXONOMY_EXTRACTION.AGGRESSIVE ) != null ) {
4627                 return false;
4628             }
4629             if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "-SOYBN~", TAXONOMY_EXTRACTION.AGGRESSIVE )
4630                     .equals( "SOYBN" ) ) {
4631                 return false;
4632             }
4633             if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "NNN8_ECOLI/1-2:0.01",
4634                                                                TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT ).equals( "ECOLI" ) ) {
4635                 return false;
4636             }
4637             if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "blag_9YX45-blag", TAXONOMY_EXTRACTION.AGGRESSIVE )
4638                     .equals( "9YX45" ) ) {
4639                 return false;
4640             }
4641             if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "BCL2_MOUSE function = 23445",
4642                                                                TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED )
4643                                                                .equals( "MOUSE" ) ) {
4644                 return false;
4645             }
4646             if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "BCL2_MOUSE+function = 23445",
4647                                                                TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED )
4648                                                                .equals( "MOUSE" ) ) {
4649                 return false;
4650             }
4651             if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "BCL2_MOUSE|function = 23445",
4652                                                                TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED )
4653                                                                .equals( "MOUSE" ) ) {
4654                 return false;
4655             }
4656             if ( ParserUtils.extractTaxonomyCodeFromNodeName( "BCL2_MOUSEfunction = 23445",
4657                                                               TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ) != null ) {
4658                 return false;
4659             }
4660             if ( ParserUtils.extractTaxonomyCodeFromNodeName( "BCL2_MOUSEFunction = 23445",
4661                                                               TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ) != null ) {
4662                 return false;
4663             }
4664             if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "BCL2_RAT function = 23445",
4665                                                                TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ).equals( "RAT" ) ) {
4666                 return false;
4667             }
4668             if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "BCL2_RAT function = 23445",
4669                                                                TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ).equals( "RAT" ) ) {
4670                 return false;
4671             }
4672             if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "BCL2_RAT|function = 23445",
4673                                                                TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ).equals( "RAT" ) ) {
4674                 return false;
4675             }
4676             if ( ParserUtils.extractTaxonomyCodeFromNodeName( "BCL2_RATfunction = 23445",
4677                                                               TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ) != null ) {
4678                 return false;
4679             }
4680             if ( ParserUtils.extractTaxonomyCodeFromNodeName( "BCL2_RATFunction = 23445",
4681                                                               TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ) != null ) {
4682                 return false;
4683             }
4684             if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "BCL2_RAT/1-3", TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED )
4685                     .equals( "RAT" ) ) {
4686                 return false;
4687             }
4688             if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "BCL2_PIG/1-3", TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT )
4689                     .equals( "PIG" ) ) {
4690                 return false;
4691             }
4692             if ( !ParserUtils
4693                     .extractTaxonomyCodeFromNodeName( "BCL2_MOUSE/1-3", TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED )
4694                     .equals( "MOUSE" ) ) {
4695                 return false;
4696             }
4697             if ( !ParserUtils.extractTaxonomyCodeFromNodeName( "BCL2_MOUSE/1-3", TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT )
4698                     .equals( "MOUSE" ) ) {
4699                 return false;
4700             }
4701             if ( ParserUtils.extractTaxonomyCodeFromNodeName( "_MOUSE ", TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED ) != null ) {
4702                 return false;
4703             }
4704         }
4705         catch ( final Exception e ) {
4706             e.printStackTrace( System.out );
4707             return false;
4708         }
4709         return true;
4710     }
4711
4712     private static boolean testExtractUniProtKbProteinSeqIdentifier() {
4713         try {
4714             PhylogenyNode n = new PhylogenyNode();
4715             n.setName( "tr|B3RJ64" );
4716             if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "B3RJ64" ) ) {
4717                 return false;
4718             }
4719             n.setName( "tr.B3RJ64" );
4720             if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "B3RJ64" ) ) {
4721                 return false;
4722             }
4723             n.setName( "tr=B3RJ64" );
4724             if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "B3RJ64" ) ) {
4725                 return false;
4726             }
4727             n.setName( "tr-B3RJ64" );
4728             if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "B3RJ64" ) ) {
4729                 return false;
4730             }
4731             n.setName( "tr/B3RJ64" );
4732             if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "B3RJ64" ) ) {
4733                 return false;
4734             }
4735             n.setName( "tr\\B3RJ64" );
4736             if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "B3RJ64" ) ) {
4737                 return false;
4738             }
4739             n.setName( "tr_B3RJ64" );
4740             if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "B3RJ64" ) ) {
4741                 return false;
4742             }
4743             n.setName( " tr|B3RJ64 " );
4744             if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "B3RJ64" ) ) {
4745                 return false;
4746             }
4747             n.setName( "-tr|B3RJ64-" );
4748             if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "B3RJ64" ) ) {
4749                 return false;
4750             }
4751             n.setName( "-tr=B3RJ64-" );
4752             if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "B3RJ64" ) ) {
4753                 return false;
4754             }
4755             n.setName( "_tr=B3RJ64_" );
4756             if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "B3RJ64" ) ) {
4757                 return false;
4758             }
4759             n.setName( " tr_tr|B3RJ64_sp|123 " );
4760             if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "B3RJ64" ) ) {
4761                 return false;
4762             }
4763             n.setName( "B3RJ64" );
4764             if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "B3RJ64" ) ) {
4765                 return false;
4766             }
4767             n.setName( "sp|B3RJ64" );
4768             if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "B3RJ64" ) ) {
4769                 return false;
4770             }
4771             n.setName( "sp|B3RJ64C" );
4772             if ( SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ) != null ) {
4773                 return false;
4774             }
4775             n.setName( "sp B3RJ64" );
4776             if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "B3RJ64" ) ) {
4777                 return false;
4778             }
4779             n.setName( "sp|B3RJ6X" );
4780             if ( SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ) != null ) {
4781                 return false;
4782             }
4783             n.setName( "sp|B3RJ6" );
4784             if ( SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ) != null ) {
4785                 return false;
4786             }
4787             n.setName( "K1PYK7_CRAGI" );
4788             if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "K1PYK7_CRAGI" ) ) {
4789                 return false;
4790             }
4791             n.setName( "K1PYK7_PEA" );
4792             if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "K1PYK7_PEA" ) ) {
4793                 return false;
4794             }
4795             n.setName( "K1PYK7_RAT" );
4796             if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "K1PYK7_RAT" ) ) {
4797                 return false;
4798             }
4799             n.setName( "K1PYK7_PIG" );
4800             if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "K1PYK7_PIG" ) ) {
4801                 return false;
4802             }
4803             n.setName( "~K1PYK7_PIG~" );
4804             if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "K1PYK7_PIG" ) ) {
4805                 return false;
4806             }
4807             n.setName( "123456_ECOLI-K1PYK7_CRAGI-sp" );
4808             if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "K1PYK7_CRAGI" ) ) {
4809                 return false;
4810             }
4811             n.setName( "K1PYKX_CRAGI" );
4812             if ( SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ) != null ) {
4813                 return false;
4814             }
4815             n.setName( "XXXXX_CRAGI" );
4816             if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "XXXXX_CRAGI" ) ) {
4817                 return false;
4818             }
4819             n.setName( "tr|H3IB65|H3IB65_STRPU~2-2" );
4820             if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "H3IB65" ) ) {
4821                 return false;
4822             }
4823             n.setName( "jgi|Lacbi2|181470|Lacbi1.estExt_GeneWisePlus_human.C_10729~2-3" );
4824             if ( SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ) != null ) {
4825                 return false;
4826             }
4827             n.setName( "sp|Q86U06|RBM23_HUMAN~2-2" );
4828             if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "Q86U06" ) ) {
4829                 return false;
4830             }
4831             n = new PhylogenyNode();
4832             org.forester.phylogeny.data.Sequence seq = new org.forester.phylogeny.data.Sequence();
4833             seq.setSymbol( "K1PYK7_CRAGI" );
4834             n.getNodeData().addSequence( seq );
4835             if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "K1PYK7_CRAGI" ) ) {
4836                 return false;
4837             }
4838             seq.setSymbol( "tr|B3RJ64" );
4839             if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "B3RJ64" ) ) {
4840                 return false;
4841             }
4842             n = new PhylogenyNode();
4843             seq = new org.forester.phylogeny.data.Sequence();
4844             seq.setName( "K1PYK7_CRAGI" );
4845             n.getNodeData().addSequence( seq );
4846             if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "K1PYK7_CRAGI" ) ) {
4847                 return false;
4848             }
4849             seq.setName( "tr|B3RJ64" );
4850             if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "B3RJ64" ) ) {
4851                 return false;
4852             }
4853             n = new PhylogenyNode();
4854             seq = new org.forester.phylogeny.data.Sequence();
4855             seq.setAccession( new Accession( "K1PYK8_CRAGI", "?" ) );
4856             n.getNodeData().addSequence( seq );
4857             if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "K1PYK8_CRAGI" ) ) {
4858                 return false;
4859             }
4860             n = new PhylogenyNode();
4861             seq = new org.forester.phylogeny.data.Sequence();
4862             seq.setAccession( new Accession( "tr|B3RJ64", "?" ) );
4863             n.getNodeData().addSequence( seq );
4864             if ( !SequenceAccessionTools.obtainUniProtAccessorFromDataFields( n ).equals( "B3RJ64" ) ) {
4865                 return false;
4866             }
4867             //
4868             n = new PhylogenyNode();
4869             n.setName( "ACP19736" );
4870             if ( !SequenceAccessionTools.obtainGenbankAccessorFromDataFields( n ).equals( "ACP19736" ) ) {
4871                 return false;
4872             }
4873             n = new PhylogenyNode();
4874             n.setName( "|ACP19736|" );
4875             if ( !SequenceAccessionTools.obtainGenbankAccessorFromDataFields( n ).equals( "ACP19736" ) ) {
4876                 return false;
4877             }
4878         }
4879         catch ( final Exception e ) {
4880             e.printStackTrace( System.out );
4881             return false;
4882         }
4883         return true;
4884     }
4885
4886     private static boolean testFastaParser() {
4887         try {
4888             if ( !FastaParser.isLikelyFasta( new FileInputStream( PATH_TO_TEST_DATA + "fasta_0.fasta" ) ) ) {
4889                 return false;
4890             }
4891             if ( FastaParser.isLikelyFasta( new FileInputStream( PATH_TO_TEST_DATA + "msa_3.txt" ) ) ) {
4892                 return false;
4893             }
4894             final Msa msa_0 = FastaParser.parseMsa( new FileInputStream( PATH_TO_TEST_DATA + "fasta_0.fasta" ) );
4895             if ( !msa_0.getSequenceAsString( 0 ).toString().equalsIgnoreCase( "ACGTGKXFMFDMXEXXXSFMFMF" ) ) {
4896                 return false;
4897             }
4898             if ( !msa_0.getIdentifier( 0 ).equals( "one dumb" ) ) {
4899                 return false;
4900             }
4901             if ( !msa_0.getSequenceAsString( 1 ).toString().equalsIgnoreCase( "DKXASDFXSFXFKFKSXDFKSLX" ) ) {
4902                 return false;
4903             }
4904             if ( !msa_0.getSequenceAsString( 2 ).toString().equalsIgnoreCase( "SXDFKSXLFSFPWEXPROWXERR" ) ) {
4905                 return false;
4906             }
4907             if ( !msa_0.getSequenceAsString( 3 ).toString().equalsIgnoreCase( "AAAAAAAAAAAAAAAAAAAAAAA" ) ) {
4908                 return false;
4909             }
4910             if ( !msa_0.getSequenceAsString( 4 ).toString().equalsIgnoreCase( "DDDDDDDDDDDDDDDDDDDDAXF" ) ) {
4911                 return false;
4912             }
4913         }
4914         catch ( final Exception e ) {
4915             e.printStackTrace();
4916             return false;
4917         }
4918         return true;
4919     }
4920
4921     private static boolean testGenbankAccessorParsing() {
4922         //The format for GenBank Accession numbers are:
4923         //Nucleotide: 1 letter + 5 numerals OR 2 letters + 6 numerals
4924         //Protein:    3 letters + 5 numerals
4925         //http://www.ncbi.nlm.nih.gov/Sequin/acc.html
4926         if ( !SequenceAccessionTools.parseGenbankAccessorFromString( "AY423861" ).equals( "AY423861" ) ) {
4927             return false;
4928         }
4929         if ( !SequenceAccessionTools.parseGenbankAccessorFromString( ".AY423861.2" ).equals( "AY423861.2" ) ) {
4930             return false;
4931         }
4932         if ( !SequenceAccessionTools.parseGenbankAccessorFromString( "345_.AY423861.24_345" ).equals( "AY423861.24" ) ) {
4933             return false;
4934         }
4935         if ( SequenceAccessionTools.parseGenbankAccessorFromString( "AAY423861" ) != null ) {
4936             return false;
4937         }
4938         if ( SequenceAccessionTools.parseGenbankAccessorFromString( "AY4238612" ) != null ) {
4939             return false;
4940         }
4941         if ( SequenceAccessionTools.parseGenbankAccessorFromString( "AAY4238612" ) != null ) {
4942             return false;
4943         }
4944         if ( SequenceAccessionTools.parseGenbankAccessorFromString( "Y423861" ) != null ) {
4945             return false;
4946         }
4947         if ( !SequenceAccessionTools.parseGenbankAccessorFromString( "S12345" ).equals( "S12345" ) ) {
4948             return false;
4949         }
4950         if ( !SequenceAccessionTools.parseGenbankAccessorFromString( "|S12345|" ).equals( "S12345" ) ) {
4951             return false;
4952         }
4953         if ( SequenceAccessionTools.parseGenbankAccessorFromString( "|S123456" ) != null ) {
4954             return false;
4955         }
4956         if ( SequenceAccessionTools.parseGenbankAccessorFromString( "ABC123456" ) != null ) {
4957             return false;
4958         }
4959         if ( !SequenceAccessionTools.parseGenbankAccessorFromString( "ABC12345" ).equals( "ABC12345" ) ) {
4960             return false;
4961         }
4962         if ( !SequenceAccessionTools.parseGenbankAccessorFromString( "&ABC12345&" ).equals( "ABC12345" ) ) {
4963             return false;
4964         }
4965         if ( SequenceAccessionTools.parseGenbankAccessorFromString( "ABCD12345" ) != null ) {
4966             return false;
4967         }
4968         return true;
4969     }
4970
4971     private static boolean testGeneralMsaParser() {
4972         try {
4973             final String msa_str_0 = "seq1 abcd\n\nseq2 efgh\n";
4974             final Msa msa_0 = GeneralMsaParser.parse( new ByteArrayInputStream( msa_str_0.getBytes() ) );
4975             final String msa_str_1 = "seq1 abc\nseq2 ghi\nseq1 def\nseq2 jkm\n";
4976             final Msa msa_1 = GeneralMsaParser.parse( new ByteArrayInputStream( msa_str_1.getBytes() ) );
4977             final String msa_str_2 = "seq1 abc\nseq2 ghi\n\ndef\njkm\n";
4978             final Msa msa_2 = GeneralMsaParser.parse( new ByteArrayInputStream( msa_str_2.getBytes() ) );
4979             final String msa_str_3 = "seq1 abc\n def\nseq2 ghi\n jkm\n";
4980             final Msa msa_3 = GeneralMsaParser.parse( new ByteArrayInputStream( msa_str_3.getBytes() ) );
4981             if ( !msa_1.getSequenceAsString( 0 ).toString().equalsIgnoreCase( "abcdef" ) ) {
4982                 return false;
4983             }
4984             if ( !msa_1.getSequenceAsString( 1 ).toString().equalsIgnoreCase( "ghixkm" ) ) {
4985                 return false;
4986             }
4987             if ( !msa_1.getIdentifier( 0 ).toString().equals( "seq1" ) ) {
4988                 return false;
4989             }
4990             if ( !msa_1.getIdentifier( 1 ).toString().equals( "seq2" ) ) {
4991                 return false;
4992             }
4993             if ( !msa_2.getSequenceAsString( 0 ).toString().equalsIgnoreCase( "abcdef" ) ) {
4994                 return false;
4995             }
4996             if ( !msa_2.getSequenceAsString( 1 ).toString().equalsIgnoreCase( "ghixkm" ) ) {
4997                 return false;
4998             }
4999             if ( !msa_2.getIdentifier( 0 ).toString().equals( "seq1" ) ) {
5000                 return false;
5001             }
5002             if ( !msa_2.getIdentifier( 1 ).toString().equals( "seq2" ) ) {
5003                 return false;
5004             }
5005             if ( !msa_3.getSequenceAsString( 0 ).toString().equalsIgnoreCase( "abcdef" ) ) {
5006                 return false;
5007             }
5008             if ( !msa_3.getSequenceAsString( 1 ).toString().equalsIgnoreCase( "ghixkm" ) ) {
5009                 return false;
5010             }
5011             if ( !msa_3.getIdentifier( 0 ).toString().equals( "seq1" ) ) {
5012                 return false;
5013             }
5014             if ( !msa_3.getIdentifier( 1 ).toString().equals( "seq2" ) ) {
5015                 return false;
5016             }
5017             final Msa msa_4 = GeneralMsaParser.parse( new FileInputStream( PATH_TO_TEST_DATA + "msa_1.txt" ) );
5018             if ( !msa_4.getSequenceAsString( 0 ).toString().equalsIgnoreCase( "abcdefeeeeeeeexx" ) ) {
5019                 return false;
5020             }
5021             if ( !msa_4.getSequenceAsString( 1 ).toString().equalsIgnoreCase( "efghixffffffffyy" ) ) {
5022                 return false;
5023             }
5024             if ( !msa_4.getSequenceAsString( 2 ).toString().equalsIgnoreCase( "klmnxphhhhhhhhzz" ) ) {
5025                 return false;
5026             }
5027             final Msa msa_5 = GeneralMsaParser.parse( new FileInputStream( PATH_TO_TEST_DATA + "msa_2.txt" ) );
5028             if ( !msa_5.getSequenceAsString( 0 ).toString().equalsIgnoreCase( "abcdefxx" ) ) {
5029                 return false;
5030             }
5031             if ( !msa_5.getSequenceAsString( 1 ).toString().equalsIgnoreCase( "efghixyy" ) ) {
5032                 return false;
5033             }
5034             if ( !msa_5.getSequenceAsString( 2 ).toString().equalsIgnoreCase( "klmnxpzz" ) ) {
5035                 return false;
5036             }
5037             final Msa msa_6 = GeneralMsaParser.parse( new FileInputStream( PATH_TO_TEST_DATA + "msa_3.txt" ) );
5038             if ( !msa_6.getSequenceAsString( 0 ).toString().equalsIgnoreCase( "abcdefeeeeeeeexx" ) ) {
5039                 return false;
5040             }
5041             if ( !msa_6.getSequenceAsString( 1 ).toString().equalsIgnoreCase( "efghixffffffffyy" ) ) {
5042                 return false;
5043             }
5044             if ( !msa_6.getSequenceAsString( 2 ).toString().equalsIgnoreCase( "klmnxphhhhhhhhzz" ) ) {
5045                 return false;
5046             }
5047         }
5048         catch ( final Exception e ) {
5049             e.printStackTrace();
5050             return false;
5051         }
5052         return true;
5053     }
5054
5055     private static boolean testGeneralTable() {
5056         try {
5057             final GeneralTable<Integer, String> t0 = new GeneralTable<Integer, String>();
5058             t0.setValue( 3, 2, "23" );
5059             t0.setValue( 10, 1, "error" );
5060             t0.setValue( 10, 1, "110" );
5061             t0.setValue( 9, 1, "19" );
5062             t0.setValue( 1, 10, "101" );
5063             t0.setValue( 10, 10, "1010" );
5064             t0.setValue( 100, 10, "10100" );
5065             t0.setValue( 0, 0, "00" );
5066             if ( !t0.getValue( 3, 2 ).equals( "23" ) ) {
5067                 return false;
5068             }
5069             if ( !t0.getValue( 10, 1 ).equals( "110" ) ) {
5070                 return false;
5071             }
5072             if ( !t0.getValueAsString( 1, 10 ).equals( "101" ) ) {
5073                 return false;
5074             }
5075             if ( !t0.getValueAsString( 10, 10 ).equals( "1010" ) ) {
5076                 return false;
5077             }
5078             if ( !t0.getValueAsString( 100, 10 ).equals( "10100" ) ) {
5079                 return false;
5080             }
5081             if ( !t0.getValueAsString( 9, 1 ).equals( "19" ) ) {
5082                 return false;
5083             }
5084             if ( !t0.getValueAsString( 0, 0 ).equals( "00" ) ) {
5085                 return false;
5086             }
5087             if ( !t0.getValueAsString( 49, 4 ).equals( "" ) ) {
5088                 return false;
5089             }
5090             if ( !t0.getValueAsString( 22349, 3434344 ).equals( "" ) ) {
5091                 return false;
5092             }
5093             final GeneralTable<String, String> t1 = new GeneralTable<String, String>();
5094             t1.setValue( "3", "2", "23" );
5095             t1.setValue( "10", "1", "error" );
5096             t1.setValue( "10", "1", "110" );
5097             t1.setValue( "9", "1", "19" );
5098             t1.setValue( "1", "10", "101" );
5099             t1.setValue( "10", "10", "1010" );
5100             t1.setValue( "100", "10", "10100" );
5101             t1.setValue( "0", "0", "00" );
5102             t1.setValue( "qwerty", "zxcvbnm", "asdef" );
5103             if ( !t1.getValue( "3", "2" ).equals( "23" ) ) {
5104                 return false;
5105             }
5106             if ( !t1.getValue( "10", "1" ).equals( "110" ) ) {
5107                 return false;
5108             }
5109             if ( !t1.getValueAsString( "1", "10" ).equals( "101" ) ) {
5110                 return false;
5111             }
5112             if ( !t1.getValueAsString( "10", "10" ).equals( "1010" ) ) {
5113                 return false;
5114             }
5115             if ( !t1.getValueAsString( "100", "10" ).equals( "10100" ) ) {
5116                 return false;
5117             }
5118             if ( !t1.getValueAsString( "9", "1" ).equals( "19" ) ) {
5119                 return false;
5120             }
5121             if ( !t1.getValueAsString( "0", "0" ).equals( "00" ) ) {
5122                 return false;
5123             }
5124             if ( !t1.getValueAsString( "qwerty", "zxcvbnm" ).equals( "asdef" ) ) {
5125                 return false;
5126             }
5127             if ( !t1.getValueAsString( "49", "4" ).equals( "" ) ) {
5128                 return false;
5129             }
5130             if ( !t1.getValueAsString( "22349", "3434344" ).equals( "" ) ) {
5131                 return false;
5132             }
5133         }
5134         catch ( final Exception e ) {
5135             e.printStackTrace( System.out );
5136             return false;
5137         }
5138         return true;
5139     }
5140
5141     private static boolean testGetDistance() {
5142         try {
5143             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
5144             final Phylogeny p1 = factory.create( "(((A:1,B:2,X:100)ab:3,C:4)abc:5,(D:7,(E:9,F:10)ef:8)def:6)r",
5145                                                  new NHXParser() )[ 0 ];
5146             if ( PhylogenyMethods.calculateDistance( p1.getNode( "C" ), p1.getNode( "C" ) ) != 0 ) {
5147                 return false;
5148             }
5149             if ( PhylogenyMethods.calculateDistance( p1.getNode( "def" ), p1.getNode( "def" ) ) != 0 ) {
5150                 return false;
5151             }
5152             if ( PhylogenyMethods.calculateDistance( p1.getNode( "ef" ), p1.getNode( "ef" ) ) != 0 ) {
5153                 return false;
5154             }
5155             if ( PhylogenyMethods.calculateDistance( p1.getNode( "r" ), p1.getNode( "r" ) ) != 0 ) {
5156                 return false;
5157             }
5158             if ( PhylogenyMethods.calculateDistance( p1.getNode( "A" ), p1.getNode( "A" ) ) != 0 ) {
5159                 return false;
5160             }
5161             if ( PhylogenyMethods.calculateDistance( p1.getNode( "A" ), p1.getNode( "B" ) ) != 3 ) {
5162                 return false;
5163             }
5164             if ( PhylogenyMethods.calculateDistance( p1.getNode( "B" ), p1.getNode( "A" ) ) != 3 ) {
5165                 return false;
5166             }
5167             if ( PhylogenyMethods.calculateDistance( p1.getNode( "A" ), p1.getNode( "C" ) ) != 8 ) {
5168                 return false;
5169             }
5170             if ( PhylogenyMethods.calculateDistance( p1.getNode( "C" ), p1.getNode( "A" ) ) != 8 ) {
5171                 return false;
5172             }
5173             if ( PhylogenyMethods.calculateDistance( p1.getNode( "A" ), p1.getNode( "D" ) ) != 22 ) {
5174                 return false;
5175             }
5176             if ( PhylogenyMethods.calculateDistance( p1.getNode( "A" ), p1.getNode( "E" ) ) != 32 ) {
5177                 return false;
5178             }
5179             if ( PhylogenyMethods.calculateDistance( p1.getNode( "E" ), p1.getNode( "A" ) ) != 32 ) {
5180                 return false;
5181             }
5182             if ( PhylogenyMethods.calculateDistance( p1.getNode( "A" ), p1.getNode( "F" ) ) != 33 ) {
5183                 return false;
5184             }
5185             if ( PhylogenyMethods.calculateDistance( p1.getNode( "F" ), p1.getNode( "A" ) ) != 33 ) {
5186                 return false;
5187             }
5188             if ( PhylogenyMethods.calculateDistance( p1.getNode( "A" ), p1.getNode( "ab" ) ) != 1 ) {
5189                 return false;
5190             }
5191             if ( PhylogenyMethods.calculateDistance( p1.getNode( "ab" ), p1.getNode( "A" ) ) != 1 ) {
5192                 return false;
5193             }
5194             if ( PhylogenyMethods.calculateDistance( p1.getNode( "A" ), p1.getNode( "abc" ) ) != 4 ) {
5195                 return false;
5196             }
5197             if ( PhylogenyMethods.calculateDistance( p1.getNode( "abc" ), p1.getNode( "A" ) ) != 4 ) {
5198                 return false;
5199             }
5200             if ( PhylogenyMethods.calculateDistance( p1.getNode( "A" ), p1.getNode( "r" ) ) != 9 ) {
5201                 return false;
5202             }
5203             if ( PhylogenyMethods.calculateDistance( p1.getNode( "r" ), p1.getNode( "A" ) ) != 9 ) {
5204                 return false;
5205             }
5206             if ( PhylogenyMethods.calculateDistance( p1.getNode( "A" ), p1.getNode( "def" ) ) != 15 ) {
5207                 return false;
5208             }
5209             if ( PhylogenyMethods.calculateDistance( p1.getNode( "def" ), p1.getNode( "A" ) ) != 15 ) {
5210                 return false;
5211             }
5212             if ( PhylogenyMethods.calculateDistance( p1.getNode( "A" ), p1.getNode( "ef" ) ) != 23 ) {
5213                 return false;
5214             }
5215             if ( PhylogenyMethods.calculateDistance( p1.getNode( "ef" ), p1.getNode( "A" ) ) != 23 ) {
5216                 return false;
5217             }
5218             if ( PhylogenyMethods.calculateDistance( p1.getNode( "ef" ), p1.getNode( "def" ) ) != 8 ) {
5219                 return false;
5220             }
5221             if ( PhylogenyMethods.calculateDistance( p1.getNode( "def" ), p1.getNode( "ef" ) ) != 8 ) {
5222                 return false;
5223             }
5224             if ( PhylogenyMethods.calculateDistance( p1.getNode( "ef" ), p1.getNode( "r" ) ) != 14 ) {
5225                 return false;
5226             }
5227             if ( PhylogenyMethods.calculateDistance( p1.getNode( "ef" ), p1.getNode( "abc" ) ) != 19 ) {
5228                 return false;
5229             }
5230             if ( PhylogenyMethods.calculateDistance( p1.getNode( "ef" ), p1.getNode( "ab" ) ) != 22 ) {
5231                 return false;
5232             }
5233             if ( PhylogenyMethods.calculateDistance( p1.getNode( "ab" ), p1.getNode( "ef" ) ) != 22 ) {
5234                 return false;
5235             }
5236             if ( PhylogenyMethods.calculateDistance( p1.getNode( "def" ), p1.getNode( "abc" ) ) != 11 ) {
5237                 return false;
5238             }
5239             final Phylogeny p2 = factory.create( "((A:4,B:5,C:6)abc:1,(D:7,E:8,F:9)def:2,(G:10,H:11,I:12)ghi:3)r",
5240                                                  new NHXParser() )[ 0 ];
5241             if ( PhylogenyMethods.calculateDistance( p2.getNode( "A" ), p2.getNode( "B" ) ) != 9 ) {
5242                 return false;
5243             }
5244             if ( PhylogenyMethods.calculateDistance( p2.getNode( "A" ), p2.getNode( "C" ) ) != 10 ) {
5245                 return false;
5246             }
5247             if ( PhylogenyMethods.calculateDistance( p2.getNode( "A" ), p2.getNode( "D" ) ) != 14 ) {
5248                 return false;
5249             }
5250             if ( PhylogenyMethods.calculateDistance( p2.getNode( "A" ), p2.getNode( "ghi" ) ) != 8 ) {
5251                 return false;
5252             }
5253             if ( PhylogenyMethods.calculateDistance( p2.getNode( "A" ), p2.getNode( "I" ) ) != 20 ) {
5254                 return false;
5255             }
5256             if ( PhylogenyMethods.calculateDistance( p2.getNode( "G" ), p2.getNode( "ghi" ) ) != 10 ) {
5257                 return false;
5258             }
5259             if ( PhylogenyMethods.calculateDistance( p2.getNode( "r" ), p2.getNode( "r" ) ) != 0 ) {
5260                 return false;
5261             }
5262             if ( PhylogenyMethods.calculateDistance( p2.getNode( "r" ), p2.getNode( "G" ) ) != 13 ) {
5263                 return false;
5264             }
5265             if ( PhylogenyMethods.calculateDistance( p2.getNode( "G" ), p2.getNode( "r" ) ) != 13 ) {
5266                 return false;
5267             }
5268             if ( PhylogenyMethods.calculateDistance( p2.getNode( "G" ), p2.getNode( "H" ) ) != 21 ) {
5269                 return false;
5270             }
5271             if ( PhylogenyMethods.calculateDistance( p2.getNode( "G" ), p2.getNode( "I" ) ) != 22 ) {
5272                 return false;
5273             }
5274         }
5275         catch ( final Exception e ) {
5276             e.printStackTrace( System.out );
5277             return false;
5278         }
5279         return true;
5280     }
5281
5282     private static boolean testGetLCA() {
5283         try {
5284             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
5285             final Phylogeny p1 = factory.create( "((((((A,B)ab,C)abc,D)abcd,E)abcde,F)abcdef,(G,H)gh)abcdefgh",
5286                                                  new NHXParser() )[ 0 ];
5287             final PhylogenyNode A = PhylogenyMethods.calculateLCA( p1.getNode( "A" ), p1.getNode( "A" ) );
5288             if ( !A.getName().equals( "A" ) ) {
5289                 return false;
5290             }
5291             final PhylogenyNode gh = PhylogenyMethods.calculateLCA( p1.getNode( "gh" ), p1.getNode( "gh" ) );
5292             if ( !gh.getName().equals( "gh" ) ) {
5293                 return false;
5294             }
5295             final PhylogenyNode ab = PhylogenyMethods.calculateLCA( p1.getNode( "A" ), p1.getNode( "B" ) );
5296             if ( !ab.getName().equals( "ab" ) ) {
5297                 return false;
5298             }
5299             final PhylogenyNode ab2 = PhylogenyMethods.calculateLCA( p1.getNode( "B" ), p1.getNode( "A" ) );
5300             if ( !ab2.getName().equals( "ab" ) ) {
5301                 return false;
5302             }
5303             final PhylogenyNode gh2 = PhylogenyMethods.calculateLCA( p1.getNode( "H" ), p1.getNode( "G" ) );
5304             if ( !gh2.getName().equals( "gh" ) ) {
5305                 return false;
5306             }
5307             final PhylogenyNode gh3 = PhylogenyMethods.calculateLCA( p1.getNode( "G" ), p1.getNode( "H" ) );
5308             if ( !gh3.getName().equals( "gh" ) ) {
5309                 return false;
5310             }
5311             final PhylogenyNode abc = PhylogenyMethods.calculateLCA( p1.getNode( "C" ), p1.getNode( "A" ) );
5312             if ( !abc.getName().equals( "abc" ) ) {
5313                 return false;
5314             }
5315             final PhylogenyNode abc2 = PhylogenyMethods.calculateLCA( p1.getNode( "A" ), p1.getNode( "C" ) );
5316             if ( !abc2.getName().equals( "abc" ) ) {
5317                 return false;
5318             }
5319             final PhylogenyNode abcd = PhylogenyMethods.calculateLCA( p1.getNode( "A" ), p1.getNode( "D" ) );
5320             if ( !abcd.getName().equals( "abcd" ) ) {
5321                 return false;
5322             }
5323             final PhylogenyNode abcd2 = PhylogenyMethods.calculateLCA( p1.getNode( "D" ), p1.getNode( "A" ) );
5324             if ( !abcd2.getName().equals( "abcd" ) ) {
5325                 return false;
5326             }
5327             final PhylogenyNode abcdef = PhylogenyMethods.calculateLCA( p1.getNode( "A" ), p1.getNode( "F" ) );
5328             if ( !abcdef.getName().equals( "abcdef" ) ) {
5329                 return false;
5330             }
5331             final PhylogenyNode abcdef2 = PhylogenyMethods.calculateLCA( p1.getNode( "F" ), p1.getNode( "A" ) );
5332             if ( !abcdef2.getName().equals( "abcdef" ) ) {
5333                 return false;
5334             }
5335             final PhylogenyNode abcdef3 = PhylogenyMethods.calculateLCA( p1.getNode( "ab" ), p1.getNode( "F" ) );
5336             if ( !abcdef3.getName().equals( "abcdef" ) ) {
5337                 return false;
5338             }
5339             final PhylogenyNode abcdef4 = PhylogenyMethods.calculateLCA( p1.getNode( "F" ), p1.getNode( "ab" ) );
5340             if ( !abcdef4.getName().equals( "abcdef" ) ) {
5341                 return false;
5342             }
5343             final PhylogenyNode abcde = PhylogenyMethods.calculateLCA( p1.getNode( "A" ), p1.getNode( "E" ) );
5344             if ( !abcde.getName().equals( "abcde" ) ) {
5345                 return false;
5346             }
5347             final PhylogenyNode abcde2 = PhylogenyMethods.calculateLCA( p1.getNode( "E" ), p1.getNode( "A" ) );
5348             if ( !abcde2.getName().equals( "abcde" ) ) {
5349                 return false;
5350             }
5351             final PhylogenyNode r = PhylogenyMethods.calculateLCA( p1.getNode( "abcdefgh" ), p1.getNode( "abcdefgh" ) );
5352             if ( !r.getName().equals( "abcdefgh" ) ) {
5353                 return false;
5354             }
5355             final PhylogenyNode r2 = PhylogenyMethods.calculateLCA( p1.getNode( "A" ), p1.getNode( "H" ) );
5356             if ( !r2.getName().equals( "abcdefgh" ) ) {
5357                 return false;
5358             }
5359             final PhylogenyNode r3 = PhylogenyMethods.calculateLCA( p1.getNode( "H" ), p1.getNode( "A" ) );
5360             if ( !r3.getName().equals( "abcdefgh" ) ) {
5361                 return false;
5362             }
5363             final PhylogenyNode abcde3 = PhylogenyMethods.calculateLCA( p1.getNode( "E" ), p1.getNode( "abcde" ) );
5364             if ( !abcde3.getName().equals( "abcde" ) ) {
5365                 return false;
5366             }
5367             final PhylogenyNode abcde4 = PhylogenyMethods.calculateLCA( p1.getNode( "abcde" ), p1.getNode( "E" ) );
5368             if ( !abcde4.getName().equals( "abcde" ) ) {
5369                 return false;
5370             }
5371             final PhylogenyNode ab3 = PhylogenyMethods.calculateLCA( p1.getNode( "ab" ), p1.getNode( "B" ) );
5372             if ( !ab3.getName().equals( "ab" ) ) {
5373                 return false;
5374             }
5375             final PhylogenyNode ab4 = PhylogenyMethods.calculateLCA( p1.getNode( "B" ), p1.getNode( "ab" ) );
5376             if ( !ab4.getName().equals( "ab" ) ) {
5377                 return false;
5378             }
5379             final Phylogeny p2 = factory.create( "(a,b,(((c,d)cd,e)cde,f)cdef)r", new NHXParser() )[ 0 ];
5380             final PhylogenyNode cd = PhylogenyMethods.calculateLCA( p2.getNode( "c" ), p2.getNode( "d" ) );
5381             if ( !cd.getName().equals( "cd" ) ) {
5382                 return false;
5383             }
5384             final PhylogenyNode cd2 = PhylogenyMethods.calculateLCA( p2.getNode( "d" ), p2.getNode( "c" ) );
5385             if ( !cd2.getName().equals( "cd" ) ) {
5386                 return false;
5387             }
5388             final PhylogenyNode cde = PhylogenyMethods.calculateLCA( p2.getNode( "c" ), p2.getNode( "e" ) );
5389             if ( !cde.getName().equals( "cde" ) ) {
5390                 return false;
5391             }
5392             final PhylogenyNode cde2 = PhylogenyMethods.calculateLCA( p2.getNode( "e" ), p2.getNode( "c" ) );
5393             if ( !cde2.getName().equals( "cde" ) ) {
5394                 return false;
5395             }
5396             final PhylogenyNode cdef = PhylogenyMethods.calculateLCA( p2.getNode( "c" ), p2.getNode( "f" ) );
5397             if ( !cdef.getName().equals( "cdef" ) ) {
5398                 return false;
5399             }
5400             final PhylogenyNode cdef2 = PhylogenyMethods.calculateLCA( p2.getNode( "d" ), p2.getNode( "f" ) );
5401             if ( !cdef2.getName().equals( "cdef" ) ) {
5402                 return false;
5403             }
5404             final PhylogenyNode cdef3 = PhylogenyMethods.calculateLCA( p2.getNode( "f" ), p2.getNode( "d" ) );
5405             if ( !cdef3.getName().equals( "cdef" ) ) {
5406                 return false;
5407             }
5408             final PhylogenyNode rt = PhylogenyMethods.calculateLCA( p2.getNode( "c" ), p2.getNode( "a" ) );
5409             if ( !rt.getName().equals( "r" ) ) {
5410                 return false;
5411             }
5412             final Phylogeny p3 = factory
5413                     .create( "((((a,(b,c)bc)abc,(d,e)de)abcde,f)abcdef,(((g,h)gh,(i,j)ij)ghij,k)ghijk,l)",
5414                              new NHXParser() )[ 0 ];
5415             final PhylogenyNode bc_3 = PhylogenyMethods.calculateLCA( p3.getNode( "b" ), p3.getNode( "c" ) );
5416             if ( !bc_3.getName().equals( "bc" ) ) {
5417                 return false;
5418             }
5419             final PhylogenyNode ac_3 = PhylogenyMethods.calculateLCA( p3.getNode( "a" ), p3.getNode( "c" ) );
5420             if ( !ac_3.getName().equals( "abc" ) ) {
5421                 return false;
5422             }
5423             final PhylogenyNode ad_3 = PhylogenyMethods.calculateLCA( p3.getNode( "a" ), p3.getNode( "d" ) );
5424             if ( !ad_3.getName().equals( "abcde" ) ) {
5425                 return false;
5426             }
5427             final PhylogenyNode af_3 = PhylogenyMethods.calculateLCA( p3.getNode( "a" ), p3.getNode( "f" ) );
5428             if ( !af_3.getName().equals( "abcdef" ) ) {
5429                 return false;
5430             }
5431             final PhylogenyNode ag_3 = PhylogenyMethods.calculateLCA( p3.getNode( "a" ), p3.getNode( "g" ) );
5432             if ( !ag_3.getName().equals( "" ) ) {
5433                 return false;
5434             }
5435             if ( !ag_3.isRoot() ) {
5436                 return false;
5437             }
5438             final PhylogenyNode al_3 = PhylogenyMethods.calculateLCA( p3.getNode( "a" ), p3.getNode( "l" ) );
5439             if ( !al_3.getName().equals( "" ) ) {
5440                 return false;
5441             }
5442             if ( !al_3.isRoot() ) {
5443                 return false;
5444             }
5445             final PhylogenyNode kl_3 = PhylogenyMethods.calculateLCA( p3.getNode( "k" ), p3.getNode( "l" ) );
5446             if ( !kl_3.getName().equals( "" ) ) {
5447                 return false;
5448             }
5449             if ( !kl_3.isRoot() ) {
5450                 return false;
5451             }
5452             final PhylogenyNode fl_3 = PhylogenyMethods.calculateLCA( p3.getNode( "f" ), p3.getNode( "l" ) );
5453             if ( !fl_3.getName().equals( "" ) ) {
5454                 return false;
5455             }
5456             if ( !fl_3.isRoot() ) {
5457                 return false;
5458             }
5459             final PhylogenyNode gk_3 = PhylogenyMethods.calculateLCA( p3.getNode( "g" ), p3.getNode( "k" ) );
5460             if ( !gk_3.getName().equals( "ghijk" ) ) {
5461                 return false;
5462             }
5463             final Phylogeny p4 = factory.create( "(a,b,c)r", new NHXParser() )[ 0 ];
5464             final PhylogenyNode r_4 = PhylogenyMethods.calculateLCA( p4.getNode( "b" ), p4.getNode( "c" ) );
5465             if ( !r_4.getName().equals( "r" ) ) {
5466                 return false;
5467             }
5468             final Phylogeny p5 = factory.create( "((a,b),c,d)root", new NHXParser() )[ 0 ];
5469             final PhylogenyNode r_5 = PhylogenyMethods.calculateLCA( p5.getNode( "a" ), p5.getNode( "c" ) );
5470             if ( !r_5.getName().equals( "root" ) ) {
5471                 return false;
5472             }
5473             final Phylogeny p6 = factory.create( "((a,b),c,d)rot", new NHXParser() )[ 0 ];
5474             final PhylogenyNode r_6 = PhylogenyMethods.calculateLCA( p6.getNode( "c" ), p6.getNode( "a" ) );
5475             if ( !r_6.getName().equals( "rot" ) ) {
5476                 return false;
5477             }
5478             final Phylogeny p7 = factory.create( "(((a,b)x,c)x,d,e)rott", new NHXParser() )[ 0 ];
5479             final PhylogenyNode r_7 = PhylogenyMethods.calculateLCA( p7.getNode( "a" ), p7.getNode( "e" ) );
5480             if ( !r_7.getName().equals( "rott" ) ) {
5481                 return false;
5482             }
5483         }
5484         catch ( final Exception e ) {
5485             e.printStackTrace( System.out );
5486             return false;
5487         }
5488         return true;
5489     }
5490
5491     private static boolean testGetLCA2() {
5492         try {
5493             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
5494             // final Phylogeny p_a = factory.create( "(a)", new NHXParser() )[ 0 ];
5495             final Phylogeny p_a = NHXParser.parse( "(a)" )[ 0 ];
5496             PhylogenyMethods.preOrderReId( p_a );
5497             final PhylogenyNode p_a_1 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p_a.getNode( "a" ),
5498                                                                                               p_a.getNode( "a" ) );
5499             if ( !p_a_1.getName().equals( "a" ) ) {
5500                 return false;
5501             }
5502             final Phylogeny p_b = NHXParser.parse( "((a)b)" )[ 0 ];
5503             PhylogenyMethods.preOrderReId( p_b );
5504             final PhylogenyNode p_b_1 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p_b.getNode( "b" ),
5505                                                                                               p_b.getNode( "a" ) );
5506             if ( !p_b_1.getName().equals( "b" ) ) {
5507                 return false;
5508             }
5509             final PhylogenyNode p_b_2 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p_b.getNode( "a" ),
5510                                                                                               p_b.getNode( "b" ) );
5511             if ( !p_b_2.getName().equals( "b" ) ) {
5512                 return false;
5513             }
5514             final Phylogeny p_c = factory.create( "(((a)b)c)", new NHXParser() )[ 0 ];
5515             PhylogenyMethods.preOrderReId( p_c );
5516             final PhylogenyNode p_c_1 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p_c.getNode( "b" ),
5517                                                                                               p_c.getNode( "a" ) );
5518             if ( !p_c_1.getName().equals( "b" ) ) {
5519                 return false;
5520             }
5521             final PhylogenyNode p_c_2 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p_c.getNode( "a" ),
5522                                                                                               p_c.getNode( "c" ) );
5523             if ( !p_c_2.getName().equals( "c" ) ) {
5524                 System.out.println( p_c_2.getName() );
5525                 System.exit( -1 );
5526                 return false;
5527             }
5528             final PhylogenyNode p_c_3 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p_c.getNode( "a" ),
5529                                                                                               p_c.getNode( "b" ) );
5530             if ( !p_c_3.getName().equals( "b" ) ) {
5531                 return false;
5532             }
5533             final PhylogenyNode p_c_4 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p_c.getNode( "c" ),
5534                                                                                               p_c.getNode( "a" ) );
5535             if ( !p_c_4.getName().equals( "c" ) ) {
5536                 return false;
5537             }
5538             final Phylogeny p1 = factory.create( "((((((A,B)ab,C)abc,D)abcd,E)abcde,F)abcdef,(G,H)gh)abcdefgh",
5539                                                  new NHXParser() )[ 0 ];
5540             PhylogenyMethods.preOrderReId( p1 );
5541             final PhylogenyNode A = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "A" ),
5542                                                                                           p1.getNode( "A" ) );
5543             if ( !A.getName().equals( "A" ) ) {
5544                 return false;
5545             }
5546             final PhylogenyNode gh = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "gh" ),
5547                                                                                            p1.getNode( "gh" ) );
5548             if ( !gh.getName().equals( "gh" ) ) {
5549                 return false;
5550             }
5551             final PhylogenyNode ab = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "A" ),
5552                                                                                            p1.getNode( "B" ) );
5553             if ( !ab.getName().equals( "ab" ) ) {
5554                 return false;
5555             }
5556             final PhylogenyNode ab2 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "B" ),
5557                                                                                             p1.getNode( "A" ) );
5558             if ( !ab2.getName().equals( "ab" ) ) {
5559                 return false;
5560             }
5561             final PhylogenyNode gh2 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "H" ),
5562                                                                                             p1.getNode( "G" ) );
5563             if ( !gh2.getName().equals( "gh" ) ) {
5564                 return false;
5565             }
5566             final PhylogenyNode gh3 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "G" ),
5567                                                                                             p1.getNode( "H" ) );
5568             if ( !gh3.getName().equals( "gh" ) ) {
5569                 return false;
5570             }
5571             final PhylogenyNode abc = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "C" ),
5572                                                                                             p1.getNode( "A" ) );
5573             if ( !abc.getName().equals( "abc" ) ) {
5574                 return false;
5575             }
5576             final PhylogenyNode abc2 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "A" ),
5577                                                                                              p1.getNode( "C" ) );
5578             if ( !abc2.getName().equals( "abc" ) ) {
5579                 return false;
5580             }
5581             final PhylogenyNode abcd = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "A" ),
5582                                                                                              p1.getNode( "D" ) );
5583             if ( !abcd.getName().equals( "abcd" ) ) {
5584                 return false;
5585             }
5586             final PhylogenyNode abcd2 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "D" ),
5587                                                                                               p1.getNode( "A" ) );
5588             if ( !abcd2.getName().equals( "abcd" ) ) {
5589                 return false;
5590             }
5591             final PhylogenyNode abcdef = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "A" ),
5592                                                                                                p1.getNode( "F" ) );
5593             if ( !abcdef.getName().equals( "abcdef" ) ) {
5594                 return false;
5595             }
5596             final PhylogenyNode abcdef2 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "F" ),
5597                                                                                                 p1.getNode( "A" ) );
5598             if ( !abcdef2.getName().equals( "abcdef" ) ) {
5599                 return false;
5600             }
5601             final PhylogenyNode abcdef3 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "ab" ),
5602                                                                                                 p1.getNode( "F" ) );
5603             if ( !abcdef3.getName().equals( "abcdef" ) ) {
5604                 return false;
5605             }
5606             final PhylogenyNode abcdef4 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "F" ),
5607                                                                                                 p1.getNode( "ab" ) );
5608             if ( !abcdef4.getName().equals( "abcdef" ) ) {
5609                 return false;
5610             }
5611             final PhylogenyNode abcde = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "A" ),
5612                                                                                               p1.getNode( "E" ) );
5613             if ( !abcde.getName().equals( "abcde" ) ) {
5614                 return false;
5615             }
5616             final PhylogenyNode abcde2 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "E" ),
5617                                                                                                p1.getNode( "A" ) );
5618             if ( !abcde2.getName().equals( "abcde" ) ) {
5619                 return false;
5620             }
5621             final PhylogenyNode r = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "abcdefgh" ),
5622                                                                                           p1.getNode( "abcdefgh" ) );
5623             if ( !r.getName().equals( "abcdefgh" ) ) {
5624                 return false;
5625             }
5626             final PhylogenyNode r2 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "A" ),
5627                                                                                            p1.getNode( "H" ) );
5628             if ( !r2.getName().equals( "abcdefgh" ) ) {
5629                 return false;
5630             }
5631             final PhylogenyNode r3 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "H" ),
5632                                                                                            p1.getNode( "A" ) );
5633             if ( !r3.getName().equals( "abcdefgh" ) ) {
5634                 return false;
5635             }
5636             final PhylogenyNode abcde3 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "E" ),
5637                                                                                                p1.getNode( "abcde" ) );
5638             if ( !abcde3.getName().equals( "abcde" ) ) {
5639                 return false;
5640             }
5641             final PhylogenyNode abcde4 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "abcde" ),
5642                                                                                                p1.getNode( "E" ) );
5643             if ( !abcde4.getName().equals( "abcde" ) ) {
5644                 return false;
5645             }
5646             final PhylogenyNode ab3 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "ab" ),
5647                                                                                             p1.getNode( "B" ) );
5648             if ( !ab3.getName().equals( "ab" ) ) {
5649                 return false;
5650             }
5651             final PhylogenyNode ab4 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p1.getNode( "B" ),
5652                                                                                             p1.getNode( "ab" ) );
5653             if ( !ab4.getName().equals( "ab" ) ) {
5654                 return false;
5655             }
5656             final Phylogeny p2 = factory.create( "(a,b,(((c,d)cd,e)cde,f)cdef)r", new NHXParser() )[ 0 ];
5657             PhylogenyMethods.preOrderReId( p2 );
5658             final PhylogenyNode cd = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p2.getNode( "c" ),
5659                                                                                            p2.getNode( "d" ) );
5660             if ( !cd.getName().equals( "cd" ) ) {
5661                 return false;
5662             }
5663             final PhylogenyNode cd2 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p2.getNode( "d" ),
5664                                                                                             p2.getNode( "c" ) );
5665             if ( !cd2.getName().equals( "cd" ) ) {
5666                 return false;
5667             }
5668             final PhylogenyNode cde = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p2.getNode( "c" ),
5669                                                                                             p2.getNode( "e" ) );
5670             if ( !cde.getName().equals( "cde" ) ) {
5671                 return false;
5672             }
5673             final PhylogenyNode cde2 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p2.getNode( "e" ),
5674                                                                                              p2.getNode( "c" ) );
5675             if ( !cde2.getName().equals( "cde" ) ) {
5676                 return false;
5677             }
5678             final PhylogenyNode cdef = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p2.getNode( "c" ),
5679                                                                                              p2.getNode( "f" ) );
5680             if ( !cdef.getName().equals( "cdef" ) ) {
5681                 return false;
5682             }
5683             final PhylogenyNode cdef2 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p2.getNode( "d" ),
5684                                                                                               p2.getNode( "f" ) );
5685             if ( !cdef2.getName().equals( "cdef" ) ) {
5686                 return false;
5687             }
5688             final PhylogenyNode cdef3 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p2.getNode( "f" ),
5689                                                                                               p2.getNode( "d" ) );
5690             if ( !cdef3.getName().equals( "cdef" ) ) {
5691                 return false;
5692             }
5693             final PhylogenyNode rt = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p2.getNode( "c" ),
5694                                                                                            p2.getNode( "a" ) );
5695             if ( !rt.getName().equals( "r" ) ) {
5696                 return false;
5697             }
5698             final Phylogeny p3 = factory
5699                     .create( "((((a,(b,c)bc)abc,(d,e)de)abcde,f)abcdef,(((g,h)gh,(i,j)ij)ghij,k)ghijk,l)",
5700                              new NHXParser() )[ 0 ];
5701             PhylogenyMethods.preOrderReId( p3 );
5702             final PhylogenyNode bc_3 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p3.getNode( "b" ),
5703                                                                                              p3.getNode( "c" ) );
5704             if ( !bc_3.getName().equals( "bc" ) ) {
5705                 return false;
5706             }
5707             final PhylogenyNode ac_3 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p3.getNode( "a" ),
5708                                                                                              p3.getNode( "c" ) );
5709             if ( !ac_3.getName().equals( "abc" ) ) {
5710                 return false;
5711             }
5712             final PhylogenyNode ad_3 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p3.getNode( "a" ),
5713                                                                                              p3.getNode( "d" ) );
5714             if ( !ad_3.getName().equals( "abcde" ) ) {
5715                 return false;
5716             }
5717             final PhylogenyNode af_3 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p3.getNode( "a" ),
5718                                                                                              p3.getNode( "f" ) );
5719             if ( !af_3.getName().equals( "abcdef" ) ) {
5720                 return false;
5721             }
5722             final PhylogenyNode ag_3 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p3.getNode( "a" ),
5723                                                                                              p3.getNode( "g" ) );
5724             if ( !ag_3.getName().equals( "" ) ) {
5725                 return false;
5726             }
5727             if ( !ag_3.isRoot() ) {
5728                 return false;
5729             }
5730             final PhylogenyNode al_3 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p3.getNode( "a" ),
5731                                                                                              p3.getNode( "l" ) );
5732             if ( !al_3.getName().equals( "" ) ) {
5733                 return false;
5734             }
5735             if ( !al_3.isRoot() ) {
5736                 return false;
5737             }
5738             final PhylogenyNode kl_3 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p3.getNode( "k" ),
5739                                                                                              p3.getNode( "l" ) );
5740             if ( !kl_3.getName().equals( "" ) ) {
5741                 return false;
5742             }
5743             if ( !kl_3.isRoot() ) {
5744                 return false;
5745             }
5746             final PhylogenyNode fl_3 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p3.getNode( "f" ),
5747                                                                                              p3.getNode( "l" ) );
5748             if ( !fl_3.getName().equals( "" ) ) {
5749                 return false;
5750             }
5751             if ( !fl_3.isRoot() ) {
5752                 return false;
5753             }
5754             final PhylogenyNode gk_3 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p3.getNode( "g" ),
5755                                                                                              p3.getNode( "k" ) );
5756             if ( !gk_3.getName().equals( "ghijk" ) ) {
5757                 return false;
5758             }
5759             final Phylogeny p4 = factory.create( "(a,b,c)r", new NHXParser() )[ 0 ];
5760             PhylogenyMethods.preOrderReId( p4 );
5761             final PhylogenyNode r_4 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p4.getNode( "b" ),
5762                                                                                             p4.getNode( "c" ) );
5763             if ( !r_4.getName().equals( "r" ) ) {
5764                 return false;
5765             }
5766             final Phylogeny p5 = factory.create( "((a,b),c,d)root", new NHXParser() )[ 0 ];
5767             PhylogenyMethods.preOrderReId( p5 );
5768             final PhylogenyNode r_5 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p5.getNode( "a" ),
5769                                                                                             p5.getNode( "c" ) );
5770             if ( !r_5.getName().equals( "root" ) ) {
5771                 return false;
5772             }
5773             final Phylogeny p6 = factory.create( "((a,b),c,d)rot", new NHXParser() )[ 0 ];
5774             PhylogenyMethods.preOrderReId( p6 );
5775             final PhylogenyNode r_6 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p6.getNode( "c" ),
5776                                                                                             p6.getNode( "a" ) );
5777             if ( !r_6.getName().equals( "rot" ) ) {
5778                 return false;
5779             }
5780             final Phylogeny p7 = factory.create( "(((a,b)x,c)x,d,e)rott", new NHXParser() )[ 0 ];
5781             PhylogenyMethods.preOrderReId( p7 );
5782             final PhylogenyNode r_7 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p7.getNode( "a" ),
5783                                                                                             p7.getNode( "e" ) );
5784             if ( !r_7.getName().equals( "rott" ) ) {
5785                 return false;
5786             }
5787             final PhylogenyNode r_71 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p7.getNode( "e" ),
5788                                                                                              p7.getNode( "a" ) );
5789             if ( !r_71.getName().equals( "rott" ) ) {
5790                 return false;
5791             }
5792             final PhylogenyNode r_72 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p7.getNode( "e" ),
5793                                                                                              p7.getNode( "rott" ) );
5794             if ( !r_72.getName().equals( "rott" ) ) {
5795                 return false;
5796             }
5797             final PhylogenyNode r_73 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p7.getNode( "rott" ),
5798                                                                                              p7.getNode( "a" ) );
5799             if ( !r_73.getName().equals( "rott" ) ) {
5800                 return false;
5801             }
5802             final PhylogenyNode r_74 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p7.getNode( "rott" ),
5803                                                                                              p7.getNode( "rott" ) );
5804             if ( !r_74.getName().equals( "rott" ) ) {
5805                 return false;
5806             }
5807             final PhylogenyNode r_75 = PhylogenyMethods.calculateLCAonTreeWithIdsInPreOrder( p7.getNode( "e" ),
5808                                                                                              p7.getNode( "e" ) );
5809             if ( !r_75.getName().equals( "e" ) ) {
5810                 return false;
5811             }
5812         }
5813         catch ( final Exception e ) {
5814             e.printStackTrace( System.out );
5815             return false;
5816         }
5817         return true;
5818     }
5819
5820     private static boolean testHmmscanOutputParser() {
5821         final String test_dir = Test.PATH_TO_TEST_DATA;
5822         try {
5823             final HmmscanPerDomainTableParser parser1 = new HmmscanPerDomainTableParser( new File( test_dir
5824                                                                                                    + ForesterUtil.getFileSeparator() + "hmmscan30b3_output_1" ), "MONBR", INDIVIDUAL_SCORE_CUTOFF.NONE );
5825             parser1.parse();
5826             final HmmscanPerDomainTableParser parser2 = new HmmscanPerDomainTableParser( new File( test_dir
5827                                                                                                    + ForesterUtil.getFileSeparator() + "hmmscan30b3_output_2" ), "MONBR", INDIVIDUAL_SCORE_CUTOFF.NONE );
5828             final List<Protein> proteins = parser2.parse();
5829             if ( parser2.getProteinsEncountered() != 4 ) {
5830                 return false;
5831             }
5832             if ( proteins.size() != 4 ) {
5833                 return false;
5834             }
5835             if ( parser2.getDomainsEncountered() != 69 ) {
5836                 return false;
5837             }
5838             if ( parser2.getDomainsIgnoredDueToDuf() != 0 ) {
5839                 return false;
5840             }
5841             if ( parser2.getDomainsIgnoredDueToFsEval() != 0 ) {
5842                 return false;
5843             }
5844             if ( parser2.getDomainsIgnoredDueToIEval() != 0 ) {
5845                 return false;
5846             }
5847             final Protein p1 = proteins.get( 0 );
5848             if ( p1.getNumberOfProteinDomains() != 15 ) {
5849                 return false;
5850             }
5851             if ( p1.getLength() != 850 ) {
5852                 return false;
5853             }
5854             final Protein p2 = proteins.get( 1 );
5855             if ( p2.getNumberOfProteinDomains() != 51 ) {
5856                 return false;
5857             }
5858             if ( p2.getLength() != 1291 ) {
5859                 return false;
5860             }
5861             final Protein p3 = proteins.get( 2 );
5862             if ( p3.getNumberOfProteinDomains() != 2 ) {
5863                 return false;
5864             }
5865             final Protein p4 = proteins.get( 3 );
5866             if ( p4.getNumberOfProteinDomains() != 1 ) {
5867                 return false;
5868             }
5869             if ( !p4.getProteinDomain( 0 ).getDomainId().toString().equals( "DNA_pol_B_new" ) ) {
5870                 return false;
5871             }
5872             if ( p4.getProteinDomain( 0 ).getFrom() != 51 ) {
5873                 return false;
5874             }
5875             if ( p4.getProteinDomain( 0 ).getTo() != 395 ) {
5876                 return false;
5877             }
5878             if ( !Test.isEqual( p4.getProteinDomain( 0 ).getPerDomainEvalue(), 1.2e-39 ) ) {
5879                 return false;
5880             }
5881             if ( !Test.isEqual( p4.getProteinDomain( 0 ).getPerDomainScore(), 135.7 ) ) {
5882                 return false;
5883             }
5884             if ( !Test.isEqual( p4.getProteinDomain( 0 ).getNumber(), 1 ) ) {
5885                 return false;
5886             }
5887             if ( !Test.isEqual( p4.getProteinDomain( 0 ).getTotalCount(), 1 ) ) {
5888                 return false;
5889             }
5890         }
5891         catch ( final Exception e ) {
5892             e.printStackTrace( System.out );
5893             return false;
5894         }
5895         return true;
5896     }
5897
5898     private static boolean testLastExternalNodeMethods() {
5899         try {
5900             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
5901             final char[] a0 = { '(', '(', 'A', ',', 'B', ')', ',', '(', 'C', ',', 'D', ')', ')', };
5902             final Phylogeny t0 = factory.create( a0, new NHXParser() )[ 0 ];
5903             final PhylogenyNode n1 = t0.getNode( "A" );
5904             if ( n1.isLastExternalNode() ) {
5905                 return false;
5906             }
5907             final PhylogenyNode n2 = t0.getNode( "B" );
5908             if ( n2.isLastExternalNode() ) {
5909                 return false;
5910             }
5911             final PhylogenyNode n3 = t0.getNode( "C" );
5912             if ( n3.isLastExternalNode() ) {
5913                 return false;
5914             }
5915             final PhylogenyNode n4 = t0.getNode( "D" );
5916             if ( !n4.isLastExternalNode() ) {
5917                 return false;
5918             }
5919         }
5920         catch ( final Exception e ) {
5921             e.printStackTrace( System.out );
5922             return false;
5923         }
5924         return true;
5925     }
5926
5927     private static boolean testLevelOrderIterator() {
5928         try {
5929             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
5930             final Phylogeny t0 = factory.create( "((A,B)ab,(C,D)cd)r", new NHXParser() )[ 0 ];
5931             PhylogenyNodeIterator it0;
5932             for( it0 = t0.iteratorLevelOrder(); it0.hasNext(); ) {
5933                 it0.next();
5934             }
5935             for( it0.reset(); it0.hasNext(); ) {
5936                 it0.next();
5937             }
5938             final PhylogenyNodeIterator it = t0.iteratorLevelOrder();
5939             if ( !it.next().getName().equals( "r" ) ) {
5940                 return false;
5941             }
5942             if ( !it.next().getName().equals( "ab" ) ) {
5943                 return false;
5944             }
5945             if ( !it.next().getName().equals( "cd" ) ) {
5946                 return false;
5947             }
5948             if ( !it.next().getName().equals( "A" ) ) {
5949                 return false;
5950             }
5951             if ( !it.next().getName().equals( "B" ) ) {
5952                 return false;
5953             }
5954             if ( !it.next().getName().equals( "C" ) ) {
5955                 return false;
5956             }
5957             if ( !it.next().getName().equals( "D" ) ) {
5958                 return false;
5959             }
5960             if ( it.hasNext() ) {
5961                 return false;
5962             }
5963             final Phylogeny t2 = factory.create( "(((1,2,(a,(X,Y,Z)b)3,4,5,6)A,B,C)abc,(D,E,(f1,(f21)f2,f3)F,G)defg)r",
5964                                                  new NHXParser() )[ 0 ];
5965             PhylogenyNodeIterator it2;
5966             for( it2 = t2.iteratorLevelOrder(); it2.hasNext(); ) {
5967                 it2.next();
5968             }
5969             for( it2.reset(); it2.hasNext(); ) {
5970                 it2.next();
5971             }
5972             final PhylogenyNodeIterator it3 = t2.iteratorLevelOrder();
5973             if ( !it3.next().getName().equals( "r" ) ) {
5974                 return false;
5975             }
5976             if ( !it3.next().getName().equals( "abc" ) ) {
5977                 return false;
5978             }
5979             if ( !it3.next().getName().equals( "defg" ) ) {
5980                 return false;
5981             }
5982             if ( !it3.next().getName().equals( "A" ) ) {
5983                 return false;
5984             }
5985             if ( !it3.next().getName().equals( "B" ) ) {
5986                 return false;
5987             }
5988             if ( !it3.next().getName().equals( "C" ) ) {
5989                 return false;
5990             }
5991             if ( !it3.next().getName().equals( "D" ) ) {
5992                 return false;
5993             }
5994             if ( !it3.next().getName().equals( "E" ) ) {
5995                 return false;
5996             }
5997             if ( !it3.next().getName().equals( "F" ) ) {
5998                 return false;
5999             }
6000             if ( !it3.next().getName().equals( "G" ) ) {
6001                 return false;
6002             }
6003             if ( !it3.next().getName().equals( "1" ) ) {
6004                 return false;
6005             }
6006             if ( !it3.next().getName().equals( "2" ) ) {
6007                 return false;
6008             }
6009             if ( !it3.next().getName().equals( "3" ) ) {
6010                 return false;
6011             }
6012             if ( !it3.next().getName().equals( "4" ) ) {
6013                 return false;
6014             }
6015             if ( !it3.next().getName().equals( "5" ) ) {
6016                 return false;
6017             }
6018             if ( !it3.next().getName().equals( "6" ) ) {
6019                 return false;
6020             }
6021             if ( !it3.next().getName().equals( "f1" ) ) {
6022                 return false;
6023             }
6024             if ( !it3.next().getName().equals( "f2" ) ) {
6025                 return false;
6026             }
6027             if ( !it3.next().getName().equals( "f3" ) ) {
6028                 return false;
6029             }
6030             if ( !it3.next().getName().equals( "a" ) ) {
6031                 return false;
6032             }
6033             if ( !it3.next().getName().equals( "b" ) ) {
6034                 return false;
6035             }
6036             if ( !it3.next().getName().equals( "f21" ) ) {
6037                 return false;
6038             }
6039             if ( !it3.next().getName().equals( "X" ) ) {
6040                 return false;
6041             }
6042             if ( !it3.next().getName().equals( "Y" ) ) {
6043                 return false;
6044             }
6045             if ( !it3.next().getName().equals( "Z" ) ) {
6046                 return false;
6047             }
6048             if ( it3.hasNext() ) {
6049                 return false;
6050             }
6051             final Phylogeny t4 = factory.create( "((((D)C)B)A)r", new NHXParser() )[ 0 ];
6052             PhylogenyNodeIterator it4;
6053             for( it4 = t4.iteratorLevelOrder(); it4.hasNext(); ) {
6054                 it4.next();
6055             }
6056             for( it4.reset(); it4.hasNext(); ) {
6057                 it4.next();
6058             }
6059             final PhylogenyNodeIterator it5 = t4.iteratorLevelOrder();
6060             if ( !it5.next().getName().equals( "r" ) ) {
6061                 return false;
6062             }
6063             if ( !it5.next().getName().equals( "A" ) ) {
6064                 return false;
6065             }
6066             if ( !it5.next().getName().equals( "B" ) ) {
6067                 return false;
6068             }
6069             if ( !it5.next().getName().equals( "C" ) ) {
6070                 return false;
6071             }
6072             if ( !it5.next().getName().equals( "D" ) ) {
6073                 return false;
6074             }
6075             final Phylogeny t5 = factory.create( "A", new NHXParser() )[ 0 ];
6076             PhylogenyNodeIterator it6;
6077             for( it6 = t5.iteratorLevelOrder(); it6.hasNext(); ) {
6078                 it6.next();
6079             }
6080             for( it6.reset(); it6.hasNext(); ) {
6081                 it6.next();
6082             }
6083             final PhylogenyNodeIterator it7 = t5.iteratorLevelOrder();
6084             if ( !it7.next().getName().equals( "A" ) ) {
6085                 return false;
6086             }
6087             if ( it.hasNext() ) {
6088                 return false;
6089             }
6090         }
6091         catch ( final Exception e ) {
6092             e.printStackTrace( System.out );
6093             return false;
6094         }
6095         return true;
6096     }
6097
6098     private static boolean testMafft( final String path ) {
6099         try {
6100             final List<String> opts = new ArrayList<String>();
6101             opts.add( "--maxiterate" );
6102             opts.add( "1000" );
6103             opts.add( "--localpair" );
6104             opts.add( "--quiet" );
6105             Msa msa = null;
6106             final MsaInferrer mafft = Mafft.createInstance( path );
6107             msa = mafft.infer( new File( PATH_TO_TEST_DATA + "ncbi_sn.fasta" ), opts );
6108             if ( ( msa == null ) || ( msa.getLength() < 20 ) || ( msa.getNumberOfSequences() != 19 ) ) {
6109                 return false;
6110             }
6111             if ( !msa.getIdentifier( 0 ).toString().equals( "a" ) ) {
6112                 return false;
6113             }
6114         }
6115         catch ( final Exception e ) {
6116             e.printStackTrace( System.out );
6117             return false;
6118         }
6119         return true;
6120     }
6121
6122     private static boolean testMidpointrooting() {
6123         try {
6124             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
6125             final Phylogeny t0 = factory.create( "(A:1,B:4,C:2,D:2,E:6,F:1,G:1,H:1)", new NHXParser() )[ 0 ];
6126             PhylogenyMethods.midpointRoot( t0 );
6127             if ( !isEqual( t0.getNode( "E" ).getDistanceToParent(), 5 ) ) {
6128                 return false;
6129             }
6130             if ( !isEqual( t0.getNode( "B" ).getDistanceToParent(), 4 ) ) {
6131                 return false;
6132             }
6133             if ( !isEqual( PhylogenyMethods.calculateLCA( t0.getNode( "F" ), t0.getNode( "G" ) ).getDistanceToParent(),
6134                            1 ) ) {
6135                 return false;
6136             }
6137             final Phylogeny t1 = factory.create( "((A:1,B:2)AB:1[&&NHX:B=55],(C:3,D:4)CD:3[&&NHX:B=10])ABCD:0.5",
6138                                                  new NHXParser() )[ 0 ];
6139             if ( !t1.isRooted() ) {
6140                 return false;
6141             }
6142             PhylogenyMethods.midpointRoot( t1 );
6143             if ( !isEqual( t1.getNode( "A" ).getDistanceToParent(), 1 ) ) {
6144                 return false;
6145             }
6146             if ( !isEqual( t1.getNode( "B" ).getDistanceToParent(), 2 ) ) {
6147                 return false;
6148             }
6149             if ( !isEqual( t1.getNode( "C" ).getDistanceToParent(), 3 ) ) {
6150                 return false;
6151             }
6152             if ( !isEqual( t1.getNode( "D" ).getDistanceToParent(), 4 ) ) {
6153                 return false;
6154             }
6155             if ( !isEqual( t1.getNode( "CD" ).getDistanceToParent(), 1 ) ) {
6156                 return false;
6157             }
6158             if ( !isEqual( t1.getNode( "AB" ).getDistanceToParent(), 3 ) ) {
6159                 return false;
6160             }
6161             t1.reRoot( t1.getNode( "A" ) );
6162             PhylogenyMethods.midpointRoot( t1 );
6163             if ( !isEqual( t1.getNode( "A" ).getDistanceToParent(), 1 ) ) {
6164                 return false;
6165             }
6166             if ( !isEqual( t1.getNode( "B" ).getDistanceToParent(), 2 ) ) {
6167                 return false;
6168             }
6169             if ( !isEqual( t1.getNode( "C" ).getDistanceToParent(), 3 ) ) {
6170                 return false;
6171             }
6172             if ( !isEqual( t1.getNode( "D" ).getDistanceToParent(), 4 ) ) {
6173                 return false;
6174             }
6175             if ( !isEqual( t1.getNode( "CD" ).getDistanceToParent(), 1 ) ) {
6176                 System.exit( -1 );
6177                 return false;
6178             }
6179             if ( !isEqual( t1.getNode( "AB" ).getDistanceToParent(), 3 ) ) {
6180                 return false;
6181             }
6182         }
6183         catch ( final Exception e ) {
6184             e.printStackTrace( System.out );
6185             return false;
6186         }
6187         return true;
6188     }
6189
6190     private static boolean testMsaQualityMethod() {
6191         try {
6192             final MolecularSequence s0 = BasicSequence.createAaSequence( "a", "ABAXEFGHIJJE-" );
6193             final MolecularSequence s1 = BasicSequence.createAaSequence( "b", "ABBXEFGHIJJBB" );
6194             final MolecularSequence s2 = BasicSequence.createAaSequence( "c", "AXCXEFGHIJJ--" );
6195             final MolecularSequence s3 = BasicSequence.createAaSequence( "d", "AXDDEFGHIJ---" );
6196             final List<MolecularSequence> l = new ArrayList<MolecularSequence>();
6197             l.add( s0 );
6198             l.add( s1 );
6199             l.add( s2 );
6200             l.add( s3 );
6201             final Msa msa = BasicMsa.createInstance( l );
6202             if ( !isEqual( 1, MsaMethods.calculateIdentityRatio( msa, 0 ) ) ) {
6203                 return false;
6204             }
6205             if ( !isEqual( 0.5, MsaMethods.calculateIdentityRatio( msa, 1 ) ) ) {
6206                 return false;
6207             }
6208             if ( !isEqual( 0.25, MsaMethods.calculateIdentityRatio( msa, 2 ) ) ) {
6209                 return false;
6210             }
6211             if ( !isEqual( 0.75, MsaMethods.calculateIdentityRatio( msa, 3 ) ) ) {
6212                 return false;
6213             }
6214             if ( !isEqual( 0.75, MsaMethods.calculateIdentityRatio( msa, 10 ) ) ) {
6215                 return false;
6216             }
6217             if ( !isEqual( 0.25, MsaMethods.calculateIdentityRatio( msa, 11 ) ) ) {
6218                 return false;
6219             }
6220             if ( !isEqual( 0.25, MsaMethods.calculateIdentityRatio( msa, 12 ) ) ) {
6221                 return false;
6222             }
6223         }
6224         catch ( final Exception e ) {
6225             e.printStackTrace( System.out );
6226             return false;
6227         }
6228         return true;
6229     }
6230
6231     private static boolean testMsaEntropy() {
6232         try {
6233             final MolecularSequence s0 = BasicSequence.createAaSequence( "a", "AAAAAAA" );
6234             final MolecularSequence s1 = BasicSequence.createAaSequence( "b", "AAAIACC" );
6235             final MolecularSequence s2 = BasicSequence.createAaSequence( "c", "AAIIIIF" );
6236             final MolecularSequence s3 = BasicSequence.createAaSequence( "d", "AIIIVVW" );
6237             final List<MolecularSequence> l = new ArrayList<MolecularSequence>();
6238             l.add( s0 );
6239             l.add( s1 );
6240             l.add( s2 );
6241             l.add( s3 );
6242             final Msa msa = BasicMsa.createInstance( l );
6243             //TODO need to DO the tests!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!
6244             //FIXME
6245             //            System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa, 0 ) );
6246             //            System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa, 1 ) );
6247             //            System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa, 2 ) );
6248             //            System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa, 3 ) );
6249             //            System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa, 4 ) );
6250             //            System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa, 5 ) );
6251             //            System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa, 6 ) );
6252             //            System.out.println();
6253             //            System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 6, msa, 0 ) );
6254             //            System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 6, msa, 1 ) );
6255             //            System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 6, msa, 2 ) );
6256             //            System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 6, msa, 3 ) );
6257             //            System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 6, msa, 4 ) );
6258             //            System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 6, msa, 5 ) );
6259             //            System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 6, msa, 6 ) );
6260             final List<MolecularSequence> l2 = new ArrayList<MolecularSequence>();
6261             l2.add( BasicSequence.createAaSequence( "1", "AAAAAAA" ) );
6262             l2.add( BasicSequence.createAaSequence( "2", "AAAIACC" ) );
6263             l2.add( BasicSequence.createAaSequence( "3", "AAIIIIF" ) );
6264             l2.add( BasicSequence.createAaSequence( "4", "AIIIVVW" ) );
6265             l2.add( BasicSequence.createAaSequence( "5", "AAAAAAA" ) );
6266             l2.add( BasicSequence.createAaSequence( "6", "AAAIACC" ) );
6267             l2.add( BasicSequence.createAaSequence( "7", "AAIIIIF" ) );
6268             l2.add( BasicSequence.createAaSequence( "8", "AIIIVVW" ) );
6269             l2.add( BasicSequence.createAaSequence( "9", "AAAAAAA" ) );
6270             l2.add( BasicSequence.createAaSequence( "10", "AAAIACC" ) );
6271             l2.add( BasicSequence.createAaSequence( "11", "AAIIIIF" ) );
6272             l2.add( BasicSequence.createAaSequence( "12", "AIIIVVW" ) );
6273             l2.add( BasicSequence.createAaSequence( "13", "AAIIIIF" ) );
6274             l2.add( BasicSequence.createAaSequence( "14", "AIIIVVW" ) );
6275             l2.add( BasicSequence.createAaSequence( "15", "AAAAAAA" ) );
6276             l2.add( BasicSequence.createAaSequence( "16", "AAAIACC" ) );
6277             l2.add( BasicSequence.createAaSequence( "17", "AAIIIIF" ) );
6278             l2.add( BasicSequence.createAaSequence( "18", "AIIIVVW" ) );
6279             l2.add( BasicSequence.createAaSequence( "19", "AAAAAAA" ) );
6280             l2.add( BasicSequence.createAaSequence( "20", "AAAIACC" ) );
6281             l2.add( BasicSequence.createAaSequence( "21", "AAIIIIF" ) );
6282             l2.add( BasicSequence.createAaSequence( "22", "AIIIVVW" ) );
6283             final Msa msa2 = BasicMsa.createInstance( l2 );
6284             //            System.out.println();
6285             //            System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa2, 0 ) );
6286             //            System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa2, 1 ) );
6287             //            System.out.println( MsaMethods.calcNormalizedShannonsEntropy( 20, msa2, 2 ) );
6288         }
6289         catch ( final Exception e ) {
6290             e.printStackTrace( System.out );
6291             return false;
6292         }
6293         return true;
6294     }
6295
6296     private static boolean testDeleteableMsa() {
6297         try {
6298             final MolecularSequence s0 = BasicSequence.createAaSequence( "a", "AAAA" );
6299             final MolecularSequence s1 = BasicSequence.createAaSequence( "b", "BAAA" );
6300             final MolecularSequence s2 = BasicSequence.createAaSequence( "c", "CAAA" );
6301             final MolecularSequence s3 = BasicSequence.createAaSequence( "d", "DAAA" );
6302             final MolecularSequence s4 = BasicSequence.createAaSequence( "e", "EAAA" );
6303             final MolecularSequence s5 = BasicSequence.createAaSequence( "f", "FAAA" );
6304             final List<MolecularSequence> l0 = new ArrayList<MolecularSequence>();
6305             l0.add( s0 );
6306             l0.add( s1 );
6307             l0.add( s2 );
6308             l0.add( s3 );
6309             l0.add( s4 );
6310             l0.add( s5 );
6311             final DeleteableMsa dmsa0 = DeleteableMsa.createInstance( l0 );
6312             dmsa0.deleteRow( "b", false );
6313             if ( !dmsa0.getIdentifier( 1 ).equals( "c" ) ) {
6314                 return false;
6315             }
6316             dmsa0.deleteRow( "e", false );
6317             dmsa0.deleteRow( "a", false );
6318             dmsa0.deleteRow( "f", false );
6319             if ( dmsa0.getLength() != 4 ) {
6320                 return false;
6321             }
6322             if ( dmsa0.getNumberOfSequences() != 2 ) {
6323                 return false;
6324             }
6325             if ( !dmsa0.getIdentifier( 0 ).equals( "c" ) ) {
6326                 return false;
6327             }
6328             if ( !dmsa0.getIdentifier( 1 ).equals( "d" ) ) {
6329                 return false;
6330             }
6331             if ( dmsa0.getResidueAt( 0, 0 ) != 'C' ) {
6332                 return false;
6333             }
6334             if ( !dmsa0.getSequenceAsString( 0 ).toString().equals( "CAAA" ) ) {
6335                 return false;
6336             }
6337             if ( dmsa0.getColumnAt( 0 ).size() != 2 ) {
6338                 return false;
6339             }
6340             dmsa0.deleteRow( "c", false );
6341             dmsa0.deleteRow( "d", false );
6342             if ( dmsa0.getNumberOfSequences() != 0 ) {
6343                 return false;
6344             }
6345             //
6346             final MolecularSequence s_0 = BasicSequence.createAaSequence( "a", "--A---B-C--X----" );
6347             final MolecularSequence s_1 = BasicSequence.createAaSequence( "b", "--B-----C-------" );
6348             final MolecularSequence s_2 = BasicSequence.createAaSequence( "c", "--C--AB-C------Z" );
6349             final MolecularSequence s_3 = BasicSequence.createAaSequence( "d", "--D--AA-C-------" );
6350             final MolecularSequence s_4 = BasicSequence.createAaSequence( "e", "--E--AA-C-------" );
6351             final MolecularSequence s_5 = BasicSequence.createAaSequence( "f", "--F--AB-CD--Y---" );
6352             final List<MolecularSequence> l1 = new ArrayList<MolecularSequence>();
6353             l1.add( s_0 );
6354             l1.add( s_1 );
6355             l1.add( s_2 );
6356             l1.add( s_3 );
6357             l1.add( s_4 );
6358             l1.add( s_5 );
6359             final DeleteableMsa dmsa1 = DeleteableMsa.createInstance( l1 );
6360             dmsa1.deleteGapOnlyColumns();
6361             dmsa1.deleteRow( "a", false );
6362             dmsa1.deleteRow( "f", false );
6363             dmsa1.deleteRow( "d", false );
6364             dmsa1.deleteGapOnlyColumns();
6365             if ( !dmsa1.getSequenceAsString( 0 ).toString().equals( "B--C-" ) ) {
6366                 return false;
6367             }
6368             if ( !dmsa1.getSequenceAsString( 1 ).toString().equals( "CABCZ" ) ) {
6369                 return false;
6370             }
6371             if ( !dmsa1.getSequenceAsString( 2 ).toString().equals( "EAAC-" ) ) {
6372                 return false;
6373             }
6374             dmsa1.deleteRow( "c", false );
6375             dmsa1.deleteGapOnlyColumns();
6376             final Writer w0 = new StringWriter();
6377             dmsa1.write( w0, MSA_FORMAT.FASTA );
6378             final Writer w1 = new StringWriter();
6379             dmsa1.write( w1, MSA_FORMAT.PHYLIP );
6380             if ( !dmsa1.getSequenceAsString( 0 ).toString().equals( "B--C" ) ) {
6381                 return false;
6382             }
6383             if ( !dmsa1.getSequenceAsString( 1 ).toString().equals( "EAAC" ) ) {
6384                 return false;
6385             }
6386             final MolecularSequence s__0 = BasicSequence.createAaSequence( "a", "A------" );
6387             final MolecularSequence s__1 = BasicSequence.createAaSequence( "b", "BB-----" );
6388             final MolecularSequence s__2 = BasicSequence.createAaSequence( "c", "CCC----" );
6389             final MolecularSequence s__3 = BasicSequence.createAaSequence( "d", "DDDD---" );
6390             final MolecularSequence s__4 = BasicSequence.createAaSequence( "e", "EEEEE--" );
6391             final MolecularSequence s__5 = BasicSequence.createAaSequence( "f", "FFFFFF-" );
6392             final List<MolecularSequence> l2 = new ArrayList<MolecularSequence>();
6393             l2.add( s__0 );
6394             l2.add( s__1 );
6395             l2.add( s__2 );
6396             l2.add( s__3 );
6397             l2.add( s__4 );
6398             l2.add( s__5 );
6399             final DeleteableMsa dmsa2 = DeleteableMsa.createInstance( l2 );
6400             dmsa2.deleteGapColumns( 0.5 );
6401             if ( !dmsa2.getSequenceAsString( 0 ).toString().equals( "A---" ) ) {
6402                 return false;
6403             }
6404             if ( !dmsa2.getSequenceAsString( 1 ).toString().equals( "BB--" ) ) {
6405                 return false;
6406             }
6407             if ( !dmsa2.getSequenceAsString( 2 ).toString().equals( "CCC-" ) ) {
6408                 return false;
6409             }
6410             dmsa2.deleteGapColumns( 0.2 );
6411             if ( !dmsa2.getSequenceAsString( 0 ).toString().equals( "A-" ) ) {
6412                 return false;
6413             }
6414             if ( !dmsa2.getSequenceAsString( 1 ).toString().equals( "BB" ) ) {
6415                 return false;
6416             }
6417             if ( !dmsa2.getSequenceAsString( 2 ).toString().equals( "CC" ) ) {
6418                 return false;
6419             }
6420             dmsa2.deleteGapColumns( 0 );
6421             dmsa2.deleteRow( "a", false );
6422             dmsa2.deleteRow( "b", false );
6423             dmsa2.deleteRow( "f", false );
6424             dmsa2.deleteRow( "e", false );
6425             dmsa2.setIdentifier( 0, "new_c" );
6426             dmsa2.setIdentifier( 1, "new_d" );
6427             dmsa2.setResidueAt( 0, 0, 'x' );
6428             final MolecularSequence s = dmsa2.deleteRow( "new_d", true );
6429             if ( !s.getMolecularSequenceAsString().equals( "D" ) ) {
6430                 return false;
6431             }
6432             final Writer w = new StringWriter();
6433             dmsa2.write( w, MSA_FORMAT.PHYLIP );
6434             final String phylip = w.toString();
6435             if ( !phylip.equals( "1 1" + ForesterUtil.LINE_SEPARATOR + "new_c x" + ForesterUtil.LINE_SEPARATOR ) ) {
6436                 System.out.println( phylip );
6437                 return false;
6438             }
6439             final Writer w2 = new StringWriter();
6440             dmsa2.write( w2, MSA_FORMAT.FASTA );
6441             final String fasta = w2.toString();
6442             if ( !fasta.equals( ">new_c" + ForesterUtil.LINE_SEPARATOR + "x" + ForesterUtil.LINE_SEPARATOR ) ) {
6443                 System.out.println( fasta );
6444                 return false;
6445             }
6446         }
6447         catch ( final Exception e ) {
6448             e.printStackTrace( System.out );
6449             return false;
6450         }
6451         return true;
6452     }
6453
6454     private static boolean testNextNodeWithCollapsing() {
6455         try {
6456             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
6457             PhylogenyNode n;
6458             List<PhylogenyNode> ext = new ArrayList<PhylogenyNode>();
6459             final StringBuffer sb0 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h))fgh)cdefgh)abcdefgh" );
6460             final Phylogeny t0 = factory.create( sb0, new NHXParser() )[ 0 ];
6461             t0.getNode( "cd" ).setCollapse( true );
6462             t0.getNode( "cde" ).setCollapse( true );
6463             n = t0.getFirstExternalNode();
6464             while ( n != null ) {
6465                 ext.add( n );
6466                 n = n.getNextExternalNodeWhileTakingIntoAccountCollapsedNodes();
6467             }
6468             if ( !ext.get( 0 ).getName().equals( "a" ) ) {
6469                 return false;
6470             }
6471             if ( !ext.get( 1 ).getName().equals( "b" ) ) {
6472                 return false;
6473             }
6474             if ( !ext.get( 2 ).getName().equals( "cde" ) ) {
6475                 return false;
6476             }
6477             if ( !ext.get( 3 ).getName().equals( "f" ) ) {
6478                 return false;
6479             }
6480             if ( !ext.get( 4 ).getName().equals( "g" ) ) {
6481                 return false;
6482             }
6483             if ( !ext.get( 5 ).getName().equals( "h" ) ) {
6484                 return false;
6485             }
6486             ext.clear();
6487             final StringBuffer sb1 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h))fgh)cdefgh)abcdefgh" );
6488             final Phylogeny t1 = factory.create( sb1, new NHXParser() )[ 0 ];
6489             t1.getNode( "ab" ).setCollapse( true );
6490             t1.getNode( "cd" ).setCollapse( true );
6491             t1.getNode( "cde" ).setCollapse( true );
6492             n = t1.getNode( "ab" );
6493             ext = new ArrayList<PhylogenyNode>();
6494             while ( n != null ) {
6495                 ext.add( n );
6496                 n = n.getNextExternalNodeWhileTakingIntoAccountCollapsedNodes();
6497             }
6498             if ( !ext.get( 0 ).getName().equals( "ab" ) ) {
6499                 return false;
6500             }
6501             if ( !ext.get( 1 ).getName().equals( "cde" ) ) {
6502                 return false;
6503             }
6504             if ( !ext.get( 2 ).getName().equals( "f" ) ) {
6505                 return false;
6506             }
6507             if ( !ext.get( 3 ).getName().equals( "g" ) ) {
6508                 return false;
6509             }
6510             if ( !ext.get( 4 ).getName().equals( "h" ) ) {
6511                 return false;
6512             }
6513             ext.clear();
6514             final StringBuffer sb2 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h)gh)fgh)cdefgh)abcdefgh" );
6515             final Phylogeny t2 = factory.create( sb2, new NHXParser() )[ 0 ];
6516             t2.getNode( "ab" ).setCollapse( true );
6517             t2.getNode( "cd" ).setCollapse( true );
6518             t2.getNode( "cde" ).setCollapse( true );
6519             t2.getNode( "c" ).setCollapse( true );
6520             t2.getNode( "d" ).setCollapse( true );
6521             t2.getNode( "e" ).setCollapse( true );
6522             t2.getNode( "gh" ).setCollapse( true );
6523             n = t2.getNode( "ab" );
6524             ext = new ArrayList<PhylogenyNode>();
6525             while ( n != null ) {
6526                 ext.add( n );
6527                 n = n.getNextExternalNodeWhileTakingIntoAccountCollapsedNodes();
6528             }
6529             if ( !ext.get( 0 ).getName().equals( "ab" ) ) {
6530                 return false;
6531             }
6532             if ( !ext.get( 1 ).getName().equals( "cde" ) ) {
6533                 return false;
6534             }
6535             if ( !ext.get( 2 ).getName().equals( "f" ) ) {
6536                 return false;
6537             }
6538             if ( !ext.get( 3 ).getName().equals( "gh" ) ) {
6539                 return false;
6540             }
6541             ext.clear();
6542             final StringBuffer sb3 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h)gh)fgh)cdefgh)abcdefgh" );
6543             final Phylogeny t3 = factory.create( sb3, new NHXParser() )[ 0 ];
6544             t3.getNode( "ab" ).setCollapse( true );
6545             t3.getNode( "cd" ).setCollapse( true );
6546             t3.getNode( "cde" ).setCollapse( true );
6547             t3.getNode( "c" ).setCollapse( true );
6548             t3.getNode( "d" ).setCollapse( true );
6549             t3.getNode( "e" ).setCollapse( true );
6550             t3.getNode( "gh" ).setCollapse( true );
6551             t3.getNode( "fgh" ).setCollapse( true );
6552             n = t3.getNode( "ab" );
6553             ext = new ArrayList<PhylogenyNode>();
6554             while ( n != null ) {
6555                 ext.add( n );
6556                 n = n.getNextExternalNodeWhileTakingIntoAccountCollapsedNodes();
6557             }
6558             if ( !ext.get( 0 ).getName().equals( "ab" ) ) {
6559                 return false;
6560             }
6561             if ( !ext.get( 1 ).getName().equals( "cde" ) ) {
6562                 return false;
6563             }
6564             if ( !ext.get( 2 ).getName().equals( "fgh" ) ) {
6565                 return false;
6566             }
6567             ext.clear();
6568             final StringBuffer sb4 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h)gh)fgh)cdefgh)abcdefgh" );
6569             final Phylogeny t4 = factory.create( sb4, new NHXParser() )[ 0 ];
6570             t4.getNode( "ab" ).setCollapse( true );
6571             t4.getNode( "cd" ).setCollapse( true );
6572             t4.getNode( "cde" ).setCollapse( true );
6573             t4.getNode( "c" ).setCollapse( true );
6574             t4.getNode( "d" ).setCollapse( true );
6575             t4.getNode( "e" ).setCollapse( true );
6576             t4.getNode( "gh" ).setCollapse( true );
6577             t4.getNode( "fgh" ).setCollapse( true );
6578             t4.getNode( "abcdefgh" ).setCollapse( true );
6579             n = t4.getNode( "abcdefgh" );
6580             if ( n.getNextExternalNodeWhileTakingIntoAccountCollapsedNodes() != null ) {
6581                 return false;
6582             }
6583             final StringBuffer sb5 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h))fgh)cdefgh)abcdefgh" );
6584             final Phylogeny t5 = factory.create( sb5, new NHXParser() )[ 0 ];
6585             ext.clear();
6586             n = t5.getFirstExternalNode();
6587             while ( n != null ) {
6588                 ext.add( n );
6589                 n = n.getNextExternalNodeWhileTakingIntoAccountCollapsedNodes();
6590             }
6591             if ( ext.size() != 8 ) {
6592                 return false;
6593             }
6594             if ( !ext.get( 0 ).getName().equals( "a" ) ) {
6595                 return false;
6596             }
6597             if ( !ext.get( 1 ).getName().equals( "b" ) ) {
6598                 return false;
6599             }
6600             if ( !ext.get( 2 ).getName().equals( "c" ) ) {
6601                 return false;
6602             }
6603             if ( !ext.get( 3 ).getName().equals( "d" ) ) {
6604                 return false;
6605             }
6606             if ( !ext.get( 4 ).getName().equals( "e" ) ) {
6607                 return false;
6608             }
6609             if ( !ext.get( 5 ).getName().equals( "f" ) ) {
6610                 return false;
6611             }
6612             if ( !ext.get( 6 ).getName().equals( "g" ) ) {
6613                 return false;
6614             }
6615             if ( !ext.get( 7 ).getName().equals( "h" ) ) {
6616                 return false;
6617             }
6618             final StringBuffer sb6 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h))fgh)cdefgh)abcdefgh" );
6619             final Phylogeny t6 = factory.create( sb6, new NHXParser() )[ 0 ];
6620             ext.clear();
6621             t6.getNode( "ab" ).setCollapse( true );
6622             n = t6.getNode( "ab" );
6623             while ( n != null ) {
6624                 ext.add( n );
6625                 n = n.getNextExternalNodeWhileTakingIntoAccountCollapsedNodes();
6626             }
6627             if ( ext.size() != 7 ) {
6628                 return false;
6629             }
6630             if ( !ext.get( 0 ).getName().equals( "ab" ) ) {
6631                 return false;
6632             }
6633             if ( !ext.get( 1 ).getName().equals( "c" ) ) {
6634                 return false;
6635             }
6636             if ( !ext.get( 2 ).getName().equals( "d" ) ) {
6637                 return false;
6638             }
6639             if ( !ext.get( 3 ).getName().equals( "e" ) ) {
6640                 return false;
6641             }
6642             if ( !ext.get( 4 ).getName().equals( "f" ) ) {
6643                 return false;
6644             }
6645             if ( !ext.get( 5 ).getName().equals( "g" ) ) {
6646                 return false;
6647             }
6648             if ( !ext.get( 6 ).getName().equals( "h" ) ) {
6649                 return false;
6650             }
6651             final StringBuffer sb7 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h))fgh)cdefgh)abcdefgh" );
6652             final Phylogeny t7 = factory.create( sb7, new NHXParser() )[ 0 ];
6653             ext.clear();
6654             t7.getNode( "cd" ).setCollapse( true );
6655             n = t7.getNode( "a" );
6656             while ( n != null ) {
6657                 ext.add( n );
6658                 n = n.getNextExternalNodeWhileTakingIntoAccountCollapsedNodes();
6659             }
6660             if ( ext.size() != 7 ) {
6661                 return false;
6662             }
6663             if ( !ext.get( 0 ).getName().equals( "a" ) ) {
6664                 return false;
6665             }
6666             if ( !ext.get( 1 ).getName().equals( "b" ) ) {
6667                 return false;
6668             }
6669             if ( !ext.get( 2 ).getName().equals( "cd" ) ) {
6670                 return false;
6671             }
6672             if ( !ext.get( 3 ).getName().equals( "e" ) ) {
6673                 return false;
6674             }
6675             if ( !ext.get( 4 ).getName().equals( "f" ) ) {
6676                 return false;
6677             }
6678             if ( !ext.get( 5 ).getName().equals( "g" ) ) {
6679                 return false;
6680             }
6681             if ( !ext.get( 6 ).getName().equals( "h" ) ) {
6682                 return false;
6683             }
6684             final StringBuffer sb8 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h))fgh)cdefgh)abcdefgh" );
6685             final Phylogeny t8 = factory.create( sb8, new NHXParser() )[ 0 ];
6686             ext.clear();
6687             t8.getNode( "cd" ).setCollapse( true );
6688             t8.getNode( "c" ).setCollapse( true );
6689             t8.getNode( "d" ).setCollapse( true );
6690             n = t8.getNode( "a" );
6691             while ( n != null ) {
6692                 ext.add( n );
6693                 n = n.getNextExternalNodeWhileTakingIntoAccountCollapsedNodes();
6694             }
6695             if ( ext.size() != 7 ) {
6696                 return false;
6697             }
6698             if ( !ext.get( 0 ).getName().equals( "a" ) ) {
6699                 return false;
6700             }
6701             if ( !ext.get( 1 ).getName().equals( "b" ) ) {
6702                 return false;
6703             }
6704             if ( !ext.get( 2 ).getName().equals( "cd" ) ) {
6705                 System.out.println( "2 fail" );
6706                 return false;
6707             }
6708             if ( !ext.get( 3 ).getName().equals( "e" ) ) {
6709                 return false;
6710             }
6711             if ( !ext.get( 4 ).getName().equals( "f" ) ) {
6712                 return false;
6713             }
6714             if ( !ext.get( 5 ).getName().equals( "g" ) ) {
6715                 return false;
6716             }
6717             if ( !ext.get( 6 ).getName().equals( "h" ) ) {
6718                 return false;
6719             }
6720             final StringBuffer sb9 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h)gh)fgh)cdefgh)abcdefgh" );
6721             final Phylogeny t9 = factory.create( sb9, new NHXParser() )[ 0 ];
6722             ext.clear();
6723             t9.getNode( "gh" ).setCollapse( true );
6724             n = t9.getNode( "a" );
6725             while ( n != null ) {
6726                 ext.add( n );
6727                 n = n.getNextExternalNodeWhileTakingIntoAccountCollapsedNodes();
6728             }
6729             if ( ext.size() != 7 ) {
6730                 return false;
6731             }
6732             if ( !ext.get( 0 ).getName().equals( "a" ) ) {
6733                 return false;
6734             }
6735             if ( !ext.get( 1 ).getName().equals( "b" ) ) {
6736                 return false;
6737             }
6738             if ( !ext.get( 2 ).getName().equals( "c" ) ) {
6739                 return false;
6740             }
6741             if ( !ext.get( 3 ).getName().equals( "d" ) ) {
6742                 return false;
6743             }
6744             if ( !ext.get( 4 ).getName().equals( "e" ) ) {
6745                 return false;
6746             }
6747             if ( !ext.get( 5 ).getName().equals( "f" ) ) {
6748                 return false;
6749             }
6750             if ( !ext.get( 6 ).getName().equals( "gh" ) ) {
6751                 return false;
6752             }
6753             final StringBuffer sb10 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h)gh)fgh)cdefgh)abcdefgh" );
6754             final Phylogeny t10 = factory.create( sb10, new NHXParser() )[ 0 ];
6755             ext.clear();
6756             t10.getNode( "gh" ).setCollapse( true );
6757             t10.getNode( "g" ).setCollapse( true );
6758             t10.getNode( "h" ).setCollapse( true );
6759             n = t10.getNode( "a" );
6760             while ( n != null ) {
6761                 ext.add( n );
6762                 n = n.getNextExternalNodeWhileTakingIntoAccountCollapsedNodes();
6763             }
6764             if ( ext.size() != 7 ) {
6765                 return false;
6766             }
6767             if ( !ext.get( 0 ).getName().equals( "a" ) ) {
6768                 return false;
6769             }
6770             if ( !ext.get( 1 ).getName().equals( "b" ) ) {
6771                 return false;
6772             }
6773             if ( !ext.get( 2 ).getName().equals( "c" ) ) {
6774                 return false;
6775             }
6776             if ( !ext.get( 3 ).getName().equals( "d" ) ) {
6777                 return false;
6778             }
6779             if ( !ext.get( 4 ).getName().equals( "e" ) ) {
6780                 return false;
6781             }
6782             if ( !ext.get( 5 ).getName().equals( "f" ) ) {
6783                 return false;
6784             }
6785             if ( !ext.get( 6 ).getName().equals( "gh" ) ) {
6786                 return false;
6787             }
6788             final StringBuffer sb11 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h)gh)fgh)cdefgh)abcdefgh" );
6789             final Phylogeny t11 = factory.create( sb11, new NHXParser() )[ 0 ];
6790             ext.clear();
6791             t11.getNode( "gh" ).setCollapse( true );
6792             t11.getNode( "fgh" ).setCollapse( true );
6793             n = t11.getNode( "a" );
6794             while ( n != null ) {
6795                 ext.add( n );
6796                 n = n.getNextExternalNodeWhileTakingIntoAccountCollapsedNodes();
6797             }
6798             if ( ext.size() != 6 ) {
6799                 return false;
6800             }
6801             if ( !ext.get( 0 ).getName().equals( "a" ) ) {
6802                 return false;
6803             }
6804             if ( !ext.get( 1 ).getName().equals( "b" ) ) {
6805                 return false;
6806             }
6807             if ( !ext.get( 2 ).getName().equals( "c" ) ) {
6808                 return false;
6809             }
6810             if ( !ext.get( 3 ).getName().equals( "d" ) ) {
6811                 return false;
6812             }
6813             if ( !ext.get( 4 ).getName().equals( "e" ) ) {
6814                 return false;
6815             }
6816             if ( !ext.get( 5 ).getName().equals( "fgh" ) ) {
6817                 return false;
6818             }
6819             final StringBuffer sb12 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h)gh)fgh)cdefgh)abcdefgh" );
6820             final Phylogeny t12 = factory.create( sb12, new NHXParser() )[ 0 ];
6821             ext.clear();
6822             t12.getNode( "gh" ).setCollapse( true );
6823             t12.getNode( "fgh" ).setCollapse( true );
6824             t12.getNode( "g" ).setCollapse( true );
6825             t12.getNode( "h" ).setCollapse( true );
6826             t12.getNode( "f" ).setCollapse( true );
6827             n = t12.getNode( "a" );
6828             while ( n != null ) {
6829                 ext.add( n );
6830                 n = n.getNextExternalNodeWhileTakingIntoAccountCollapsedNodes();
6831             }
6832             if ( ext.size() != 6 ) {
6833                 return false;
6834             }
6835             if ( !ext.get( 0 ).getName().equals( "a" ) ) {
6836                 return false;
6837             }
6838             if ( !ext.get( 1 ).getName().equals( "b" ) ) {
6839                 return false;
6840             }
6841             if ( !ext.get( 2 ).getName().equals( "c" ) ) {
6842                 return false;
6843             }
6844             if ( !ext.get( 3 ).getName().equals( "d" ) ) {
6845                 return false;
6846             }
6847             if ( !ext.get( 4 ).getName().equals( "e" ) ) {
6848                 return false;
6849             }
6850             if ( !ext.get( 5 ).getName().equals( "fgh" ) ) {
6851                 return false;
6852             }
6853             final StringBuffer sb13 = new StringBuffer( "((a,b)ab,(((c,d)cd,e)cde,(f,(g,h)gh)fgh)cdefgh)abcdefgh" );
6854             final Phylogeny t13 = factory.create( sb13, new NHXParser() )[ 0 ];
6855             ext.clear();
6856             t13.getNode( "ab" ).setCollapse( true );
6857             t13.getNode( "b" ).setCollapse( true );
6858             t13.getNode( "fgh" ).setCollapse( true );
6859             t13.getNode( "gh" ).setCollapse( true );
6860             n = t13.getNode( "ab" );
6861             while ( n != null ) {
6862                 ext.add( n );
6863                 n = n.getNextExternalNodeWhileTakingIntoAccountCollapsedNodes();
6864             }
6865             if ( ext.size() != 5 ) {
6866                 return false;
6867             }
6868             if ( !ext.get( 0 ).getName().equals( "ab" ) ) {
6869                 return false;
6870             }
6871             if ( !ext.get( 1 ).getName().equals( "c" ) ) {
6872                 return false;
6873             }
6874             if ( !ext.get( 2 ).getName().equals( "d" ) ) {
6875                 return false;
6876             }
6877             if ( !ext.get( 3 ).getName().equals( "e" ) ) {
6878                 return false;
6879             }
6880             if ( !ext.get( 4 ).getName().equals( "fgh" ) ) {
6881                 return false;
6882             }
6883             final StringBuffer sb14 = new StringBuffer( "((a,b,0)ab,(((c,d)cd,e)cde,(f,(g,h,1,2)gh,0)fgh)cdefgh)abcdefgh" );
6884             final Phylogeny t14 = factory.create( sb14, new NHXParser() )[ 0 ];
6885             ext.clear();
6886             t14.getNode( "ab" ).setCollapse( true );
6887             t14.getNode( "a" ).setCollapse( true );
6888             t14.getNode( "fgh" ).setCollapse( true );
6889             t14.getNode( "gh" ).setCollapse( true );
6890             n = t14.getNode( "ab" );
6891             while ( n != null ) {
6892                 ext.add( n );
6893                 n = n.getNextExternalNodeWhileTakingIntoAccountCollapsedNodes();
6894             }
6895             if ( ext.size() != 5 ) {
6896                 return false;
6897             }
6898             if ( !ext.get( 0 ).getName().equals( "ab" ) ) {
6899                 return false;
6900             }
6901             if ( !ext.get( 1 ).getName().equals( "c" ) ) {
6902                 return false;
6903             }
6904             if ( !ext.get( 2 ).getName().equals( "d" ) ) {
6905                 return false;
6906             }
6907             if ( !ext.get( 3 ).getName().equals( "e" ) ) {
6908                 return false;
6909             }
6910             if ( !ext.get( 4 ).getName().equals( "fgh" ) ) {
6911                 return false;
6912             }
6913             final StringBuffer sb15 = new StringBuffer( "((a,b,0)ab,(((c,d)cd,e)cde,x,(f,(g,h,1,2)gh,0)fgh)cdefgh)abcdefgh" );
6914             final Phylogeny t15 = factory.create( sb15, new NHXParser() )[ 0 ];
6915             ext.clear();
6916             t15.getNode( "ab" ).setCollapse( true );
6917             t15.getNode( "a" ).setCollapse( true );
6918             t15.getNode( "fgh" ).setCollapse( true );
6919             t15.getNode( "gh" ).setCollapse( true );
6920             n = t15.getNode( "ab" );
6921             while ( n != null ) {
6922                 ext.add( n );
6923                 n = n.getNextExternalNodeWhileTakingIntoAccountCollapsedNodes();
6924             }
6925             if ( ext.size() != 6 ) {
6926                 return false;
6927             }
6928             if ( !ext.get( 0 ).getName().equals( "ab" ) ) {
6929                 return false;
6930             }
6931             if ( !ext.get( 1 ).getName().equals( "c" ) ) {
6932                 return false;
6933             }
6934             if ( !ext.get( 2 ).getName().equals( "d" ) ) {
6935                 return false;
6936             }
6937             if ( !ext.get( 3 ).getName().equals( "e" ) ) {
6938                 return false;
6939             }
6940             if ( !ext.get( 4 ).getName().equals( "x" ) ) {
6941                 return false;
6942             }
6943             if ( !ext.get( 5 ).getName().equals( "fgh" ) ) {
6944                 return false;
6945             }
6946             //
6947             //
6948             final StringBuffer sb16 = new StringBuffer( "((a,b,0)ab,(((c,d)cd,e)cde,x,(f,(g,h,1,2)gh,0)fgh)cdefgh)abcdefgh" );
6949             final Phylogeny t16 = factory.create( sb16, new NHXParser() )[ 0 ];
6950             ext.clear();
6951             t16.getNode( "ab" ).setCollapse( true );
6952             t16.getNode( "a" ).setCollapse( true );
6953             t16.getNode( "fgh" ).setCollapse( true );
6954             t16.getNode( "gh" ).setCollapse( true );
6955             t16.getNode( "cd" ).setCollapse( true );
6956             t16.getNode( "cde" ).setCollapse( true );
6957             t16.getNode( "d" ).setCollapse( true );
6958             t16.getNode( "x" ).setCollapse( true );
6959             n = t16.getNode( "ab" );
6960             while ( n != null ) {
6961                 ext.add( n );
6962                 n = n.getNextExternalNodeWhileTakingIntoAccountCollapsedNodes();
6963             }
6964             if ( ext.size() != 4 ) {
6965                 return false;
6966             }
6967             if ( !ext.get( 0 ).getName().equals( "ab" ) ) {
6968                 return false;
6969             }
6970             if ( !ext.get( 1 ).getName().equals( "cde" ) ) {
6971                 return false;
6972             }
6973             if ( !ext.get( 2 ).getName().equals( "x" ) ) {
6974                 return false;
6975             }
6976             if ( !ext.get( 3 ).getName().equals( "fgh" ) ) {
6977                 return false;
6978             }
6979         }
6980         catch ( final Exception e ) {
6981             e.printStackTrace( System.out );
6982             return false;
6983         }
6984         return true;
6985     }
6986
6987     private static boolean testNexusCharactersParsing() {
6988         try {
6989             final NexusCharactersParser parser = new NexusCharactersParser();
6990             parser.setSource( new File( Test.PATH_TO_TEST_DATA + "nexus_test_7.nex" ) );
6991             parser.parse();
6992             String[] labels = parser.getCharStateLabels();
6993             if ( labels.length != 7 ) {
6994                 return false;
6995             }
6996             if ( !labels[ 0 ].equals( "14-3-3" ) ) {
6997                 return false;
6998             }
6999             if ( !labels[ 1 ].equals( "2-Hacid_dh" ) ) {
7000                 return false;
7001             }
7002             if ( !labels[ 2 ].equals( "2-Hacid_dh_C" ) ) {
7003                 return false;
7004             }
7005             if ( !labels[ 3 ].equals( "2-oxoacid_dh" ) ) {
7006                 return false;
7007             }
7008             if ( !labels[ 4 ].equals( "2OG-FeII_Oxy" ) ) {
7009                 return false;
7010             }
7011             if ( !labels[ 5 ].equals( "3-HAO" ) ) {
7012                 return false;
7013             }
7014             if ( !labels[ 6 ].equals( "3_5_exonuc" ) ) {
7015                 return false;
7016             }
7017             parser.setSource( new File( Test.PATH_TO_TEST_DATA + "nexus_test_8.nex" ) );
7018             parser.parse();
7019             labels = parser.getCharStateLabels();
7020             if ( labels.length != 7 ) {
7021                 return false;
7022             }
7023             if ( !labels[ 0 ].equals( "14-3-3" ) ) {
7024                 return false;
7025             }
7026             if ( !labels[ 1 ].equals( "2-Hacid_dh" ) ) {
7027                 return false;
7028             }
7029             if ( !labels[ 2 ].equals( "2-Hacid_dh_C" ) ) {
7030                 return false;
7031             }
7032             if ( !labels[ 3 ].equals( "2-oxoacid_dh" ) ) {
7033                 return false;
7034             }
7035             if ( !labels[ 4 ].equals( "2OG-FeII_Oxy" ) ) {
7036                 return false;
7037             }
7038             if ( !labels[ 5 ].equals( "3-HAO" ) ) {
7039                 return false;
7040             }
7041             if ( !labels[ 6 ].equals( "3_5_exonuc" ) ) {
7042                 return false;
7043             }
7044         }
7045         catch ( final Exception e ) {
7046             e.printStackTrace( System.out );
7047             return false;
7048         }
7049         return true;
7050     }
7051
7052     private static boolean testNexusMatrixParsing() {
7053         try {
7054             final NexusBinaryStatesMatrixParser parser = new NexusBinaryStatesMatrixParser();
7055             parser.setSource( new File( Test.PATH_TO_TEST_DATA + "nexus_test_9.nex" ) );
7056             parser.parse();
7057             final CharacterStateMatrix<BinaryStates> m = parser.getMatrix();
7058             if ( m.getNumberOfCharacters() != 9 ) {
7059                 return false;
7060             }
7061             if ( m.getNumberOfIdentifiers() != 5 ) {
7062                 return false;
7063             }
7064             if ( m.getState( 0, 0 ) != BinaryStates.PRESENT ) {
7065                 return false;
7066             }
7067             if ( m.getState( 0, 1 ) != BinaryStates.ABSENT ) {
7068                 return false;
7069             }
7070             if ( m.getState( 1, 0 ) != BinaryStates.PRESENT ) {
7071                 return false;
7072             }
7073             if ( m.getState( 2, 0 ) != BinaryStates.ABSENT ) {
7074                 return false;
7075             }
7076             if ( m.getState( 4, 8 ) != BinaryStates.PRESENT ) {
7077                 return false;
7078             }
7079             if ( !m.getIdentifier( 0 ).equals( "MOUSE" ) ) {
7080                 return false;
7081             }
7082             if ( !m.getIdentifier( 4 ).equals( "ARATH" ) ) {
7083                 return false;
7084             }
7085             //            if ( labels.length != 7 ) {
7086             //                return false;
7087             //            }
7088             //            if ( !labels[ 0 ].equals( "14-3-3" ) ) {
7089             //                return false;
7090             //            }
7091             //            if ( !labels[ 1 ].equals( "2-Hacid_dh" ) ) {
7092             //                return false;
7093             //            }
7094             //            if ( !labels[ 2 ].equals( "2-Hacid_dh_C" ) ) {
7095             //                return false;
7096             //            }
7097             //            if ( !labels[ 3 ].equals( "2-oxoacid_dh" ) ) {
7098             //                return false;
7099             //            }
7100             //            if ( !labels[ 4 ].equals( "2OG-FeII_Oxy" ) ) {
7101             //                return false;
7102             //            }
7103             //            if ( !labels[ 5 ].equals( "3-HAO" ) ) {
7104             //                return false;
7105             //            }
7106             //            if ( !labels[ 6 ].equals( "3_5_exonuc" ) ) {
7107             //                return false;
7108             //            }
7109             //            parser.setSource( new File( Test.PATH_TO_TEST_DATA + "nexus_test_8.nex" ) );
7110             //            parser.parse();
7111             //            labels = parser.getCharStateLabels();
7112             //            if ( labels.length != 7 ) {
7113             //                return false;
7114             //            }
7115             //            if ( !labels[ 0 ].equals( "14-3-3" ) ) {
7116             //                return false;
7117             //            }
7118             //            if ( !labels[ 1 ].equals( "2-Hacid_dh" ) ) {
7119             //                return false;
7120             //            }
7121             //            if ( !labels[ 2 ].equals( "2-Hacid_dh_C" ) ) {
7122             //                return false;
7123             //            }
7124             //            if ( !labels[ 3 ].equals( "2-oxoacid_dh" ) ) {
7125             //                return false;
7126             //            }
7127             //            if ( !labels[ 4 ].equals( "2OG-FeII_Oxy" ) ) {
7128             //                return false;
7129             //            }
7130             //            if ( !labels[ 5 ].equals( "3-HAO" ) ) {
7131             //                return false;
7132             //            }
7133             //            if ( !labels[ 6 ].equals( "3_5_exonuc" ) ) {
7134             //                return false;
7135             //            }
7136         }
7137         catch ( final Exception e ) {
7138             e.printStackTrace( System.out );
7139             return false;
7140         }
7141         return true;
7142     }
7143
7144     private static boolean testNexusTreeParsing() {
7145         try {
7146             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
7147             final NexusPhylogeniesParser parser = new NexusPhylogeniesParser();
7148             Phylogeny[] phylogenies = factory.create( Test.PATH_TO_TEST_DATA + "nexus_test_1.nex", parser );
7149             if ( phylogenies.length != 1 ) {
7150                 return false;
7151             }
7152             if ( phylogenies[ 0 ].getNumberOfExternalNodes() != 25 ) {
7153                 return false;
7154             }
7155             if ( !phylogenies[ 0 ].getName().equals( "" ) ) {
7156                 return false;
7157             }
7158             phylogenies = null;
7159             phylogenies = factory.create( Test.PATH_TO_TEST_DATA + "nexus_test_2.nex", parser );
7160             if ( phylogenies.length != 1 ) {
7161                 return false;
7162             }
7163             if ( phylogenies[ 0 ].getNumberOfExternalNodes() != 10 ) {
7164                 return false;
7165             }
7166             if ( !phylogenies[ 0 ].getName().equals( "name" ) ) {
7167                 return false;
7168             }
7169             phylogenies = null;
7170             phylogenies = factory.create( Test.PATH_TO_TEST_DATA + "nexus_test_3.nex", parser );
7171             if ( phylogenies.length != 1 ) {
7172                 return false;
7173             }
7174             if ( phylogenies[ 0 ].getNumberOfExternalNodes() != 3 ) {
7175                 return false;
7176             }
7177             if ( !phylogenies[ 0 ].getName().equals( "" ) ) {
7178                 return false;
7179             }
7180             if ( phylogenies[ 0 ].isRooted() ) {
7181                 return false;
7182             }
7183             phylogenies = null;
7184             phylogenies = factory.create( Test.PATH_TO_TEST_DATA + "nexus_test_4.nex", parser );
7185             if ( phylogenies.length != 18 ) {
7186                 return false;
7187             }
7188             if ( phylogenies[ 0 ].getNumberOfExternalNodes() != 10 ) {
7189                 return false;
7190             }
7191             if ( !phylogenies[ 0 ].getName().equals( "tree 0" ) ) {
7192                 return false;
7193             }
7194             if ( !phylogenies[ 1 ].getName().equals( "tree 1" ) ) {
7195                 return false;
7196             }
7197             if ( phylogenies[ 1 ].getNumberOfExternalNodes() != 10 ) {
7198                 return false;
7199             }
7200             if ( phylogenies[ 2 ].getNumberOfExternalNodes() != 3 ) {
7201                 return false;
7202             }
7203             if ( phylogenies[ 3 ].getNumberOfExternalNodes() != 3 ) {
7204                 return false;
7205             }
7206             if ( phylogenies[ 4 ].getNumberOfExternalNodes() != 3 ) {
7207                 return false;
7208             }
7209             if ( phylogenies[ 5 ].getNumberOfExternalNodes() != 3 ) {
7210                 return false;
7211             }
7212             if ( phylogenies[ 6 ].getNumberOfExternalNodes() != 3 ) {
7213                 return false;
7214             }
7215             if ( phylogenies[ 7 ].getNumberOfExternalNodes() != 3 ) {
7216                 return false;
7217             }
7218             if ( !phylogenies[ 8 ].getName().equals( "tree 8" ) ) {
7219                 return false;
7220             }
7221             if ( phylogenies[ 8 ].isRooted() ) {
7222                 return false;
7223             }
7224             if ( phylogenies[ 8 ].getNumberOfExternalNodes() != 3 ) {
7225                 return false;
7226             }
7227             if ( !phylogenies[ 9 ].getName().equals( "tree 9" ) ) {
7228                 return false;
7229             }
7230             if ( !phylogenies[ 9 ].isRooted() ) {
7231                 return false;
7232             }
7233             if ( phylogenies[ 9 ].getNumberOfExternalNodes() != 3 ) {
7234                 return false;
7235             }
7236             if ( !phylogenies[ 10 ].getName().equals( "tree 10" ) ) {
7237                 return false;
7238             }
7239             if ( !phylogenies[ 10 ].isRooted() ) {
7240                 return false;
7241             }
7242             if ( phylogenies[ 10 ].getNumberOfExternalNodes() != 3 ) {
7243                 return false;
7244             }
7245             if ( !phylogenies[ 11 ].getName().equals( "tree 11" ) ) {
7246                 return false;
7247             }
7248             if ( phylogenies[ 11 ].isRooted() ) {
7249                 return false;
7250             }
7251             if ( phylogenies[ 11 ].getNumberOfExternalNodes() != 3 ) {
7252                 return false;
7253             }
7254             if ( !phylogenies[ 12 ].getName().equals( "tree 12" ) ) {
7255                 return false;
7256             }
7257             if ( !phylogenies[ 12 ].isRooted() ) {
7258                 return false;
7259             }
7260             if ( phylogenies[ 12 ].getNumberOfExternalNodes() != 3 ) {
7261                 return false;
7262             }
7263             if ( !phylogenies[ 13 ].getName().equals( "tree 13" ) ) {
7264                 return false;
7265             }
7266             if ( !phylogenies[ 13 ].isRooted() ) {
7267                 return false;
7268             }
7269             if ( phylogenies[ 13 ].getNumberOfExternalNodes() != 3 ) {
7270                 return false;
7271             }
7272             if ( !phylogenies[ 14 ].getName().equals( "tree 14" ) ) {
7273                 return false;
7274             }
7275             if ( !phylogenies[ 14 ].isRooted() ) {
7276                 return false;
7277             }
7278             if ( phylogenies[ 14 ].getNumberOfExternalNodes() != 10 ) {
7279                 return false;
7280             }
7281             if ( !phylogenies[ 15 ].getName().equals( "tree 15" ) ) {
7282                 return false;
7283             }
7284             if ( phylogenies[ 15 ].isRooted() ) {
7285                 return false;
7286             }
7287             if ( phylogenies[ 15 ].getNumberOfExternalNodes() != 10 ) {
7288                 return false;
7289             }
7290             if ( !phylogenies[ 16 ].getName().equals( "tree 16" ) ) {
7291                 return false;
7292             }
7293             if ( !phylogenies[ 16 ].isRooted() ) {
7294                 return false;
7295             }
7296             if ( phylogenies[ 16 ].getNumberOfExternalNodes() != 10 ) {
7297                 return false;
7298             }
7299             if ( !phylogenies[ 17 ].getName().equals( "tree 17" ) ) {
7300                 return false;
7301             }
7302             if ( phylogenies[ 17 ].isRooted() ) {
7303                 return false;
7304             }
7305             if ( phylogenies[ 17 ].getNumberOfExternalNodes() != 10 ) {
7306                 return false;
7307             }
7308             final NexusPhylogeniesParser p2 = new NexusPhylogeniesParser();
7309             phylogenies = null;
7310             phylogenies = factory.create( Test.PATH_TO_TEST_DATA + "S15613.nex", p2 );
7311             if ( phylogenies.length != 9 ) {
7312                 return false;
7313             }
7314             if ( !isEqual( 0.48039661496919533, phylogenies[ 0 ].getNode( "Diadocidia_spinosula" )
7315                            .getDistanceToParent() ) ) {
7316                 return false;
7317             }
7318             if ( !isEqual( 0.3959796191512233, phylogenies[ 0 ].getNode( "Diadocidia_stanfordensis" )
7319                            .getDistanceToParent() ) ) {
7320                 return false;
7321             }
7322             if ( !phylogenies[ 0 ].getName().equals( "Family Diadocidiidae MLT (Imported_tree_0)" ) ) {
7323                 return false;
7324             }
7325             if ( !phylogenies[ 1 ].getName().equals( "Family Diadocidiidae BAT (con_50_majrule)" ) ) {
7326                 return false;
7327             }
7328             if ( !phylogenies[ 2 ].getName().equals( "Family Diadocidiidae BAT (con_50_majrule)" ) ) {
7329                 return false;
7330             }
7331             if ( !isEqual( 0.065284, phylogenies[ 7 ].getNode( "Bradysia_amoena" ).getDistanceToParent() ) ) {
7332                 return false;
7333             }
7334             if ( !isEqual( 0.065284, phylogenies[ 8 ].getNode( "Bradysia_amoena" ).getDistanceToParent() ) ) {
7335                 return false;
7336             }
7337         }
7338         catch ( final Exception e ) {
7339             e.printStackTrace( System.out );
7340             return false;
7341         }
7342         return true;
7343     }
7344
7345     private static boolean testNexusTreeParsingIterating() {
7346         try {
7347             final NexusPhylogeniesParser p = new NexusPhylogeniesParser();
7348             p.setSource( Test.PATH_TO_TEST_DATA + "nexus_test_1.nex" );
7349             if ( !p.hasNext() ) {
7350                 return false;
7351             }
7352             Phylogeny phy = p.next();
7353             if ( phy == null ) {
7354                 return false;
7355             }
7356             if ( phy.getNumberOfExternalNodes() != 25 ) {
7357                 return false;
7358             }
7359             if ( !phy.getName().equals( "" ) ) {
7360                 return false;
7361             }
7362             if ( p.hasNext() ) {
7363                 return false;
7364             }
7365             phy = p.next();
7366             if ( phy != null ) {
7367                 return false;
7368             }
7369             p.reset();
7370             if ( !p.hasNext() ) {
7371                 return false;
7372             }
7373             phy = p.next();
7374             if ( phy == null ) {
7375                 return false;
7376             }
7377             if ( phy.getNumberOfExternalNodes() != 25 ) {
7378                 return false;
7379             }
7380             if ( !phy.getName().equals( "" ) ) {
7381                 return false;
7382             }
7383             if ( p.hasNext() ) {
7384                 return false;
7385             }
7386             phy = p.next();
7387             if ( phy != null ) {
7388                 return false;
7389             }
7390             p.setSource( Test.PATH_TO_TEST_DATA + "nexus_test_2.nex" );
7391             if ( !p.hasNext() ) {
7392                 return false;
7393             }
7394             phy = p.next();
7395             if ( phy == null ) {
7396                 return false;
7397             }
7398             if ( phy.getNumberOfExternalNodes() != 10 ) {
7399                 return false;
7400             }
7401             if ( !phy.getName().equals( "name" ) ) {
7402                 return false;
7403             }
7404             if ( p.hasNext() ) {
7405                 return false;
7406             }
7407             phy = p.next();
7408             if ( phy != null ) {
7409                 return false;
7410             }
7411             p.reset();
7412             if ( !p.hasNext() ) {
7413                 return false;
7414             }
7415             phy = p.next();
7416             if ( phy == null ) {
7417                 return false;
7418             }
7419             if ( phy.getNumberOfExternalNodes() != 10 ) {
7420                 return false;
7421             }
7422             if ( !phy.getName().equals( "name" ) ) {
7423                 return false;
7424             }
7425             if ( p.hasNext() ) {
7426                 return false;
7427             }
7428             phy = p.next();
7429             if ( phy != null ) {
7430                 return false;
7431             }
7432             p.setSource( Test.PATH_TO_TEST_DATA + "nexus_test_3.nex" );
7433             if ( !p.hasNext() ) {
7434                 return false;
7435             }
7436             phy = p.next();
7437             if ( phy == null ) {
7438                 return false;
7439             }
7440             if ( phy.getNumberOfExternalNodes() != 3 ) {
7441                 return false;
7442             }
7443             if ( !phy.getName().equals( "" ) ) {
7444                 return false;
7445             }
7446             if ( phy.isRooted() ) {
7447                 return false;
7448             }
7449             if ( p.hasNext() ) {
7450                 return false;
7451             }
7452             phy = p.next();
7453             if ( phy != null ) {
7454                 return false;
7455             }
7456             //
7457             p.reset();
7458             if ( !p.hasNext() ) {
7459                 return false;
7460             }
7461             phy = p.next();
7462             if ( phy == null ) {
7463                 return false;
7464             }
7465             if ( phy.getNumberOfExternalNodes() != 3 ) {
7466                 return false;
7467             }
7468             if ( !phy.getName().equals( "" ) ) {
7469                 return false;
7470             }
7471             if ( p.hasNext() ) {
7472                 return false;
7473             }
7474             phy = p.next();
7475             if ( phy != null ) {
7476                 return false;
7477             }
7478             //
7479             p.setSource( Test.PATH_TO_TEST_DATA + "nexus_test_4_1.nex" );
7480             if ( !p.hasNext() ) {
7481                 return false;
7482             }
7483             //0
7484             phy = p.next();
7485             if ( phy == null ) {
7486                 return false;
7487             }
7488             if ( phy.getNumberOfExternalNodes() != 10 ) {
7489                 return false;
7490             }
7491             if ( !phy.getName().equals( "tree 0" ) ) {
7492                 return false;
7493             }
7494             //1
7495             if ( !p.hasNext() ) {
7496                 return false;
7497             }
7498             phy = p.next();
7499             if ( phy == null ) {
7500                 return false;
7501             }
7502             if ( phy.getNumberOfExternalNodes() != 10 ) {
7503                 return false;
7504             }
7505             if ( !phy.getName().equals( "tree 1" ) ) {
7506                 return false;
7507             }
7508             //2
7509             if ( !p.hasNext() ) {
7510                 return false;
7511             }
7512             phy = p.next();
7513             if ( phy == null ) {
7514                 return false;
7515             }
7516             if ( phy.getNumberOfExternalNodes() != 3 ) {
7517                 System.out.println( phy.toString() );
7518                 return false;
7519             }
7520             if ( !phy.getName().equals( "" ) ) {
7521                 return false;
7522             }
7523             if ( phy.isRooted() ) {
7524                 return false;
7525             }
7526             //3
7527             if ( !p.hasNext() ) {
7528                 return false;
7529             }
7530             phy = p.next();
7531             if ( phy == null ) {
7532                 return false;
7533             }
7534             if ( phy.getNumberOfExternalNodes() != 4 ) {
7535                 return false;
7536             }
7537             if ( !phy.getName().equals( "" ) ) {
7538                 return false;
7539             }
7540             if ( !phy.isRooted() ) {
7541                 return false;
7542             }
7543             //4
7544             if ( !p.hasNext() ) {
7545                 return false;
7546             }
7547             phy = p.next();
7548             if ( phy == null ) {
7549                 return false;
7550             }
7551             if ( phy.getNumberOfExternalNodes() != 5 ) {
7552                 System.out.println( phy.getNumberOfExternalNodes() );
7553                 return false;
7554             }
7555             if ( !phy.getName().equals( "" ) ) {
7556                 return false;
7557             }
7558             if ( !phy.isRooted() ) {
7559                 return false;
7560             }
7561             //5
7562             if ( !p.hasNext() ) {
7563                 return false;
7564             }
7565             phy = p.next();
7566             if ( phy == null ) {
7567                 return false;
7568             }
7569             if ( phy.getNumberOfExternalNodes() != 3 ) {
7570                 return false;
7571             }
7572             if ( !phy.getName().equals( "" ) ) {
7573                 return false;
7574             }
7575             if ( phy.isRooted() ) {
7576                 return false;
7577             }
7578             //6
7579             if ( !p.hasNext() ) {
7580                 return false;
7581             }
7582             phy = p.next();
7583             if ( phy == null ) {
7584                 return false;
7585             }
7586             if ( phy.getNumberOfExternalNodes() != 2 ) {
7587                 return false;
7588             }
7589             if ( !phy.getName().equals( "" ) ) {
7590                 return false;
7591             }
7592             if ( !phy.isRooted() ) {
7593                 return false;
7594             }
7595             //7
7596             if ( !p.hasNext() ) {
7597                 return false;
7598             }
7599             phy = p.next();
7600             if ( phy.getNumberOfExternalNodes() != 3 ) {
7601                 return false;
7602             }
7603             if ( !phy.toNewHampshire().equals( "((a,b),c);" ) ) {
7604                 return false;
7605             }
7606             if ( !phy.isRooted() ) {
7607                 return false;
7608             }
7609             //8
7610             if ( !p.hasNext() ) {
7611                 return false;
7612             }
7613             phy = p.next();
7614             if ( phy.getNumberOfExternalNodes() != 3 ) {
7615                 return false;
7616             }
7617             if ( !phy.toNewHampshire().equals( "((AA,BB),CC);" ) ) {
7618                 return false;
7619             }
7620             if ( !phy.getName().equals( "tree 8" ) ) {
7621                 return false;
7622             }
7623             //9
7624             if ( !p.hasNext() ) {
7625                 return false;
7626             }
7627             phy = p.next();
7628             if ( phy.getNumberOfExternalNodes() != 3 ) {
7629                 return false;
7630             }
7631             if ( !phy.toNewHampshire().equals( "((a,b),cc);" ) ) {
7632                 return false;
7633             }
7634             if ( !phy.getName().equals( "tree 9" ) ) {
7635                 return false;
7636             }
7637             //10
7638             if ( !p.hasNext() ) {
7639                 return false;
7640             }
7641             phy = p.next();
7642             if ( phy.getNumberOfExternalNodes() != 3 ) {
7643                 return false;
7644             }
7645             if ( !phy.toNewHampshire().equals( "((a,b),c);" ) ) {
7646                 return false;
7647             }
7648             if ( !phy.getName().equals( "tree 10" ) ) {
7649                 return false;
7650             }
7651             if ( !phy.isRooted() ) {
7652                 return false;
7653             }
7654             //11
7655             if ( !p.hasNext() ) {
7656                 return false;
7657             }
7658             phy = p.next();
7659             if ( phy.getNumberOfExternalNodes() != 3 ) {
7660                 return false;
7661             }
7662             if ( !phy.toNewHampshire().equals( "((1,2),3);" ) ) {
7663                 return false;
7664             }
7665             if ( !phy.getName().equals( "tree 11" ) ) {
7666                 return false;
7667             }
7668             if ( phy.isRooted() ) {
7669                 return false;
7670             }
7671             //12
7672             if ( !p.hasNext() ) {
7673                 return false;
7674             }
7675             phy = p.next();
7676             if ( phy.getNumberOfExternalNodes() != 3 ) {
7677                 return false;
7678             }
7679             if ( !phy.toNewHampshire().equals( "((aa,bb),cc);" ) ) {
7680                 return false;
7681             }
7682             if ( !phy.getName().equals( "tree 12" ) ) {
7683                 return false;
7684             }
7685             if ( !phy.isRooted() ) {
7686                 return false;
7687             }
7688             //13
7689             if ( !p.hasNext() ) {
7690                 return false;
7691             }
7692             phy = p.next();
7693             if ( phy.getNumberOfExternalNodes() != 3 ) {
7694                 return false;
7695             }
7696             if ( !phy.toNewHampshire().equals( "((a,b),c);" ) ) {
7697                 return false;
7698             }
7699             if ( !phy.getName().equals( "tree 13" ) ) {
7700                 return false;
7701             }
7702             if ( !phy.isRooted() ) {
7703                 return false;
7704             }
7705             //14
7706             if ( !p.hasNext() ) {
7707                 return false;
7708             }
7709             phy = p.next();
7710             if ( phy.getNumberOfExternalNodes() != 10 ) {
7711                 System.out.println( phy.getNumberOfExternalNodes() );
7712                 return false;
7713             }
7714             if ( !phy
7715                     .toNewHampshire()
7716                     .equals( "(1:0.212481,8:0.297838,(9:0.222729,((6:0.201563,7:0.194547):0.282035,(4:1.146091,(3:1.008881,(10:0.384105,(2:0.235682,5:0.353432):0.32368):0.103875):0.41354):0.254687):0.095341):0.079254):0.0;" ) ) {
7717                 System.out.println( phy.toNewHampshire() );
7718                 return false;
7719             }
7720             if ( !phy.getName().equals( "tree 14" ) ) {
7721                 return false;
7722             }
7723             if ( !phy.isRooted() ) {
7724                 return false;
7725             }
7726             //15
7727             if ( !p.hasNext() ) {
7728                 return false;
7729             }
7730             phy = p.next();
7731             if ( phy.getNumberOfExternalNodes() != 10 ) {
7732                 System.out.println( phy.getNumberOfExternalNodes() );
7733                 return false;
7734             }
7735             if ( !phy
7736                     .toNewHampshire()
7737                     .equals( "(1:0.212481,8:0.297838,(9:0.222729,((6:0.201563,7:0.194547):0.282035,(4:1.146091,(3:1.008881,(10:0.384105,(2:0.235682,5:0.353432):0.32368):0.103875):0.41354):0.254687):0.095341):0.079254):0.0;" ) ) {
7738                 System.out.println( phy.toNewHampshire() );
7739                 return false;
7740             }
7741             if ( !phy.getName().equals( "tree 15" ) ) {
7742                 return false;
7743             }
7744             if ( phy.isRooted() ) {
7745                 return false;
7746             }
7747             //16
7748             if ( !p.hasNext() ) {
7749                 return false;
7750             }
7751             phy = p.next();
7752             if ( phy.getNumberOfExternalNodes() != 10 ) {
7753                 System.out.println( phy.getNumberOfExternalNodes() );
7754                 return false;
7755             }
7756             if ( !phy
7757                     .toNewHampshire()
7758                     .equals( "(1:0.212481,8:0.297838,(9:0.222729,((6:0.201563,7:0.194547):0.282035,(4:1.146091,(3:1.008881,(10:0.384105,(2:0.235682,5:0.353432):0.32368):0.103875):0.41354):0.254687):0.095341):0.079254):0.0;" ) ) {
7759                 System.out.println( phy.toNewHampshire() );
7760                 return false;
7761             }
7762             if ( !phy.getName().equals( "tree 16" ) ) {
7763                 return false;
7764             }
7765             if ( !phy.isRooted() ) {
7766                 return false;
7767             }
7768             //17
7769             if ( !p.hasNext() ) {
7770                 return false;
7771             }
7772             phy = p.next();
7773             if ( phy.getNumberOfExternalNodes() != 10 ) {
7774                 System.out.println( phy.getNumberOfExternalNodes() );
7775                 return false;
7776             }
7777             if ( !phy
7778                     .toNewHampshire()
7779                     .equals( "(1:0.212481,8:0.297838,(9:0.222729,((6:0.201563,7:0.194547):0.282035,(4:1.146091,(3:1.008881,(10:0.384105,(2:0.235682,5:0.353432):0.32368):0.103875):0.41354):0.254687):0.095341):0.079254):0.0;" ) ) {
7780                 System.out.println( phy.toNewHampshire() );
7781                 return false;
7782             }
7783             if ( !phy.getName().equals( "tree 17" ) ) {
7784                 return false;
7785             }
7786             if ( phy.isRooted() ) {
7787                 return false;
7788             }
7789             //
7790             if ( p.hasNext() ) {
7791                 return false;
7792             }
7793             phy = p.next();
7794             if ( phy != null ) {
7795                 return false;
7796             }
7797             p.reset();
7798             //0
7799             if ( !p.hasNext() ) {
7800                 return false;
7801             }
7802             phy = p.next();
7803             if ( phy == null ) {
7804                 return false;
7805             }
7806             if ( phy.getNumberOfExternalNodes() != 10 ) {
7807                 return false;
7808             }
7809             if ( !phy.getName().equals( "tree 0" ) ) {
7810                 return false;
7811             }
7812             //1
7813             if ( !p.hasNext() ) {
7814                 return false;
7815             }
7816             phy = p.next();
7817             if ( phy == null ) {
7818                 return false;
7819             }
7820             if ( phy.getNumberOfExternalNodes() != 10 ) {
7821                 return false;
7822             }
7823             if ( !phy.getName().equals( "tree 1" ) ) {
7824                 return false;
7825             }
7826             //2
7827             if ( !p.hasNext() ) {
7828                 return false;
7829             }
7830             phy = p.next();
7831             if ( phy == null ) {
7832                 return false;
7833             }
7834             if ( phy.getNumberOfExternalNodes() != 3 ) {
7835                 return false;
7836             }
7837             if ( !phy.getName().equals( "" ) ) {
7838                 return false;
7839             }
7840             if ( phy.isRooted() ) {
7841                 return false;
7842             }
7843             //3
7844             if ( !p.hasNext() ) {
7845                 return false;
7846             }
7847             phy = p.next();
7848             if ( phy == null ) {
7849                 return false;
7850             }
7851             if ( phy.getNumberOfExternalNodes() != 4 ) {
7852                 return false;
7853             }
7854             if ( !phy.getName().equals( "" ) ) {
7855                 return false;
7856             }
7857             if ( !phy.isRooted() ) {
7858                 return false;
7859             }
7860             //4
7861             if ( !p.hasNext() ) {
7862                 return false;
7863             }
7864             phy = p.next();
7865             if ( phy == null ) {
7866                 return false;
7867             }
7868             if ( phy.getNumberOfExternalNodes() != 5 ) {
7869                 System.out.println( phy.getNumberOfExternalNodes() );
7870                 return false;
7871             }
7872             if ( !phy.getName().equals( "" ) ) {
7873                 return false;
7874             }
7875             if ( !phy.isRooted() ) {
7876                 return false;
7877             }
7878             //5
7879             if ( !p.hasNext() ) {
7880                 return false;
7881             }
7882             phy = p.next();
7883             if ( phy == null ) {
7884                 return false;
7885             }
7886             if ( phy.getNumberOfExternalNodes() != 3 ) {
7887                 return false;
7888             }
7889             if ( !phy.getName().equals( "" ) ) {
7890                 return false;
7891             }
7892             if ( phy.isRooted() ) {
7893                 return false;
7894             }
7895             //
7896             final NexusPhylogeniesParser p2 = new NexusPhylogeniesParser();
7897             p2.setSource( Test.PATH_TO_TEST_DATA + "S15613.nex" );
7898             // 0
7899             if ( !p2.hasNext() ) {
7900                 return false;
7901             }
7902             phy = p2.next();
7903             if ( !isEqual( 0.48039661496919533, phy.getNode( "Diadocidia_spinosula" ).getDistanceToParent() ) ) {
7904                 return false;
7905             }
7906             if ( !isEqual( 0.3959796191512233, phy.getNode( "Diadocidia_stanfordensis" ).getDistanceToParent() ) ) {
7907                 return false;
7908             }
7909             // 1
7910             if ( !p2.hasNext() ) {
7911                 return false;
7912             }
7913             phy = p2.next();
7914             // 2
7915             if ( !p2.hasNext() ) {
7916                 return false;
7917             }
7918             phy = p2.next();
7919             // 3
7920             if ( !p2.hasNext() ) {
7921                 return false;
7922             }
7923             phy = p2.next();
7924             // 4
7925             if ( !p2.hasNext() ) {
7926                 return false;
7927             }
7928             phy = p2.next();
7929             // 5
7930             if ( !p2.hasNext() ) {
7931                 return false;
7932             }
7933             phy = p2.next();
7934             // 6
7935             if ( !p2.hasNext() ) {
7936                 return false;
7937             }
7938             phy = p2.next();
7939             // 7
7940             if ( !p2.hasNext() ) {
7941                 return false;
7942             }
7943             phy = p2.next();
7944             // 8
7945             if ( !p2.hasNext() ) {
7946                 return false;
7947             }
7948             phy = p2.next();
7949             if ( !isEqual( 0.065284, phy.getNode( "Bradysia_amoena" ).getDistanceToParent() ) ) {
7950                 return false;
7951             }
7952             if ( p2.hasNext() ) {
7953                 return false;
7954             }
7955             phy = p2.next();
7956             if ( phy != null ) {
7957                 return false;
7958             }
7959             // 0
7960             p2.reset();
7961             if ( !p2.hasNext() ) {
7962                 return false;
7963             }
7964             phy = p2.next();
7965             if ( !isEqual( 0.48039661496919533, phy.getNode( "Diadocidia_spinosula" ).getDistanceToParent() ) ) {
7966                 return false;
7967             }
7968             if ( !isEqual( 0.3959796191512233, phy.getNode( "Diadocidia_stanfordensis" ).getDistanceToParent() ) ) {
7969                 return false;
7970             }
7971         }
7972         catch ( final Exception e ) {
7973             e.printStackTrace( System.out );
7974             return false;
7975         }
7976         return true;
7977     }
7978
7979     private static boolean testNexusTreeParsingTranslating() {
7980         try {
7981             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
7982             final NexusPhylogeniesParser parser = new NexusPhylogeniesParser();
7983             Phylogeny[] phylogenies = factory.create( Test.PATH_TO_TEST_DATA + "nexus_test_5.nex", parser );
7984             if ( phylogenies.length != 1 ) {
7985                 return false;
7986             }
7987             if ( phylogenies[ 0 ].getNumberOfExternalNodes() != 3 ) {
7988                 return false;
7989             }
7990             if ( !phylogenies[ 0 ].getName().equals( "Tree0" ) ) {
7991                 return false;
7992             }
7993             if ( !phylogenies[ 0 ].getFirstExternalNode().getName().equals( "Scarabaeus" ) ) {
7994                 return false;
7995             }
7996             if ( !phylogenies[ 0 ].getFirstExternalNode().getNextExternalNode().getName().equals( "Drosophila" ) ) {
7997                 return false;
7998             }
7999             if ( !phylogenies[ 0 ].getFirstExternalNode().getNextExternalNode().getNextExternalNode().getName()
8000                     .equals( "Aranaeus" ) ) {
8001                 return false;
8002             }
8003             phylogenies = null;
8004             phylogenies = factory.create( Test.PATH_TO_TEST_DATA + "nexus_test_6.nex", parser );
8005             if ( phylogenies.length != 3 ) {
8006                 return false;
8007             }
8008             if ( phylogenies[ 0 ].getNumberOfExternalNodes() != 3 ) {
8009                 return false;
8010             }
8011             if ( !phylogenies[ 0 ].getName().equals( "Tree0" ) ) {
8012                 return false;
8013             }
8014             if ( phylogenies[ 0 ].isRooted() ) {
8015                 return false;
8016             }
8017             if ( !phylogenies[ 0 ].getFirstExternalNode().getName().equals( "Scarabaeus" ) ) {
8018                 return false;
8019             }
8020             if ( !phylogenies[ 0 ].getFirstExternalNode().getNextExternalNode().getName().equals( "Drosophila" ) ) {
8021                 return false;
8022             }
8023             if ( !phylogenies[ 0 ].getFirstExternalNode().getNextExternalNode().getNextExternalNode().getName()
8024                     .equals( "Aranaeus" ) ) {
8025                 return false;
8026             }
8027             if ( phylogenies[ 1 ].getNumberOfExternalNodes() != 3 ) {
8028                 return false;
8029             }
8030             if ( !phylogenies[ 1 ].getName().equals( "Tree1" ) ) {
8031                 return false;
8032             }
8033             if ( phylogenies[ 1 ].isRooted() ) {
8034                 return false;
8035             }
8036             if ( !phylogenies[ 1 ].getFirstExternalNode().getName().equals( "Scarabaeus" ) ) {
8037                 return false;
8038             }
8039             if ( !phylogenies[ 1 ].getFirstExternalNode().getNextExternalNode().getName().equals( "Drosophila" ) ) {
8040                 return false;
8041             }
8042             if ( !phylogenies[ 1 ].getFirstExternalNode().getNextExternalNode().getNextExternalNode().getName()
8043                     .equals( "Aranaeus" ) ) {
8044                 return false;
8045             }
8046             if ( phylogenies[ 2 ].getNumberOfExternalNodes() != 3 ) {
8047                 return false;
8048             }
8049             if ( !phylogenies[ 2 ].getName().equals( "Tree2" ) ) {
8050                 return false;
8051             }
8052             if ( !phylogenies[ 2 ].isRooted() ) {
8053                 return false;
8054             }
8055             if ( !phylogenies[ 2 ].getFirstExternalNode().getName().equals( "Scarabaeus" ) ) {
8056                 return false;
8057             }
8058             if ( !phylogenies[ 2 ].getFirstExternalNode().getNextExternalNode().getName().equals( "Drosophila" ) ) {
8059                 return false;
8060             }
8061             if ( !phylogenies[ 2 ].getFirstExternalNode().getNextExternalNode().getNextExternalNode().getName()
8062                     .equals( "Aranaeus" ) ) {
8063                 return false;
8064             }
8065             phylogenies = null;
8066             phylogenies = factory.create( Test.PATH_TO_TEST_DATA + "nexus_test_7.nex", parser );
8067             if ( phylogenies.length != 3 ) {
8068                 return false;
8069             }
8070             if ( phylogenies[ 0 ].getNumberOfExternalNodes() != 3 ) {
8071                 return false;
8072             }
8073             if ( !phylogenies[ 0 ].getName().equals( "Tree0" ) ) {
8074                 return false;
8075             }
8076             if ( phylogenies[ 0 ].isRooted() ) {
8077                 return false;
8078             }
8079             if ( !phylogenies[ 0 ].getFirstExternalNode().getName().equals( "Scarabaeus" ) ) {
8080                 return false;
8081             }
8082             if ( !phylogenies[ 0 ].getFirstExternalNode().getNextExternalNode().getName().equals( "Drosophila" ) ) {
8083                 return false;
8084             }
8085             if ( !phylogenies[ 0 ].getFirstExternalNode().getNextExternalNode().getNextExternalNode().getName()
8086                     .equals( "Aranaeus" ) ) {
8087                 return false;
8088             }
8089             if ( phylogenies[ 1 ].getNumberOfExternalNodes() != 3 ) {
8090                 return false;
8091             }
8092             if ( !phylogenies[ 1 ].getName().equals( "Tree1" ) ) {
8093                 return false;
8094             }
8095             if ( phylogenies[ 1 ].isRooted() ) {
8096                 return false;
8097             }
8098             if ( !phylogenies[ 1 ].getFirstExternalNode().getName().equals( "Scarabaeus" ) ) {
8099                 return false;
8100             }
8101             if ( !phylogenies[ 1 ].getFirstExternalNode().getNextExternalNode().getName().equals( "Drosophila" ) ) {
8102                 return false;
8103             }
8104             if ( !phylogenies[ 1 ].getFirstExternalNode().getNextExternalNode().getNextExternalNode().getName()
8105                     .equals( "Aranaeus" ) ) {
8106                 return false;
8107             }
8108             if ( phylogenies[ 2 ].getNumberOfExternalNodes() != 3 ) {
8109                 return false;
8110             }
8111             if ( !phylogenies[ 2 ].getName().equals( "Tree2" ) ) {
8112                 return false;
8113             }
8114             if ( !phylogenies[ 2 ].isRooted() ) {
8115                 return false;
8116             }
8117             if ( !phylogenies[ 2 ].getFirstExternalNode().getName().equals( "Scarabaeus" ) ) {
8118                 return false;
8119             }
8120             if ( !phylogenies[ 2 ].getFirstExternalNode().getNextExternalNode().getName().equals( "Drosophila" ) ) {
8121                 return false;
8122             }
8123             if ( !phylogenies[ 2 ].getFirstExternalNode().getNextExternalNode().getNextExternalNode().getName()
8124                     .equals( "Aranaeus" ) ) {
8125                 return false;
8126             }
8127             phylogenies = factory.create( Test.PATH_TO_TEST_DATA + "S14117.nex", parser );
8128             if ( phylogenies.length != 3 ) {
8129                 return false;
8130             }
8131             if ( !isEqual( phylogenies[ 2 ].getNode( "Aloysia lycioides 251-76-02169" ).getDistanceToParent(),
8132                            0.00100049 ) ) {
8133                 return false;
8134             }
8135         }
8136         catch ( final Exception e ) {
8137             e.printStackTrace( System.out );
8138             return false;
8139         }
8140         return true;
8141     }
8142
8143     private static boolean testNHParsing() {
8144         try {
8145             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
8146             final Phylogeny p1 = factory.create( "(A,B1)", new NHXParser() )[ 0 ];
8147             if ( !p1.toNewHampshireX().equals( "(A,B1)" ) ) {
8148                 return false;
8149             }
8150             final NHXParser nhxp = new NHXParser();
8151             nhxp.setTaxonomyExtraction( NHXParser.TAXONOMY_EXTRACTION.NO );
8152             nhxp.setReplaceUnderscores( true );
8153             final Phylogeny uc0 = factory.create( "(A__A_,_B_B)", nhxp )[ 0 ];
8154             if ( !uc0.getRoot().getChildNode( 0 ).getName().equals( "A A" ) ) {
8155                 return false;
8156             }
8157             if ( !uc0.getRoot().getChildNode( 1 ).getName().equals( "B B" ) ) {
8158                 return false;
8159             }
8160             final Phylogeny p1b = factory
8161                     .create( "   \n  \t  \b   \r \f   ; (  \n  \t  \b   \r \f; A ;  \n  \t  \b   \r \f,  \n  \t  \b   \r \f; B ;   \n  \t  \b   \r \f 1  \n  \t  \b   \r \f ;  \n  \t  \b   \r \f );;;;; \n  \t  \b   \r \f;;;  \n  \t  \b   \r \f ",
8162                              new NHXParser() )[ 0 ];
8163             if ( !p1b.toNewHampshireX().equals( "(';A;',';B;1;')" ) ) {
8164                 return false;
8165             }
8166             if ( !p1b.toNewHampshire().equals( "(';A;',';B;1;');" ) ) {
8167                 return false;
8168             }
8169             final Phylogeny p2 = factory.create( new StringBuffer( "(A,B2)" ), new NHXParser() )[ 0 ];
8170             final Phylogeny p3 = factory.create( new char[] { '(', 'A', ',', 'B', '3', ')' }, new NHXParser() )[ 0 ];
8171             final Phylogeny p4 = factory.create( "(A,B4);", new NHXParser() )[ 0 ];
8172             final Phylogeny p5 = factory.create( new StringBuffer( "(A,B5);" ), new NHXParser() )[ 0 ];
8173             final Phylogeny[] p7 = factory.create( "(A,B7);(C,D7)", new NHXParser() );
8174             final Phylogeny[] p8 = factory.create( "(A,B8) (C,D8)", new NHXParser() );
8175             final Phylogeny[] p9 = factory.create( "(A,B9)\n(C,D9)", new NHXParser() );
8176             final Phylogeny[] p10 = factory.create( "(A,B10);(C,D10);", new NHXParser() );
8177             final Phylogeny[] p11 = factory.create( "(A,B11);(C,D11) (E,F11)\t(G,H11)", new NHXParser() );
8178             final Phylogeny[] p12 = factory.create( "(A,B12) (C,D12) (E,F12) (G,H12)", new NHXParser() );
8179             final Phylogeny[] p13 = factory.create( " ; (;A; , ; B ; 1  3 ; \n)\t ( \n ;"
8180                     + " C ; ,; D;13;);;;;;;(;E;,;F;13 ;) ; "
8181                     + "; ; ( \t\n\r\b; G ;, ;H ;1 3; )  ;  ;   ;",
8182                     new NHXParser() );
8183             if ( !p13[ 0 ].toNewHampshireX().equals( "(';A;',';B;13;')" ) ) {
8184                 return false;
8185             }
8186             if ( !p13[ 1 ].toNewHampshireX().equals( "(';C;',';D;13;')" ) ) {
8187                 return false;
8188             }
8189             if ( !p13[ 2 ].toNewHampshireX().equals( "(';E;',';F;13;')" ) ) {
8190                 return false;
8191             }
8192             if ( !p13[ 3 ].toNewHampshireX().equals( "(';G;',';H;13;')" ) ) {
8193                 return false;
8194             }
8195             final Phylogeny[] p14 = factory.create( "(A,B14)ab", new NHXParser() );
8196             final Phylogeny[] p15 = factory.create( "(A,B15)ab;", new NHXParser() );
8197             final String p16_S = "((A,B),C)";
8198             final Phylogeny[] p16 = factory.create( p16_S, new NHXParser() );
8199             if ( p16.length != 1 ) {
8200                 return false;
8201             }
8202             if ( !p16[ 0 ].toNewHampshireX().equals( p16_S ) ) {
8203                 return false;
8204             }
8205             final String p17_S = "(C,(A,B))";
8206             final Phylogeny[] p17 = factory.create( p17_S, new NHXParser() );
8207             if ( p17.length != 1 ) {
8208                 return false;
8209             }
8210             if ( !p17[ 0 ].toNewHampshireX().equals( p17_S ) ) {
8211                 return false;
8212             }
8213             final String p18_S = "((A,B),(C,D))";
8214             final Phylogeny[] p18 = factory.create( p18_S, new NHXParser() );
8215             if ( p18.length != 1 ) {
8216                 return false;
8217             }
8218             if ( !p18[ 0 ].toNewHampshireX().equals( p18_S ) ) {
8219                 return false;
8220             }
8221             final String p19_S = "(((A,B),C),D)";
8222             final Phylogeny[] p19 = factory.create( p19_S, new NHXParser() );
8223             if ( p19.length != 1 ) {
8224                 return false;
8225             }
8226             if ( !p19[ 0 ].toNewHampshireX().equals( p19_S ) ) {
8227                 return false;
8228             }
8229             final String p20_S = "(A,(B,(C,D)))";
8230             final Phylogeny[] p20 = factory.create( p20_S, new NHXParser() );
8231             if ( p20.length != 1 ) {
8232                 return false;
8233             }
8234             if ( !p20[ 0 ].toNewHampshireX().equals( p20_S ) ) {
8235                 return false;
8236             }
8237             final String p21_S = "(A,(B,(C,(D,E))))";
8238             final Phylogeny[] p21 = factory.create( p21_S, new NHXParser() );
8239             if ( p21.length != 1 ) {
8240                 return false;
8241             }
8242             if ( !p21[ 0 ].toNewHampshireX().equals( p21_S ) ) {
8243                 return false;
8244             }
8245             final String p22_S = "((((A,B),C),D),E)";
8246             final Phylogeny[] p22 = factory.create( p22_S, new NHXParser() );
8247             if ( p22.length != 1 ) {
8248                 return false;
8249             }
8250             if ( !p22[ 0 ].toNewHampshireX().equals( p22_S ) ) {
8251                 return false;
8252             }
8253             final String p23_S = "(A,(B,(C,(D,E)de)cde)bcde)abcde";
8254             final Phylogeny[] p23 = factory.create( p23_S, new NHXParser() );
8255             if ( p23.length != 1 ) {
8256                 System.out.println( "xl=" + p23.length );
8257                 System.exit( -1 );
8258                 return false;
8259             }
8260             if ( !p23[ 0 ].toNewHampshireX().equals( p23_S ) ) {
8261                 return false;
8262             }
8263             final String p24_S = "((((A,B)ab,C)abc,D)abcd,E)abcde";
8264             final Phylogeny[] p24 = factory.create( p24_S, new NHXParser() );
8265             if ( p24.length != 1 ) {
8266                 return false;
8267             }
8268             if ( !p24[ 0 ].toNewHampshireX().equals( p24_S ) ) {
8269                 return false;
8270             }
8271             final String p241_S1 = "(A,(B,(C,(D,E)de)cde)bcde)abcde";
8272             final String p241_S2 = "((((A,B)ab,C)abc,D)abcd,E)abcde";
8273             final Phylogeny[] p241 = factory.create( p241_S1 + p241_S2, new NHXParser() );
8274             if ( p241.length != 2 ) {
8275                 return false;
8276             }
8277             if ( !p241[ 0 ].toNewHampshireX().equals( p241_S1 ) ) {
8278                 return false;
8279             }
8280             if ( !p241[ 1 ].toNewHampshireX().equals( p241_S2 ) ) {
8281                 return false;
8282             }
8283             final String p25_S = "((((((((((((((A,B)ab,C)abc,D)abcd,E)"
8284                     + "abcde,(B,(C,(D,E)de)cde)bcde)abcde,(B,((A,(B,(C,(D,"
8285                     + "E)de)cde)bcde)abcde,(D,E)de)cde)bcde)abcde,B)ab,C)"
8286                     + "abc,((((A,B)ab,C)abc,D)abcd,E)abcde)abcd,E)abcde,"
8287                     + "((((A,((((((((A,B)ab,C)abc,((((A,B)ab,C)abc,D)abcd,"
8288                     + "E)abcde)abcd,E)abcde,((((A,B)ab,C)abc,D)abcd,E)abcde)"
8289                     + "ab,C)abc,((((A,B)ab,C)abc,D)abcd,E)abcde)abcd,E)abcde"
8290                     + ")ab,C)abc,D)abcd,E)abcde)ab,C)abc,((((A,B)ab,C)abc,D)" + "abcd,E)abcde)abcd,E)abcde";
8291             final Phylogeny[] p25 = factory.create( p25_S, new NHXParser() );
8292             if ( !p25[ 0 ].toNewHampshireX().equals( p25_S ) ) {
8293                 return false;
8294             }
8295             final String p26_S = "(A,B)ab";
8296             final Phylogeny[] p26 = factory.create( p26_S, new NHXParser() );
8297             if ( !p26[ 0 ].toNewHampshireX().equals( p26_S ) ) {
8298                 return false;
8299             }
8300             final String p27_S = "((((A,B)ab,C)abc,D)abcd,E)abcde";
8301             final Phylogeny[] p27s = factory.create( p27_S, new NHXParser() );
8302             if ( p27s.length != 1 ) {
8303                 System.out.println( "xxl=" + p27s.length );
8304                 System.exit( -1 );
8305                 return false;
8306             }
8307             if ( !p27s[ 0 ].toNewHampshireX().equals( p27_S ) ) {
8308                 System.out.println( p27s[ 0 ].toNewHampshireX() );
8309                 System.exit( -1 );
8310                 return false;
8311             }
8312             final Phylogeny[] p27 = factory.create( new File( Test.PATH_TO_TEST_DATA + "phylogeny27.nhx" ),
8313                                                     new NHXParser() );
8314             if ( p27.length != 1 ) {
8315                 System.out.println( "yl=" + p27.length );
8316                 System.exit( -1 );
8317                 return false;
8318             }
8319             if ( !p27[ 0 ].toNewHampshireX().equals( p27_S ) ) {
8320                 System.out.println( p27[ 0 ].toNewHampshireX() );
8321                 System.exit( -1 );
8322                 return false;
8323             }
8324             final String p28_S1 = "((((A,B)ab,C)abc,D)abcd,E)abcde";
8325             final String p28_S2 = "(A,(B,(C,(D,E)de)cde)bcde)abcde";
8326             final String p28_S3 = "(A,B)ab";
8327             final String p28_S4 = "((((A,B),C),D),;E;)";
8328             final Phylogeny[] p28 = factory.create( new File( Test.PATH_TO_TEST_DATA + "phylogeny28.nhx" ),
8329                                                     new NHXParser() );
8330             if ( !p28[ 0 ].toNewHampshireX().equals( p28_S1 ) ) {
8331                 return false;
8332             }
8333             if ( !p28[ 1 ].toNewHampshireX().equals( p28_S2 ) ) {
8334                 return false;
8335             }
8336             if ( !p28[ 2 ].toNewHampshireX().equals( p28_S3 ) ) {
8337                 return false;
8338             }
8339             if ( !p28[ 3 ].toNewHampshireX().equals( "((((A,B),C),D),';E;')" ) ) {
8340                 return false;
8341             }
8342             if ( p28.length != 4 ) {
8343                 return false;
8344             }
8345             final String p29_S = "((((A:0.01,B:0.684)ab:0.345,C:0.3451)abc:0.3451,D:1.5)abcd:0.134,E:0.32)abcde:0.1345";
8346             final Phylogeny[] p29 = factory.create( p29_S, new NHXParser() );
8347             if ( !p29[ 0 ].toNewHampshireX().equals( p29_S ) ) {
8348                 return false;
8349             }
8350             final String p30_S = "((((A:0.01,B:0.02):0.93,C:0.04):0.05,D:1.4):0.06,E):0.72";
8351             final Phylogeny[] p30 = factory.create( p30_S, new NHXParser() );
8352             if ( !p30[ 0 ].toNewHampshireX().equals( p30_S ) ) {
8353                 return false;
8354             }
8355             final String p32_S = " ;   ;        \n  \t  \b   \f  \r  ;;;;;; ";
8356             final Phylogeny[] p32 = factory.create( p32_S, new NHXParser() );
8357             if ( ( p32.length != 0 ) ) {
8358                 return false;
8359             }
8360             final String p33_S = "A";
8361             final Phylogeny[] p33 = factory.create( p33_S, new NHXParser() );
8362             if ( !p33[ 0 ].toNewHampshireX().equals( p33_S ) ) {
8363                 return false;
8364             }
8365             final String p34_S = "B;";
8366             final Phylogeny[] p34 = factory.create( p34_S, new NHXParser() );
8367             if ( !p34[ 0 ].toNewHampshireX().equals( "B" ) ) {
8368                 return false;
8369             }
8370             final String p35_S = "B:0.2";
8371             final Phylogeny[] p35 = factory.create( p35_S, new NHXParser() );
8372             if ( !p35[ 0 ].toNewHampshireX().equals( p35_S ) ) {
8373                 return false;
8374             }
8375             final String p36_S = "(A)";
8376             final Phylogeny[] p36 = factory.create( p36_S, new NHXParser() );
8377             if ( !p36[ 0 ].toNewHampshireX().equals( p36_S ) ) {
8378                 return false;
8379             }
8380             final String p37_S = "((A))";
8381             final Phylogeny[] p37 = factory.create( p37_S, new NHXParser() );
8382             if ( !p37[ 0 ].toNewHampshireX().equals( p37_S ) ) {
8383                 return false;
8384             }
8385             final String p38_S = "(((((((A:0.2):0.2):0.3):0.4):0.5):0.6):0.7):0.8";
8386             final Phylogeny[] p38 = factory.create( p38_S, new NHXParser() );
8387             if ( !p38[ 0 ].toNewHampshireX().equals( p38_S ) ) {
8388                 return false;
8389             }
8390             final String p39_S = "(((B,((((A:0.2):0.2):0.3):0.4):0.5):0.6):0.7):0.8";
8391             final Phylogeny[] p39 = factory.create( p39_S, new NHXParser() );
8392             if ( !p39[ 0 ].toNewHampshireX().equals( p39_S ) ) {
8393                 return false;
8394             }
8395             final String p40_S = "(A,B,C)";
8396             final Phylogeny[] p40 = factory.create( p40_S, new NHXParser() );
8397             if ( !p40[ 0 ].toNewHampshireX().equals( p40_S ) ) {
8398                 return false;
8399             }
8400             final String p41_S = "(A,B,C,D,E,F,G,H,I,J,K)";
8401             final Phylogeny[] p41 = factory.create( p41_S, new NHXParser() );
8402             if ( !p41[ 0 ].toNewHampshireX().equals( p41_S ) ) {
8403                 return false;
8404             }
8405             final String p42_S = "(A,B,(X,Y,Z),D,E,F,G,H,I,J,K)";
8406             final Phylogeny[] p42 = factory.create( p42_S, new NHXParser() );
8407             if ( !p42[ 0 ].toNewHampshireX().equals( p42_S ) ) {
8408                 return false;
8409             }
8410             final String p43_S = "(A,B,C,(AA,BB,CC,(CCC,DDD,EEE,(FFFF,GGGG)x)y,DD,EE,FF,GG,HH),D,E,(EE,FF),F,G,H,(((((5)4)3)2)1),I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,(XX,(YY)),Y,Z)";
8411             final Phylogeny[] p43 = factory.create( p43_S, new NHXParser() );
8412             if ( !p43[ 0 ].toNewHampshireX().equals( p43_S ) ) {
8413                 return false;
8414             }
8415             final String p44_S = "(((A,B,C,D),(A,B,C,D),(A,B,C,D),(A,B,C,D)),((A,B,C,D),(A,B,C,D),(A,B,C,D),(A,B,C,D)),((A,B,C,D),(A,B,C,D),(A,B,C,D),(A,B,C,D)),((A,B,C,D),(A,B,C,D),(A,B,C,D),(A,B,C,D)))";
8416             final Phylogeny[] p44 = factory.create( p44_S, new NHXParser() );
8417             if ( !p44[ 0 ].toNewHampshireX().equals( p44_S ) ) {
8418                 return false;
8419             }
8420             final String p45_S = "((((((((((A))))))))),(((((((((B))))))))),(((((((((C))))))))))";
8421             final Phylogeny[] p45 = factory.create( p45_S, new NHXParser() );
8422             if ( !p45[ 0 ].toNewHampshireX().equals( p45_S ) ) {
8423                 return false;
8424             }
8425             final String p46_S = "";
8426             final Phylogeny[] p46 = factory.create( p46_S, new NHXParser() );
8427             if ( p46.length != 0 ) {
8428                 return false;
8429             }
8430             final Phylogeny p47 = factory.create( new StringBuffer( "((A,B)ab:2[0.44],C)" ), new NHXParser() )[ 0 ];
8431             if ( !isEqual( 0.44, p47.getNode( "ab" ).getBranchData().getConfidence( 0 ).getValue() ) ) {
8432                 return false;
8433             }
8434             final Phylogeny p48 = factory.create( new StringBuffer( "((A,B)ab:2[88],C)" ), new NHXParser() )[ 0 ];
8435             if ( !isEqual( 88, p48.getNode( "ab" ).getBranchData().getConfidence( 0 ).getValue() ) ) {
8436                 return false;
8437             }
8438             final Phylogeny p49 = factory
8439                     .create( new StringBuffer( "((A,B)a[comment:a,b;(a)]b:2[0.44][comment(a,b,b);],C)" ),
8440                              new NHXParser() )[ 0 ];
8441             if ( !isEqual( 0.44, p49.getNode( "ab" ).getBranchData().getConfidence( 0 ).getValue() ) ) {
8442                 return false;
8443             }
8444             final Phylogeny p50 = factory.create( new StringBuffer( "((\"A\",B)ab:2[88],C)" ), new NHXParser() )[ 0 ];
8445             if ( p50.getNode( "A" ) == null ) {
8446                 return false;
8447             }
8448             if ( !p50.toNewHampshire( NH_CONVERSION_SUPPORT_VALUE_STYLE.IN_SQUARE_BRACKETS )
8449                     .equals( "((A,B)ab:2.0[88],C);" ) ) {
8450                 return false;
8451             }
8452             if ( !p50.toNewHampshire( NH_CONVERSION_SUPPORT_VALUE_STYLE.NONE ).equals( "((A,B)ab:2.0,C);" ) ) {
8453                 return false;
8454             }
8455             if ( !p50.toNewHampshire( NH_CONVERSION_SUPPORT_VALUE_STYLE.AS_INTERNAL_NODE_NAMES )
8456                     .equals( "((A,B)88:2.0,C);" ) ) {
8457                 return false;
8458             }
8459             final Phylogeny p51 = factory.create( new StringBuffer( "((\"A(A\",B)ab:2[88],C)" ), new NHXParser() )[ 0 ];
8460             if ( p51.getNode( "A(A" ) == null ) {
8461                 return false;
8462             }
8463             final Phylogeny p52 = factory.create( new StringBuffer( "(('A(A',B)ab:2[88],C)" ), new NHXParser() )[ 0 ];
8464             if ( p52.getNode( "A(A" ) == null ) {
8465                 return false;
8466             }
8467             final Phylogeny p53 = factory
8468                     .create( new StringBuffer( "(('A(A',\"B (x (a' ,b) f(x);\"[com])[ment]ab:2[88],C)" ),
8469                              new NHXParser() )[ 0 ];
8470             if ( p53.getNode( "B (x (a' ,b) f(x);" ) == null ) {
8471                 return false;
8472             }
8473             final Phylogeny p54 = factory.create( new StringBuffer( "((A,B):[88],C)" ), new NHXParser() )[ 0 ];
8474             if ( p54.getNode( "A" ) == null ) {
8475                 return false;
8476             }
8477             if ( !p54.toNewHampshire( NH_CONVERSION_SUPPORT_VALUE_STYLE.IN_SQUARE_BRACKETS ).equals( "((A,B)[88],C);" ) ) {
8478                 return false;
8479             }
8480             final Phylogeny p55 = factory
8481                     .create( new StringBuffer( "((\"lcl|HPV32_L1.:1  s\":0.195593,\"lcl|HPV30_L1.1|;a\":0.114237):0.0359322,\"lcl|HPV56_L1.1|,d\":0.0727412,\"lcl|HPV66_L1.1x\":0.0798012);" ),
8482                              new NHXParser() )[ 0 ];
8483             if ( !p55
8484                     .toNewHampshire()
8485                     .equals( "(('lcl|HPV32_L1.:1 s':0.195593,'lcl|HPV30_L1.1|;a':0.114237):0.0359322,'lcl|HPV56_L1.1|,d':0.0727412,lcl|HPV66_L1.1x:0.0798012);" ) ) {
8486                 System.out.println( p55.toNewHampshire() );
8487                 return false;
8488             }
8489             final Phylogeny p56 = factory
8490                     .create( new StringBuffer( "((\"lcl|HPV32_L1.:1      s\":0.195593,\"lcl|HPV30_L1.1|;a\":0.114\n237):0.0359322,\"lcl|HPV56_L1.1|,d\":0.0727412,\"lcl|HPV66_L1.1:x\":0.0798012);" ),
8491                              new NHXParser() )[ 0 ];
8492             if ( !p56
8493                     .toNewHampshire()
8494                     .equals( "(('lcl|HPV32_L1.:1 s':0.195593,'lcl|HPV30_L1.1|;a':0.114237):0.0359322,'lcl|HPV56_L1.1|,d':0.0727412,'lcl|HPV66_L1.1:x':0.0798012);" ) ) {
8495                 System.out.println( p56.toNewHampshire() );
8496                 return false;
8497             }
8498             final Phylogeny p57 = factory
8499                     .create( new StringBuffer( "((\"lcl|HPV32_L1.:1      s\":0.195593,\"lcl|HPV30_L1.1|;a\":0.114\n237):0.0359322,\"lcl|HPV56_L1.1|,d\":0.0727412,\"lcl|HPV66_L1.1:x\":0.0798012);" ),
8500                              new NHXParser() )[ 0 ];
8501             if ( !p57
8502                     .toNewHampshire()
8503                     .equals( "(('lcl|HPV32_L1.:1 s':0.195593,'lcl|HPV30_L1.1|;a':0.114237):0.0359322,'lcl|HPV56_L1.1|,d':0.0727412,'lcl|HPV66_L1.1:x':0.0798012);" ) ) {
8504                 System.out.println( p56.toNewHampshire() );
8505                 return false;
8506             }
8507             final String s58 = "('Homo \"man\" sapiens:1',\"Homo 'man' sapiens;\")';root \"1_ )';";
8508             final Phylogeny p58 = factory.create( new StringBuffer( s58 ), new NHXParser() )[ 0 ];
8509             if ( !p58.toNewHampshire().equals( s58 ) ) {
8510                 System.out.println( p58.toNewHampshire() );
8511                 return false;
8512             }
8513             final String s59 = "('Homo \"man sapiens:1',\"Homo 'man sapiens\")\"root; '1_ )\";";
8514             final Phylogeny p59 = factory.create( new StringBuffer( s59 ), new NHXParser() )[ 0 ];
8515             if ( !p59.toNewHampshire().equals( s59 ) ) {
8516                 System.out.println( p59.toNewHampshire() );
8517                 return false;
8518             }
8519             final String s60 = "('\" ;,:\":\"',\"'abc def' g's_\",'=:0.45+,.:%~`!@#$%^&*()_-+={} | ;,');";
8520             final Phylogeny p60 = factory.create( new StringBuffer( s60 ), new NHXParser() )[ 0 ];
8521             if ( !p60.toNewHampshire().equals( s60 ) ) {
8522                 System.out.println( p60.toNewHampshire() );
8523                 return false;
8524             }
8525             final String s61 = "('H[omo] \"man\" sapiens:1',\"H[omo] 'man' sapiens;\",H[omo] sapiens)';root \"1_ )';";
8526             final Phylogeny p61 = factory.create( new StringBuffer( s61 ), new NHXParser() )[ 0 ];
8527             if ( !p61.toNewHampshire()
8528                     .equals( "('H{omo} \"man\" sapiens:1',\"H{omo} 'man' sapiens;\",Hsapiens)';root \"1_ )';" ) ) {
8529                 System.out.println( p61.toNewHampshire() );
8530                 return false;
8531             }
8532         }
8533         catch ( final Exception e ) {
8534             e.printStackTrace( System.out );
8535             return false;
8536         }
8537         return true;
8538     }
8539
8540     private static boolean testNHParsingIter() {
8541         try {
8542             final String p0_str = "(A,B);";
8543             final NHXParser p = new NHXParser();
8544             p.setSource( p0_str );
8545             if ( !p.hasNext() ) {
8546                 return false;
8547             }
8548             final Phylogeny p0 = p.next();
8549             if ( !p0.toNewHampshire().equals( p0_str ) ) {
8550                 System.out.println( p0.toNewHampshire() );
8551                 return false;
8552             }
8553             if ( p.hasNext() ) {
8554                 return false;
8555             }
8556             if ( p.next() != null ) {
8557                 return false;
8558             }
8559             //
8560             final String p00_str = "(A,B)root;";
8561             p.setSource( p00_str );
8562             final Phylogeny p00 = p.next();
8563             if ( !p00.toNewHampshire().equals( p00_str ) ) {
8564                 System.out.println( p00.toNewHampshire() );
8565                 return false;
8566             }
8567             //
8568             final String p000_str = "A;";
8569             p.setSource( p000_str );
8570             final Phylogeny p000 = p.next();
8571             if ( !p000.toNewHampshire().equals( p000_str ) ) {
8572                 System.out.println( p000.toNewHampshire() );
8573                 return false;
8574             }
8575             //
8576             final String p0000_str = "A";
8577             p.setSource( p0000_str );
8578             final Phylogeny p0000 = p.next();
8579             if ( !p0000.toNewHampshire().equals( "A;" ) ) {
8580                 System.out.println( p0000.toNewHampshire() );
8581                 return false;
8582             }
8583             //
8584             p.setSource( "(A)" );
8585             final Phylogeny p00000 = p.next();
8586             if ( !p00000.toNewHampshire().equals( "(A);" ) ) {
8587                 System.out.println( p00000.toNewHampshire() );
8588                 return false;
8589             }
8590             //
8591             final String p1_str = "(A,B)(C,D)(E,F)(G,H)";
8592             p.setSource( p1_str );
8593             if ( !p.hasNext() ) {
8594                 return false;
8595             }
8596             final Phylogeny p1_0 = p.next();
8597             if ( !p1_0.toNewHampshire().equals( "(A,B);" ) ) {
8598                 System.out.println( p1_0.toNewHampshire() );
8599                 return false;
8600             }
8601             if ( !p.hasNext() ) {
8602                 return false;
8603             }
8604             final Phylogeny p1_1 = p.next();
8605             if ( !p1_1.toNewHampshire().equals( "(C,D);" ) ) {
8606                 System.out.println( "(C,D) != " + p1_1.toNewHampshire() );
8607                 return false;
8608             }
8609             if ( !p.hasNext() ) {
8610                 return false;
8611             }
8612             final Phylogeny p1_2 = p.next();
8613             if ( !p1_2.toNewHampshire().equals( "(E,F);" ) ) {
8614                 System.out.println( "(E,F) != " + p1_2.toNewHampshire() );
8615                 return false;
8616             }
8617             if ( !p.hasNext() ) {
8618                 return false;
8619             }
8620             final Phylogeny p1_3 = p.next();
8621             if ( !p1_3.toNewHampshire().equals( "(G,H);" ) ) {
8622                 System.out.println( "(G,H) != " + p1_3.toNewHampshire() );
8623                 return false;
8624             }
8625             if ( p.hasNext() ) {
8626                 return false;
8627             }
8628             if ( p.next() != null ) {
8629                 return false;
8630             }
8631             //
8632             final String p2_str = "((1,2,3),B);(C,D) (E,F)root;(G,H); ;(X)";
8633             p.setSource( p2_str );
8634             if ( !p.hasNext() ) {
8635                 return false;
8636             }
8637             Phylogeny p2_0 = p.next();
8638             if ( !p2_0.toNewHampshire().equals( "((1,2,3),B);" ) ) {
8639                 System.out.println( p2_0.toNewHampshire() );
8640                 return false;
8641             }
8642             if ( !p.hasNext() ) {
8643                 return false;
8644             }
8645             Phylogeny p2_1 = p.next();
8646             if ( !p2_1.toNewHampshire().equals( "(C,D);" ) ) {
8647                 System.out.println( "(C,D) != " + p2_1.toNewHampshire() );
8648                 return false;
8649             }
8650             if ( !p.hasNext() ) {
8651                 return false;
8652             }
8653             Phylogeny p2_2 = p.next();
8654             if ( !p2_2.toNewHampshire().equals( "(E,F)root;" ) ) {
8655                 System.out.println( "(E,F)root != " + p2_2.toNewHampshire() );
8656                 return false;
8657             }
8658             if ( !p.hasNext() ) {
8659                 return false;
8660             }
8661             Phylogeny p2_3 = p.next();
8662             if ( !p2_3.toNewHampshire().equals( "(G,H);" ) ) {
8663                 System.out.println( "(G,H) != " + p2_3.toNewHampshire() );
8664                 return false;
8665             }
8666             if ( !p.hasNext() ) {
8667                 return false;
8668             }
8669             Phylogeny p2_4 = p.next();
8670             if ( !p2_4.toNewHampshire().equals( "(X);" ) ) {
8671                 System.out.println( "(X) != " + p2_4.toNewHampshire() );
8672                 return false;
8673             }
8674             if ( p.hasNext() ) {
8675                 return false;
8676             }
8677             if ( p.next() != null ) {
8678                 return false;
8679             }
8680             ////
8681             p.reset();
8682             if ( !p.hasNext() ) {
8683                 return false;
8684             }
8685             p2_0 = p.next();
8686             if ( !p2_0.toNewHampshire().equals( "((1,2,3),B);" ) ) {
8687                 System.out.println( p2_0.toNewHampshire() );
8688                 return false;
8689             }
8690             if ( !p.hasNext() ) {
8691                 return false;
8692             }
8693             p2_1 = p.next();
8694             if ( !p2_1.toNewHampshire().equals( "(C,D);" ) ) {
8695                 System.out.println( "(C,D) != " + p2_1.toNewHampshire() );
8696                 return false;
8697             }
8698             if ( !p.hasNext() ) {
8699                 return false;
8700             }
8701             p2_2 = p.next();
8702             if ( !p2_2.toNewHampshire().equals( "(E,F)root;" ) ) {
8703                 System.out.println( "(E,F)root != " + p2_2.toNewHampshire() );
8704                 return false;
8705             }
8706             if ( !p.hasNext() ) {
8707                 return false;
8708             }
8709             p2_3 = p.next();
8710             if ( !p2_3.toNewHampshire().equals( "(G,H);" ) ) {
8711                 System.out.println( "(G,H) != " + p2_3.toNewHampshire() );
8712                 return false;
8713             }
8714             if ( !p.hasNext() ) {
8715                 return false;
8716             }
8717             p2_4 = p.next();
8718             if ( !p2_4.toNewHampshire().equals( "(X);" ) ) {
8719                 System.out.println( "(X) != " + p2_4.toNewHampshire() );
8720                 return false;
8721             }
8722             if ( p.hasNext() ) {
8723                 return false;
8724             }
8725             if ( p.next() != null ) {
8726                 return false;
8727             }
8728             //
8729             final String p3_str = "((A,B),C)abc";
8730             p.setSource( p3_str );
8731             if ( !p.hasNext() ) {
8732                 return false;
8733             }
8734             final Phylogeny p3_0 = p.next();
8735             if ( !p3_0.toNewHampshire().equals( "((A,B),C)abc;" ) ) {
8736                 return false;
8737             }
8738             if ( p.hasNext() ) {
8739                 return false;
8740             }
8741             if ( p.next() != null ) {
8742                 return false;
8743             }
8744             //
8745             final String p4_str = "((A,B)ab,C)abc";
8746             p.setSource( p4_str );
8747             if ( !p.hasNext() ) {
8748                 return false;
8749             }
8750             final Phylogeny p4_0 = p.next();
8751             if ( !p4_0.toNewHampshire().equals( "((A,B)ab,C)abc;" ) ) {
8752                 return false;
8753             }
8754             if ( p.hasNext() ) {
8755                 return false;
8756             }
8757             if ( p.next() != null ) {
8758                 return false;
8759             }
8760             //
8761             final String p5_str = "(((A,B)ab,C)abc,D)abcd";
8762             p.setSource( p5_str );
8763             if ( !p.hasNext() ) {
8764                 return false;
8765             }
8766             final Phylogeny p5_0 = p.next();
8767             if ( !p5_0.toNewHampshire().equals( "(((A,B)ab,C)abc,D)abcd;" ) ) {
8768                 return false;
8769             }
8770             if ( p.hasNext() ) {
8771                 return false;
8772             }
8773             if ( p.next() != null ) {
8774                 return false;
8775             }
8776             //
8777             final String p6_str = "(A,(B,(C,(D,E)de)cde)bcde)abcde";
8778             p.setSource( p6_str );
8779             if ( !p.hasNext() ) {
8780                 return false;
8781             }
8782             Phylogeny p6_0 = p.next();
8783             if ( !p6_0.toNewHampshire().equals( "(A,(B,(C,(D,E)de)cde)bcde)abcde;" ) ) {
8784                 return false;
8785             }
8786             if ( p.hasNext() ) {
8787                 return false;
8788             }
8789             if ( p.next() != null ) {
8790                 return false;
8791             }
8792             p.reset();
8793             if ( !p.hasNext() ) {
8794                 return false;
8795             }
8796             p6_0 = p.next();
8797             if ( !p6_0.toNewHampshire().equals( "(A,(B,(C,(D,E)de)cde)bcde)abcde;" ) ) {
8798                 return false;
8799             }
8800             if ( p.hasNext() ) {
8801                 return false;
8802             }
8803             if ( p.next() != null ) {
8804                 return false;
8805             }
8806             //
8807             final String p7_str = "((((A,B)ab,C)abc,D)abcd,E)abcde";
8808             p.setSource( p7_str );
8809             if ( !p.hasNext() ) {
8810                 return false;
8811             }
8812             Phylogeny p7_0 = p.next();
8813             if ( !p7_0.toNewHampshire().equals( "((((A,B)ab,C)abc,D)abcd,E)abcde;" ) ) {
8814                 return false;
8815             }
8816             if ( p.hasNext() ) {
8817                 return false;
8818             }
8819             if ( p.next() != null ) {
8820                 return false;
8821             }
8822             p.reset();
8823             if ( !p.hasNext() ) {
8824                 return false;
8825             }
8826             p7_0 = p.next();
8827             if ( !p7_0.toNewHampshire().equals( "((((A,B)ab,C)abc,D)abcd,E)abcde;" ) ) {
8828                 return false;
8829             }
8830             if ( p.hasNext() ) {
8831                 return false;
8832             }
8833             if ( p.next() != null ) {
8834                 return false;
8835             }
8836             //
8837             final String p8_str = "((((A,B)ab,C)abc,D)abcd,E)abcde ((((a,b)ab,c)abc,d)abcd,e)abcde";
8838             p.setSource( p8_str );
8839             if ( !p.hasNext() ) {
8840                 return false;
8841             }
8842             Phylogeny p8_0 = p.next();
8843             if ( !p8_0.toNewHampshire().equals( "((((A,B)ab,C)abc,D)abcd,E)abcde;" ) ) {
8844                 return false;
8845             }
8846             if ( !p.hasNext() ) {
8847                 return false;
8848             }
8849             if ( !p.hasNext() ) {
8850                 return false;
8851             }
8852             Phylogeny p8_1 = p.next();
8853             if ( !p8_1.toNewHampshire().equals( "((((a,b)ab,c)abc,d)abcd,e)abcde;" ) ) {
8854                 return false;
8855             }
8856             if ( p.hasNext() ) {
8857                 return false;
8858             }
8859             if ( p.next() != null ) {
8860                 return false;
8861             }
8862             p.reset();
8863             if ( !p.hasNext() ) {
8864                 return false;
8865             }
8866             p8_0 = p.next();
8867             if ( !p8_0.toNewHampshire().equals( "((((A,B)ab,C)abc,D)abcd,E)abcde;" ) ) {
8868                 return false;
8869             }
8870             if ( !p.hasNext() ) {
8871                 return false;
8872             }
8873             p8_1 = p.next();
8874             if ( !p8_1.toNewHampshire().equals( "((((a,b)ab,c)abc,d)abcd,e)abcde;" ) ) {
8875                 return false;
8876             }
8877             if ( p.hasNext() ) {
8878                 return false;
8879             }
8880             if ( p.next() != null ) {
8881                 return false;
8882             }
8883             p.reset();
8884             //
8885             p.setSource( "" );
8886             if ( p.hasNext() ) {
8887                 return false;
8888             }
8889             //
8890             p.setSource( new File( Test.PATH_TO_TEST_DATA + "phylogeny27.nhx" ) );
8891             if ( !p.hasNext() ) {
8892                 return false;
8893             }
8894             Phylogeny p_27 = p.next();
8895             if ( !p_27.toNewHampshireX().equals( "((((A,B)ab,C)abc,D)abcd,E)abcde" ) ) {
8896                 System.out.println( p_27.toNewHampshireX() );
8897                 System.exit( -1 );
8898                 return false;
8899             }
8900             if ( p.hasNext() ) {
8901                 return false;
8902             }
8903             if ( p.next() != null ) {
8904                 return false;
8905             }
8906             p.reset();
8907             if ( !p.hasNext() ) {
8908                 return false;
8909             }
8910             p_27 = p.next();
8911             if ( !p_27.toNewHampshireX().equals( "((((A,B)ab,C)abc,D)abcd,E)abcde" ) ) {
8912                 System.out.println( p_27.toNewHampshireX() );
8913                 System.exit( -1 );
8914                 return false;
8915             }
8916             if ( p.hasNext() ) {
8917                 return false;
8918             }
8919             if ( p.next() != null ) {
8920                 return false;
8921             }
8922             //
8923             final String p30_str = "(A,B);(C,D)";
8924             final NHXParser p30 = new NHXParser();
8925             p30.setSource( p30_str );
8926             if ( !p30.hasNext() ) {
8927                 return false;
8928             }
8929             Phylogeny phy30 = p30.next();
8930             if ( !phy30.toNewHampshire().equals( "(A,B);" ) ) {
8931                 System.out.println( phy30.toNewHampshire() );
8932                 return false;
8933             }
8934             if ( !p30.hasNext() ) {
8935                 return false;
8936             }
8937             Phylogeny phy301 = p30.next();
8938             if ( !phy301.toNewHampshire().equals( "(C,D);" ) ) {
8939                 System.out.println( phy301.toNewHampshire() );
8940                 return false;
8941             }
8942             if ( p30.hasNext() ) {
8943                 return false;
8944             }
8945             if ( p30.hasNext() ) {
8946                 return false;
8947             }
8948             if ( p30.next() != null ) {
8949                 return false;
8950             }
8951             if ( p30.next() != null ) {
8952                 return false;
8953             }
8954             p30.reset();
8955             if ( !p30.hasNext() ) {
8956                 return false;
8957             }
8958             phy30 = p30.next();
8959             if ( !phy30.toNewHampshire().equals( "(A,B);" ) ) {
8960                 System.out.println( phy30.toNewHampshire() );
8961                 return false;
8962             }
8963             if ( !p30.hasNext() ) {
8964                 return false;
8965             }
8966             phy301 = p30.next();
8967             if ( !phy301.toNewHampshire().equals( "(C,D);" ) ) {
8968                 System.out.println( phy301.toNewHampshire() );
8969                 return false;
8970             }
8971             if ( p30.hasNext() ) {
8972                 return false;
8973             }
8974             if ( p30.hasNext() ) {
8975                 return false;
8976             }
8977             if ( p30.next() != null ) {
8978                 return false;
8979             }
8980             if ( p30.next() != null ) {
8981                 return false;
8982             }
8983         }
8984         catch ( final Exception e ) {
8985             e.printStackTrace( System.out );
8986             return false;
8987         }
8988         return true;
8989     }
8990
8991     private static boolean testNHXconversion() {
8992         try {
8993             final PhylogenyNode n1 = new PhylogenyNode();
8994             final PhylogenyNode n2 = PhylogenyNode.createInstanceFromNhxString( "" );
8995             final PhylogenyNode n3 = PhylogenyNode.createInstanceFromNhxString( "n3" );
8996             final PhylogenyNode n4 = PhylogenyNode.createInstanceFromNhxString( "n4:0.01" );
8997             final PhylogenyNode n5 = PhylogenyNode
8998                     .createInstanceFromNhxString( "n5:0.1[&&NHX:S=Ecoli:E=1.1.1.1:D=Y:Co=Y:B=56:T=1]" );
8999             final PhylogenyNode n6 = PhylogenyNode
9000                     .createInstanceFromNhxString( "n6:0.000001[&&NHX:S=Ecoli:E=1.1.1.1:D=N:Co=N:B=100:T=1]" );
9001             if ( !n1.toNewHampshireX().equals( "" ) ) {
9002                 return false;
9003             }
9004             if ( !n2.toNewHampshireX().equals( "" ) ) {
9005                 return false;
9006             }
9007             if ( !n3.toNewHampshireX().equals( "n3" ) ) {
9008                 return false;
9009             }
9010             if ( !n4.toNewHampshireX().equals( "n4:0.01" ) ) {
9011                 return false;
9012             }
9013             if ( !n5.toNewHampshireX().equals( "n5:0.1[&&NHX:T=1:S=Ecoli:D=Y:B=56]" ) ) {
9014                 return false;
9015             }
9016             if ( !n6.toNewHampshireX().equals( "n6:1.0E-6[&&NHX:T=1:S=Ecoli:D=N:B=100]" ) ) {
9017                 System.out.println( n6.toNewHampshireX() );
9018                 return false;
9019             }
9020             final PhylogenyNode n7 = new PhylogenyNode();
9021             n7.setName( "   gks:dr-m4 \"    '    `@:[]sadq04 " );
9022             if ( !n7.toNewHampshire( true, PhylogenyNode.NH_CONVERSION_SUPPORT_VALUE_STYLE.IN_SQUARE_BRACKETS )
9023                     .equals( "'gks:dr-m4 \" ` `@:[]sadq04'" ) ) {
9024                 System.out.println( n7
9025                                     .toNewHampshire( true, PhylogenyNode.NH_CONVERSION_SUPPORT_VALUE_STYLE.IN_SQUARE_BRACKETS ) );
9026                 return false;
9027             }
9028         }
9029         catch ( final Exception e ) {
9030             e.printStackTrace( System.out );
9031             return false;
9032         }
9033         return true;
9034     }
9035
9036     private static boolean testNHXNodeParsing() {
9037         try {
9038             final PhylogenyNode n1 = new PhylogenyNode();
9039             final PhylogenyNode n2 = PhylogenyNode.createInstanceFromNhxString( "" );
9040             final PhylogenyNode n3 = PhylogenyNode.createInstanceFromNhxString( "n3" );
9041             final PhylogenyNode n4 = PhylogenyNode.createInstanceFromNhxString( "n4:0.01" );
9042             final PhylogenyNode n5 = PhylogenyNode
9043                     .createInstanceFromNhxString( "n5:0.1[&&NHX:S=Ecoli:E=1.1.1.1:D=Y:B=56:T=1:On=22:SOn=33:SNn=44:W=2:C=10.20.30:XN=S=tag1=value1=unit1:XN=S=tag3=value3=unit3]" );
9044             if ( !n3.getName().equals( "n3" ) ) {
9045                 return false;
9046             }
9047             if ( n3.getDistanceToParent() != PhylogenyDataUtil.BRANCH_LENGTH_DEFAULT ) {
9048                 return false;
9049             }
9050             if ( n3.isDuplication() ) {
9051                 return false;
9052             }
9053             if ( n3.isHasAssignedEvent() ) {
9054                 return false;
9055             }
9056             if ( PhylogenyMethods.getBranchWidthValue( n3 ) != BranchWidth.BRANCH_WIDTH_DEFAULT_VALUE ) {
9057                 return false;
9058             }
9059             if ( !n4.getName().equals( "n4" ) ) {
9060                 return false;
9061             }
9062             if ( n4.getDistanceToParent() != 0.01 ) {
9063                 return false;
9064             }
9065             if ( !n5.getName().equals( "n5" ) ) {
9066                 return false;
9067             }
9068             if ( PhylogenyMethods.getConfidenceValue( n5 ) != 56 ) {
9069                 return false;
9070             }
9071             if ( n5.getDistanceToParent() != 0.1 ) {
9072                 return false;
9073             }
9074             if ( !PhylogenyMethods.getSpecies( n5 ).equals( "Ecoli" ) ) {
9075                 return false;
9076             }
9077             if ( !n5.isDuplication() ) {
9078                 return false;
9079             }
9080             if ( !n5.isHasAssignedEvent() ) {
9081                 return false;
9082             }
9083             final PhylogenyNode n8 = PhylogenyNode
9084                     .createInstanceFromNhxString( "ABCD_ECOLI/1-2:0.01",
9085                                                   NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
9086             if ( !n8.getName().equals( "ABCD_ECOLI/1-2" ) ) {
9087                 return false;
9088             }
9089             if ( !PhylogenyMethods.getSpecies( n8 ).equals( "ECOLI" ) ) {
9090                 return false;
9091             }
9092             final PhylogenyNode n9 = PhylogenyNode
9093                     .createInstanceFromNhxString( "ABCD_ECOLI/1-12:0.01",
9094                                                   NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
9095             if ( !n9.getName().equals( "ABCD_ECOLI/1-12" ) ) {
9096                 return false;
9097             }
9098             if ( !PhylogenyMethods.getSpecies( n9 ).equals( "ECOLI" ) ) {
9099                 return false;
9100             }
9101             final PhylogenyNode n10 = PhylogenyNode
9102                     .createInstanceFromNhxString( "n10.ECOLI", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
9103             if ( !n10.getName().equals( "n10.ECOLI" ) ) {
9104                 return false;
9105             }
9106             final PhylogenyNode n20 = PhylogenyNode
9107                     .createInstanceFromNhxString( "ABCD_ECOLI/1-2", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
9108             if ( !n20.getName().equals( "ABCD_ECOLI/1-2" ) ) {
9109                 return false;
9110             }
9111             if ( !PhylogenyMethods.getSpecies( n20 ).equals( "ECOLI" ) ) {
9112                 return false;
9113             }
9114             final PhylogenyNode n20x = PhylogenyNode
9115                     .createInstanceFromNhxString( "N20_ECOL1/1-2", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
9116             if ( !n20x.getName().equals( "N20_ECOL1/1-2" ) ) {
9117                 return false;
9118             }
9119             if ( !PhylogenyMethods.getSpecies( n20x ).equals( "ECOL1" ) ) {
9120                 return false;
9121             }
9122             final PhylogenyNode n20xx = PhylogenyNode
9123                     .createInstanceFromNhxString( "N20_eCOL1/1-2", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
9124             if ( !n20xx.getName().equals( "N20_eCOL1/1-2" ) ) {
9125                 return false;
9126             }
9127             if ( PhylogenyMethods.getSpecies( n20xx ).length() > 0 ) {
9128                 return false;
9129             }
9130             final PhylogenyNode n20xxx = PhylogenyNode
9131                     .createInstanceFromNhxString( "n20_ecoli/1-2", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
9132             if ( !n20xxx.getName().equals( "n20_ecoli/1-2" ) ) {
9133                 return false;
9134             }
9135             if ( PhylogenyMethods.getSpecies( n20xxx ).length() > 0 ) {
9136                 return false;
9137             }
9138             final PhylogenyNode n20xxxx = PhylogenyNode
9139                     .createInstanceFromNhxString( "n20_Ecoli/1-2", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
9140             if ( !n20xxxx.getName().equals( "n20_Ecoli/1-2" ) ) {
9141                 return false;
9142             }
9143             if ( PhylogenyMethods.getSpecies( n20xxxx ).length() > 0 ) {
9144                 return false;
9145             }
9146             final PhylogenyNode n21 = PhylogenyNode
9147                     .createInstanceFromNhxString( "N21_PIG", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
9148             if ( !n21.getName().equals( "N21_PIG" ) ) {
9149                 return false;
9150             }
9151             if ( !PhylogenyMethods.getSpecies( n21 ).equals( "PIG" ) ) {
9152                 return false;
9153             }
9154             final PhylogenyNode n21x = PhylogenyNode
9155                     .createInstanceFromNhxString( "n21_PIG", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
9156             if ( !n21x.getName().equals( "n21_PIG" ) ) {
9157                 return false;
9158             }
9159             if ( PhylogenyMethods.getSpecies( n21x ).length() > 0 ) {
9160                 return false;
9161             }
9162             final PhylogenyNode n22 = PhylogenyNode
9163                     .createInstanceFromNhxString( "n22/PIG", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
9164             if ( !n22.getName().equals( "n22/PIG" ) ) {
9165                 return false;
9166             }
9167             if ( PhylogenyMethods.getSpecies( n22 ).length() > 0 ) {
9168                 return false;
9169             }
9170             final PhylogenyNode n23 = PhylogenyNode
9171                     .createInstanceFromNhxString( "n23/PIG_1", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
9172             if ( !n23.getName().equals( "n23/PIG_1" ) ) {
9173                 return false;
9174             }
9175             if ( PhylogenyMethods.getSpecies( n23 ).length() > 0 ) {
9176                 return false;
9177             }
9178             final PhylogenyNode a = PhylogenyNode
9179                     .createInstanceFromNhxString( "ABCD_ECOLI/1-2", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
9180             if ( !a.getName().equals( "ABCD_ECOLI/1-2" ) ) {
9181                 return false;
9182             }
9183             if ( !PhylogenyMethods.getSpecies( a ).equals( "ECOLI" ) ) {
9184                 return false;
9185             }
9186             final PhylogenyNode c1 = PhylogenyNode
9187                     .createInstanceFromNhxString( "n10_BOVIN/1000-2000",
9188                                                   NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
9189             if ( !c1.getName().equals( "n10_BOVIN/1000-2000" ) ) {
9190                 return false;
9191             }
9192             if ( !PhylogenyMethods.getSpecies( c1 ).equals( "BOVIN" ) ) {
9193                 return false;
9194             }
9195             final PhylogenyNode c2 = PhylogenyNode
9196                     .createInstanceFromNhxString( "N10_Bovin_1/1000-2000",
9197                                                   NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
9198             if ( !c2.getName().equals( "N10_Bovin_1/1000-2000" ) ) {
9199                 return false;
9200             }
9201             if ( PhylogenyMethods.getSpecies( c2 ).length() > 0 ) {
9202                 return false;
9203             }
9204             final PhylogenyNode e3 = PhylogenyNode
9205                     .createInstanceFromNhxString( "n10_RAT~", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
9206             if ( !e3.getName().equals( "n10_RAT~" ) ) {
9207                 return false;
9208             }
9209             if ( !PhylogenyMethods.getSpecies( e3 ).equals( "RAT" ) ) {
9210                 return false;
9211             }
9212             final PhylogenyNode n11 = PhylogenyNode
9213                     .createInstanceFromNhxString( "N111111_ECOLI/1-2:0.4",
9214                                                   NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
9215             if ( !n11.getName().equals( "N111111_ECOLI/1-2" ) ) {
9216                 return false;
9217             }
9218             if ( n11.getDistanceToParent() != 0.4 ) {
9219                 return false;
9220             }
9221             if ( !PhylogenyMethods.getSpecies( n11 ).equals( "ECOLI" ) ) {
9222                 return false;
9223             }
9224             final PhylogenyNode n12 = PhylogenyNode
9225                     .createInstanceFromNhxString( "N111111-ECOLI---/jdj:0.4",
9226                                                   NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
9227             if ( !n12.getName().equals( "N111111-ECOLI---/jdj" ) ) {
9228                 return false;
9229             }
9230             if ( n12.getDistanceToParent() != 0.4 ) {
9231                 return false;
9232             }
9233             if ( PhylogenyMethods.getSpecies( n12 ).length() > 0 ) {
9234                 return false;
9235             }
9236             final PhylogenyNode o = PhylogenyNode
9237                     .createInstanceFromNhxString( "ABCD_MOUSE", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
9238             if ( !o.getName().equals( "ABCD_MOUSE" ) ) {
9239                 return false;
9240             }
9241             if ( !PhylogenyMethods.getSpecies( o ).equals( "MOUSE" ) ) {
9242                 return false;
9243             }
9244             if ( n1.getName().compareTo( "" ) != 0 ) {
9245                 return false;
9246             }
9247             if ( PhylogenyMethods.getConfidenceValue( n1 ) != Confidence.CONFIDENCE_DEFAULT_VALUE ) {
9248                 return false;
9249             }
9250             if ( n1.getDistanceToParent() != PhylogenyDataUtil.BRANCH_LENGTH_DEFAULT ) {
9251                 return false;
9252             }
9253             if ( n2.getName().compareTo( "" ) != 0 ) {
9254                 return false;
9255             }
9256             if ( PhylogenyMethods.getConfidenceValue( n2 ) != Confidence.CONFIDENCE_DEFAULT_VALUE ) {
9257                 return false;
9258             }
9259             if ( n2.getDistanceToParent() != PhylogenyDataUtil.BRANCH_LENGTH_DEFAULT ) {
9260                 return false;
9261             }
9262             final PhylogenyNode n00 = PhylogenyNode
9263                     .createInstanceFromNhxString( "n7:0.000001[&&NHX:GN=gene_name:AC=accession123:S=Ecoli:D=N:Co=N:B=100:T=1]" );
9264             if ( !n00.getNodeData().getSequence().getName().equals( "gene_name" ) ) {
9265                 return false;
9266             }
9267             if ( !n00.getNodeData().getSequence().getAccession().getValue().equals( "accession123" ) ) {
9268                 return false;
9269             }
9270             final PhylogenyNode nx = PhylogenyNode.createInstanceFromNhxString( "n5:0.1[&&NHX:S=Ecoli:GN=gene_1]" );
9271             if ( !nx.getNodeData().getSequence().getName().equals( "gene_1" ) ) {
9272                 return false;
9273             }
9274             final PhylogenyNode n13 = PhylogenyNode
9275                     .createInstanceFromNhxString( "BLAH_12345/1-2", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
9276             if ( !n13.getName().equals( "BLAH_12345/1-2" ) ) {
9277                 return false;
9278             }
9279             if ( PhylogenyMethods.getSpecies( n13 ).equals( "12345" ) ) {
9280                 return false;
9281             }
9282             if ( !n13.getNodeData().getTaxonomy().getIdentifier().getValue().equals( "12345" ) ) {
9283                 return false;
9284             }
9285             if ( !n13.getNodeData().getTaxonomy().getIdentifier().getProvider().equals( "uniprot" ) ) {
9286                 return false;
9287             }
9288             final PhylogenyNode n14 = PhylogenyNode
9289                     .createInstanceFromNhxString( "BLA1_9QX45/1-2", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
9290             if ( !n14.getName().equals( "BLA1_9QX45/1-2" ) ) {
9291                 return false;
9292             }
9293             if ( !PhylogenyMethods.getSpecies( n14 ).equals( "9QX45" ) ) {
9294                 return false;
9295             }
9296             final PhylogenyNode n15 = PhylogenyNode
9297                     .createInstanceFromNhxString( "something_wicked[123]",
9298                                                   NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
9299             if ( !n15.getName().equals( "something_wicked" ) ) {
9300                 return false;
9301             }
9302             if ( n15.getBranchData().getNumberOfConfidences() != 1 ) {
9303                 return false;
9304             }
9305             if ( !isEqual( n15.getBranchData().getConfidence( 0 ).getValue(), 123 ) ) {
9306                 return false;
9307             }
9308             final PhylogenyNode n16 = PhylogenyNode
9309                     .createInstanceFromNhxString( "something_wicked2[9]",
9310                                                   NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
9311             if ( !n16.getName().equals( "something_wicked2" ) ) {
9312                 return false;
9313             }
9314             if ( n16.getBranchData().getNumberOfConfidences() != 1 ) {
9315                 return false;
9316             }
9317             if ( !isEqual( n16.getBranchData().getConfidence( 0 ).getValue(), 9 ) ) {
9318                 return false;
9319             }
9320             final PhylogenyNode n17 = PhylogenyNode
9321                     .createInstanceFromNhxString( "something_wicked3[a]",
9322                                                   NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
9323             if ( !n17.getName().equals( "something_wicked3" ) ) {
9324                 return false;
9325             }
9326             if ( n17.getBranchData().getNumberOfConfidences() != 0 ) {
9327                 return false;
9328             }
9329             final PhylogenyNode n18 = PhylogenyNode
9330                     .createInstanceFromNhxString( ":0.5[91]", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
9331             if ( !isEqual( n18.getDistanceToParent(), 0.5 ) ) {
9332                 return false;
9333             }
9334             if ( n18.getBranchData().getNumberOfConfidences() != 1 ) {
9335                 return false;
9336             }
9337             if ( !isEqual( n18.getBranchData().getConfidence( 0 ).getValue(), 91 ) ) {
9338                 return false;
9339             }
9340             final PhylogenyNode n19 = PhylogenyNode
9341                     .createInstanceFromNhxString( "BLAH_1-roejojoej", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
9342             if ( !n19.getNodeData().getTaxonomy().getIdentifier().getValue().equals( "1" ) ) {
9343                 return false;
9344             }
9345             if ( !n19.getNodeData().getTaxonomy().getIdentifier().getProvider().equals( "uniprot" ) ) {
9346                 return false;
9347             }
9348             final PhylogenyNode n30 = PhylogenyNode
9349                     .createInstanceFromNhxString( "BLAH_1234567-roejojoej",
9350                                                   NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
9351             if ( !n30.getNodeData().getTaxonomy().getIdentifier().getValue().equals( "1234567" ) ) {
9352                 return false;
9353             }
9354             if ( !n30.getNodeData().getTaxonomy().getIdentifier().getProvider().equals( "uniprot" ) ) {
9355                 return false;
9356             }
9357             final PhylogenyNode n31 = PhylogenyNode
9358                     .createInstanceFromNhxString( "BLAH_12345678-roejojoej",
9359                                                   NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
9360             if ( n31.getNodeData().isHasTaxonomy() ) {
9361                 return false;
9362             }
9363             final PhylogenyNode n32 = PhylogenyNode
9364                     .createInstanceFromNhxString( "sd_12345678", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
9365             if ( n32.getNodeData().isHasTaxonomy() ) {
9366                 return false;
9367             }
9368             final PhylogenyNode n40 = PhylogenyNode
9369                     .createInstanceFromNhxString( "BCL2_12345", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
9370             if ( !n40.getNodeData().getTaxonomy().getIdentifier().getValue().equals( "12345" ) ) {
9371                 return false;
9372             }
9373             final PhylogenyNode n41 = PhylogenyNode
9374                     .createInstanceFromNhxString( "12345", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
9375             if ( n41.getNodeData().isHasTaxonomy() ) {
9376                 return false;
9377             }
9378             final PhylogenyNode n42 = PhylogenyNode
9379                     .createInstanceFromNhxString( "12345", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_STRICT );
9380             if ( n42.getNodeData().isHasTaxonomy() ) {
9381                 return false;
9382             }
9383             final PhylogenyNode n43 = PhylogenyNode.createInstanceFromNhxString( "12345",
9384                                                                                  NHXParser.TAXONOMY_EXTRACTION.NO );
9385             if ( n43.getNodeData().isHasTaxonomy() ) {
9386                 return false;
9387             }
9388             final PhylogenyNode n44 = PhylogenyNode
9389                     .createInstanceFromNhxString( "12345~1-2", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
9390             if ( n44.getNodeData().isHasTaxonomy() ) {
9391                 return false;
9392             }
9393         }
9394         catch ( final Exception e ) {
9395             e.printStackTrace( System.out );
9396             return false;
9397         }
9398         return true;
9399     }
9400
9401     private static boolean testNHXParsing() {
9402         try {
9403             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
9404             final Phylogeny p1 = factory.create( "(A     [&&NHX:S=a_species],B1[&&NHX:S=b_species])", new NHXParser() )[ 0 ];
9405             if ( !p1.toNewHampshireX().equals( "(A[&&NHX:S=a_species],B1[&&NHX:S=b_species])" ) ) {
9406                 return false;
9407             }
9408             final String p2_S = "(((((((A:0.2[&&NHX:S=qwerty]):0.2[&&NHX:S=uiop]):0.3[&&NHX:S=asdf]):0.4[&&NHX:S=zxc]):0.5[&&NHX:S=a]):0.6[&&NHX:S=asd]):0.7[&&NHX:S=za]):0.8[&&NHX:S=zaq]";
9409             final Phylogeny[] p2 = factory.create( p2_S, new NHXParser() );
9410             if ( !p2[ 0 ].toNewHampshireX().equals( p2_S ) ) {
9411                 return false;
9412             }
9413             final String p2b_S = "(((((((A:0.2[&NHX:S=qw,erty]):0.2[&:S=u(io)p]):0.3[&NHX:S=asdf]):0.4[S=zxc]):0.5[]):0.6[&&NH:S=asd]):0.7[&&HX:S=za]):0.8[&&:S=zaq]";
9414             final Phylogeny[] p2b = factory.create( p2b_S, new NHXParser() );
9415             if ( !p2b[ 0 ].toNewHampshireX().equals( "(((((((A:0.2):0.2):0.3):0.4):0.5):0.6):0.7):0.8" ) ) {
9416                 return false;
9417             }
9418             final Phylogeny[] p3 = factory
9419                     .create( "[  comment&&NHX,())))](((((((A:0.2[&&NHX:S=qwerty]):0.2[&&NHX:S=uiop]):0.3[&&NHX:S=asdf]):0.4[&&NHX:S=zxc]):0.5[&&NHX:S=a]):0.6[&&NHX:S=asd]):0.7[&&NHX:S=za]):0.8[&&NHX:S=zaq]",
9420                              new NHXParser() );
9421             if ( !p3[ 0 ].toNewHampshireX().equals( p2_S ) ) {
9422                 return false;
9423             }
9424             final Phylogeny[] p4 = factory
9425                     .create( "(((((((A:0.2[&&NHX:S=qwerty]):0.2[&&NHX:S=uiop]):0.3[&&NHX:S=asdf]):0.4[&&NHX:S=zxc]):0.5[&&NHX:S=a]):0.6[&&NHX:S=asd]):0.7[&&NHX:S=za]):0.8[&&NHX:S=zaq][comment(]",
9426                              new NHXParser() );
9427             if ( !p4[ 0 ].toNewHampshireX().equals( p2_S ) ) {
9428                 return false;
9429             }
9430             final Phylogeny[] p5 = factory
9431                     .create( "[]  (  [][ ][   ]  ([((( &&NHXcomment only![[[[[[]([]((((A:0.2[&&NHX:S=q[comment )))]werty][,,,,))]):0.2[&&NHX:S=uiop]):0.3[&&NHX:S=a[comment,,))]sdf])[comment(((]:0.4[&&NHX:S=zxc][comment(((][comment(((]):0.5[&&NHX:S=a]):0.6[&&NHX:S=a[comment(((]sd]):0.7[&&NHX:S=za]):0.8[&&NHX:S=zaq][comment(((]",
9432                              new NHXParser() );
9433             if ( !p5[ 0 ].toNewHampshireX().equals( p2_S ) ) {
9434                 return false;
9435             }
9436             final String p6_S_C = "(A[][][][1][22][333][4444][55555][666666][&&NHX:S=Aspecies],B[))],C,(AA,BB,CC,(CCC,DDD,EEE,[comment](FFFF,GGGG)x)y,D[comment]D,EE,FF,GG,HH),D,E,(EE,FF),F,G,H,(((((5)4)3)2)1),I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,(XX,(YY)),Y,Z)";
9437             final String p6_S_WO_C = "(A[&&NHX:S=Aspecies],B,C,(AA,BB,CC,(CCC,DDD,EEE,(FFFF,GGGG)x)y,DD,EE,FF,GG,HH),D,E,(EE,FF),F,G,H,(((((5)4)3)2)1),I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,(XX,(YY)),Y,Z)";
9438             final Phylogeny[] p6 = factory.create( p6_S_C, new NHXParser() );
9439             if ( !p6[ 0 ].toNewHampshireX().equals( p6_S_WO_C ) ) {
9440                 return false;
9441             }
9442             final String p7_S_C = "(((A [&&NHX:S=species_a], B [&&NHX:S=Vstorri] , C   , D),(A,B,C,D[comment])[],[c][]([xxx]A[comment],[comment]B[comment][comment],[comment][comment]C[comment][comment],[comment][comment]D[comment][comment])[comment][comment],[comment]   [comment](A,B,C,D)),((A,B,C,D),(A,B,C,D),(A,B,C,D),(A,B,C,D)),((A,B,C[comment][comment][comment][comment][comment]    [comment],D),(A,B,C,D),(A,B,C,D),(A,B,C,D)),[comment][comment]((A,B,C,D),(A,B,C,D),(A,B,C,D),(A,B,C,D)))";
9443             final String p7_S_WO_C = "(((A[&&NHX:S=species_a],B[&&NHX:S=Vstorri],C,D),(A,B,C,D),(A,B,C,D),(A,B,C,D)),((A,B,C,D),(A,B,C,D),(A,B,C,D),(A,B,C,D)),((A,B,C,D),(A,B,C,D),(A,B,C,D),(A,B,C,D)),((A,B,C,D),(A,B,C,D),(A,B,C,D),(A,B,C,D)))";
9444             final Phylogeny[] p7 = factory.create( p7_S_C, new NHXParser() );
9445             if ( !p7[ 0 ].toNewHampshireX().equals( p7_S_WO_C ) ) {
9446                 return false;
9447             }
9448             final String p8_S_C = "[cmt](((([]([))))))](((((A[&&NHX:S= [a comment] a])))))))[too many comments!:)])),(((((((((B[&&NHX[ a comment in a bad place]:S   =b])))))[] []   )))),(((((((((C[&&NHX:S=c])   ))[,,, ])))))))";
9449             final String p8_S_WO_C = "((((((((((A[&&NHX:S=a]))))))))),(((((((((B[&&NHX:S=b]))))))))),(((((((((C[&&NHX:S=c]))))))))))";
9450             final Phylogeny[] p8 = factory.create( p8_S_C, new NHXParser() );
9451             if ( !p8[ 0 ].toNewHampshireX().equals( p8_S_WO_C ) ) {
9452                 return false;
9453             }
9454             final Phylogeny p9 = factory.create( "((A:0.2,B:0.3):0.5[91],C:0.1)root:0.1[100]", new NHXParser() )[ 0 ];
9455             if ( !p9.toNewHampshireX().equals( "((A:0.2,B:0.3):0.5[&&NHX:B=91],C:0.1)root:0.1[&&NHX:B=100]" ) ) {
9456                 return false;
9457             }
9458             final Phylogeny p10 = factory
9459                     .create( " [79]   ( (A [co mment] :0 .2[comment],B:0.3[com])[com ment]: 0. 5 \t[ 9 1 ][ comment],C: 0.1)[comment]root:0.1[100] [comment]",
9460                              new NHXParser() )[ 0 ];
9461             if ( !p10.toNewHampshireX().equals( "((A:0.2,B:0.3):0.5[&&NHX:B=91],C:0.1)root:0.1[&&NHX:B=100]" ) ) {
9462                 return false;
9463             }
9464             final Phylogeny p11 = factory
9465                     .create( " [79]   ( ('A: \" ' [co mment] :0 .2[comment],B:0.3[com])[com ment]: 0. 5 \t[ 9 1 ][ comment],C: 0.1)[comment]root:0.1[100] [comment]",
9466                              new NHXParser() )[ 0 ];
9467             if ( !p11.toNewHampshireX().equals( "(('A: \"':0.2,B:0.3):0.5[&&NHX:B=91],C:0.1)root:0.1[&&NHX:B=100]" ) ) {
9468                 return false;
9469             }
9470             final Phylogeny p12 = factory.create( "((A:0.2,B:0.3):0.5[&&NHX:B=91],C:0.1)root:0.1[&&NHX:B=100]",
9471                                                   new NHXParser() )[ 0 ];
9472             if ( !p12.toNewHampshireX().equals( "((A:0.2,B:0.3):0.5[&&NHX:B=91],C:0.1)root:0.1[&&NHX:B=100]" ) ) {
9473                 return false;
9474             }
9475         }
9476         catch ( final Exception e ) {
9477             e.printStackTrace( System.out );
9478             return false;
9479         }
9480         return true;
9481     }
9482
9483     private static boolean testNHXParsingMB() {
9484         try {
9485             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
9486             final Phylogeny p1 = factory.create( "(1[&prob=0.9500000000000000e+00,prob_stddev=0.1100000000000000e+00,"
9487                     + "prob_range={1.000000000000000e+00,1.000000000000000e+00},prob(percent)=\"100\","
9488                     + "prob+-sd=\"100+-0\"]:4.129000000000000e-02[&length_mean=4.153987461671767e-02,"
9489                     + "length_median=4.129000000000000e-02,length_95%HPD={3.217800000000000e-02,"
9490                     + "5.026800000000000e-02}],2[&prob=0.810000000000000e+00,prob_stddev=0.000000000000000e+00,"
9491                     + "prob_range={1.000000000000000e+00,1.000000000000000e+00},prob(percent)=\"100\","
9492                     + "prob+-sd=\"100+-0\"]:6.375699999999999e-02[&length_mean=6.395210411945065e-02,"
9493                     + "length_median=6.375699999999999e-02,length_95%HPD={5.388600000000000e-02,"
9494                     + "7.369400000000000e-02}])", new NHXParser() )[ 0 ];
9495             if ( !isEqual( p1.getNode( "1" ).getDistanceToParent(), 4.129e-02 ) ) {
9496                 return false;
9497             }
9498             if ( !isEqual( p1.getNode( "1" ).getBranchData().getConfidence( 0 ).getValue(), 0.9500000000000000e+00 ) ) {
9499                 return false;
9500             }
9501             if ( !isEqual( p1.getNode( "1" ).getBranchData().getConfidence( 0 ).getStandardDeviation(),
9502                            0.1100000000000000e+00 ) ) {
9503                 return false;
9504             }
9505             if ( !isEqual( p1.getNode( "2" ).getDistanceToParent(), 6.375699999999999e-02 ) ) {
9506                 return false;
9507             }
9508             if ( !isEqual( p1.getNode( "2" ).getBranchData().getConfidence( 0 ).getValue(), 0.810000000000000e+00 ) ) {
9509                 return false;
9510             }
9511             final Phylogeny p2 = factory
9512                     .create( "(1[something_else(?)s,prob=0.9500000000000000e+00{}(((,p)rob_stddev=0.110000000000e+00,"
9513                             + "prob_range={1.000000000000000e+00,1.000000000000000e+00},prob(percent)=\"100\","
9514                             + "prob+-sd=\"100+-0\"]:4.129000000000000e-02[&length_mean=4.153987461671767e-02,"
9515                             + "length_median=4.129000000000000e-02,length_95%HPD={3.217800000000000e-02,"
9516                             + "5.026800000000000e-02}],2[&prob=0.810000000000000e+00,prob_stddev=0.000000000000000e+00,"
9517                             + "prob_range={1.000000000000000e+00,1.000000000000000e+00},prob(percent)=\"100\","
9518                             + "prob+-sd=\"100+-0\"]:6.375699999999999e-02[&length_mean=6.395210411945065e-02,"
9519                             + "length_median=6.375699999999999e-02,length_95%HPD={5.388600000000000e-02,"
9520                             + "7.369400000000000e-02}])",
9521                             new NHXParser() )[ 0 ];
9522             if ( p2.getNode( "1" ) == null ) {
9523                 return false;
9524             }
9525             if ( p2.getNode( "2" ) == null ) {
9526                 return false;
9527             }
9528         }
9529         catch ( final Exception e ) {
9530             e.printStackTrace( System.out );
9531             System.exit( -1 );
9532             return false;
9533         }
9534         return true;
9535     }
9536
9537     private static boolean testNHXParsingQuotes() {
9538         try {
9539             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
9540             final NHXParser p = new NHXParser();
9541             final Phylogeny[] phylogenies_0 = factory.create( new File( Test.PATH_TO_TEST_DATA + "quotes.nhx" ), p );
9542             if ( phylogenies_0.length != 5 ) {
9543                 return false;
9544             }
9545             final Phylogeny phy = phylogenies_0[ 4 ];
9546             if ( phy.getNumberOfExternalNodes() != 7 ) {
9547                 return false;
9548             }
9549             if ( phy.getNodes( "a name in double quotes from tree ((a,b),c)" ).size() != 1 ) {
9550                 return false;
9551             }
9552             if ( phy.getNodes( "charles darwin 'origin of species'" ).size() != 1 ) {
9553                 return false;
9554             }
9555             if ( !phy.getNodes( "charles darwin 'origin of species'" ).get( 0 ).getNodeData().getTaxonomy()
9556                     .getScientificName().equals( "hsapiens" ) ) {
9557                 return false;
9558             }
9559             if ( phy.getNodes( "shouldbetogether single quotes" ).size() != 1 ) {
9560                 return false;
9561             }
9562             if ( phy.getNodes( "'single quotes' inside double quotes" ).size() != 1 ) {
9563                 return false;
9564             }
9565             if ( phy.getNodes( "\"double quotes\" inside single quotes" ).size() != 1 ) {
9566                 return false;
9567             }
9568             if ( phy.getNodes( "noquotes" ).size() != 1 ) {
9569                 return false;
9570             }
9571             if ( phy.getNodes( "A ( B C '" ).size() != 1 ) {
9572                 return false;
9573             }
9574             final NHXParser p1p = new NHXParser();
9575             p1p.setIgnoreQuotes( true );
9576             final Phylogeny p1 = factory.create( "(\"A\",'B1')", p1p )[ 0 ];
9577             if ( !p1.toNewHampshire().equals( "(A,B1);" ) ) {
9578                 return false;
9579             }
9580             final NHXParser p2p = new NHXParser();
9581             p1p.setIgnoreQuotes( false );
9582             final Phylogeny p2 = factory.create( "(\"A\",'B1')", p2p )[ 0 ];
9583             if ( !p2.toNewHampshire().equals( "(A,B1);" ) ) {
9584                 return false;
9585             }
9586             final NHXParser p3p = new NHXParser();
9587             p3p.setIgnoreQuotes( false );
9588             final Phylogeny p3 = factory.create( "(\"A)\",'B1')", p3p )[ 0 ];
9589             if ( !p3.toNewHampshire().equals( "('A)',B1);" ) ) {
9590                 return false;
9591             }
9592             final NHXParser p4p = new NHXParser();
9593             p4p.setIgnoreQuotes( false );
9594             final Phylogeny p4 = factory.create( "(\"A)\",'B(),; x')", p4p )[ 0 ];
9595             if ( !p4.toNewHampshire().equals( "('A)','B(),; x');" ) ) {
9596                 return false;
9597             }
9598             final Phylogeny p10 = factory
9599                     .create( " [79]   ( (\"A \n\tB \" [co mment] :0 .2[comment],'B':0.3[com])[com ment]: 0. 5 \t[ 9 1 ][ comment],'C (or D?\\//;,))': 0.1)[comment]'\nroot is here (cool,  was! ) ':0.1[100] [comment]",
9600                              new NHXParser() )[ 0 ];
9601             final String p10_clean_str = "(('A B':0.2,B:0.3):0.5[&&NHX:B=91],'C (or D?\\//;,))':0.1)'root is here (cool, was! )':0.1[&&NHX:B=100]";
9602             if ( !p10.toNewHampshireX().equals( p10_clean_str ) ) {
9603                 return false;
9604             }
9605             final Phylogeny p11 = factory.create( p10.toNewHampshireX(), new NHXParser() )[ 0 ];
9606             if ( !p11.toNewHampshireX().equals( p10_clean_str ) ) {
9607                 return false;
9608             }
9609             final Phylogeny p12 = factory
9610                     .create( " [79]   ( (\"A \n\tB \" [[][] :0 .2[comment][\t&\t&\n N\tH\tX:S=mo\tnkey !],'\tB\t\b\t\n\f\rB B ':0.0\b3[])\t[com ment]: 0. 5 \t[ 9 1 ][ \ncomment],'C\t (or D?\\//;,))': 0.\b1)[comment]'\nroot \tis here (cool, \b\t\n\f\r was! ) ':0.1[100] [comment]",
9611                              new NHXParser() )[ 0 ];
9612             final String p12_clean_str = "(('A B':0.2[&&NHX:S=monkey!],'BB B':0.03):0.5[&&NHX:B=91],'C (or D?\\//;,))':0.1)'root is here (cool, was! )':0.1[&&NHX:B=100]";
9613             if ( !p12.toNewHampshireX().equals( p12_clean_str ) ) {
9614                 return false;
9615             }
9616             final Phylogeny p13 = factory.create( p12.toNewHampshireX(), new NHXParser() )[ 0 ];
9617             if ( !p13.toNewHampshireX().equals( p12_clean_str ) ) {
9618                 return false;
9619             }
9620             final String p12_clean_str_nh = "(('A B':0.2,'BB B':0.03):0.5,'C (or D?\\//;,))':0.1)'root is here (cool, was! )':0.1;";
9621             if ( !p13.toNewHampshire().equals( p12_clean_str_nh ) ) {
9622                 return false;
9623             }
9624             final Phylogeny p14 = factory.create( p13.toNewHampshire(), new NHXParser() )[ 0 ];
9625             if ( !p14.toNewHampshire().equals( p12_clean_str_nh ) ) {
9626                 return false;
9627             }
9628         }
9629         catch ( final Exception e ) {
9630             e.printStackTrace( System.out );
9631             return false;
9632         }
9633         return true;
9634     }
9635
9636     private static boolean testNodeRemoval() {
9637         try {
9638             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
9639             final Phylogeny t0 = factory.create( "((a)b)", new NHXParser() )[ 0 ];
9640             PhylogenyMethods.removeNode( t0.getNode( "b" ), t0 );
9641             if ( !t0.toNewHampshire().equals( "(a);" ) ) {
9642                 return false;
9643             }
9644             final Phylogeny t1 = factory.create( "((a:2)b:4)", new NHXParser() )[ 0 ];
9645             PhylogenyMethods.removeNode( t1.getNode( "b" ), t1 );
9646             if ( !t1.toNewHampshire().equals( "(a:6.0);" ) ) {
9647                 return false;
9648             }
9649             final Phylogeny t2 = factory.create( "((a,b),c)", new NHXParser() )[ 0 ];
9650             PhylogenyMethods.removeNode( t2.getNode( "b" ), t2 );
9651             if ( !t2.toNewHampshire().equals( "((a),c);" ) ) {
9652                 return false;
9653             }
9654         }
9655         catch ( final Exception e ) {
9656             e.printStackTrace( System.out );
9657             return false;
9658         }
9659         return true;
9660     }
9661
9662     private static boolean testPhylogenyBranch() {
9663         try {
9664             final PhylogenyNode a1 = PhylogenyNode.createInstanceFromNhxString( "a" );
9665             final PhylogenyNode b1 = PhylogenyNode.createInstanceFromNhxString( "b" );
9666             final PhylogenyBranch a1b1 = new PhylogenyBranch( a1, b1 );
9667             final PhylogenyBranch b1a1 = new PhylogenyBranch( b1, a1 );
9668             if ( !a1b1.equals( a1b1 ) ) {
9669                 return false;
9670             }
9671             if ( !a1b1.equals( b1a1 ) ) {
9672                 return false;
9673             }
9674             if ( !b1a1.equals( a1b1 ) ) {
9675                 return false;
9676             }
9677             final PhylogenyBranch a1_b1 = new PhylogenyBranch( a1, b1, true );
9678             final PhylogenyBranch b1_a1 = new PhylogenyBranch( b1, a1, true );
9679             final PhylogenyBranch a1_b1_ = new PhylogenyBranch( a1, b1, false );
9680             if ( a1_b1.equals( b1_a1 ) ) {
9681                 return false;
9682             }
9683             if ( a1_b1.equals( a1_b1_ ) ) {
9684                 return false;
9685             }
9686             final PhylogenyBranch b1_a1_ = new PhylogenyBranch( b1, a1, false );
9687             if ( !a1_b1.equals( b1_a1_ ) ) {
9688                 return false;
9689             }
9690             if ( a1_b1_.equals( b1_a1_ ) ) {
9691                 return false;
9692             }
9693             if ( !a1_b1_.equals( b1_a1 ) ) {
9694                 return false;
9695             }
9696         }
9697         catch ( final Exception e ) {
9698             e.printStackTrace( System.out );
9699             return false;
9700         }
9701         return true;
9702     }
9703
9704     private static boolean testPhyloXMLparsingOfDistributionElement() {
9705         try {
9706             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
9707             PhyloXmlParser xml_parser = null;
9708             try {
9709                 xml_parser = PhyloXmlParser.createPhyloXmlParserXsdValidating();
9710             }
9711             catch ( final Exception e ) {
9712                 // Do nothing -- means were not running from jar.
9713             }
9714             if ( xml_parser == null ) {
9715                 xml_parser = PhyloXmlParser.createPhyloXmlParser();
9716                 if ( USE_LOCAL_PHYLOXML_SCHEMA ) {
9717                     xml_parser.setValidateAgainstSchema( PHYLOXML_LOCAL_XSD );
9718                 }
9719                 else {
9720                     xml_parser.setValidateAgainstSchema( PHYLOXML_REMOTE_XSD );
9721                 }
9722             }
9723             final Phylogeny[] phylogenies_0 = factory.create( Test.PATH_TO_TEST_DATA + "phyloxml_distribution.xml",
9724                                                               xml_parser );
9725             if ( xml_parser.getErrorCount() > 0 ) {
9726                 System.out.println( xml_parser.getErrorMessages().toString() );
9727                 return false;
9728             }
9729             if ( phylogenies_0.length != 1 ) {
9730                 return false;
9731             }
9732             final Phylogeny t1 = phylogenies_0[ 0 ];
9733             PhylogenyNode n = null;
9734             Distribution d = null;
9735             n = t1.getNode( "root node" );
9736             if ( !n.getNodeData().isHasDistribution() ) {
9737                 return false;
9738             }
9739             if ( n.getNodeData().getDistributions().size() != 1 ) {
9740                 return false;
9741             }
9742             d = n.getNodeData().getDistribution();
9743             if ( !d.getDesc().equals( "Hirschweg 38" ) ) {
9744                 return false;
9745             }
9746             if ( d.getPoints().size() != 1 ) {
9747                 return false;
9748             }
9749             if ( d.getPolygons() != null ) {
9750                 return false;
9751             }
9752             if ( !d.getPoints().get( 0 ).getAltitude().toString().equals( "472" ) ) {
9753                 return false;
9754             }
9755             if ( !d.getPoints().get( 0 ).getAltiudeUnit().equals( "m" ) ) {
9756                 return false;
9757             }
9758             if ( !d.getPoints().get( 0 ).getGeodeticDatum().equals( "WGS84" ) ) {
9759                 return false;
9760             }
9761             if ( !d.getPoints().get( 0 ).getLatitude().toString().equals( "47.48148427110029" ) ) {
9762                 return false;
9763             }
9764             if ( !d.getPoints().get( 0 ).getLongitude().toString().equals( "8.768951296806335" ) ) {
9765                 return false;
9766             }
9767             n = t1.getNode( "node a" );
9768             if ( !n.getNodeData().isHasDistribution() ) {
9769                 return false;
9770             }
9771             if ( n.getNodeData().getDistributions().size() != 2 ) {
9772                 return false;
9773             }
9774             d = n.getNodeData().getDistribution( 1 );
9775             if ( !d.getDesc().equals( "San Diego" ) ) {
9776                 return false;
9777             }
9778             if ( d.getPoints().size() != 1 ) {
9779                 return false;
9780             }
9781             if ( d.getPolygons() != null ) {
9782                 return false;
9783             }
9784             if ( !d.getPoints().get( 0 ).getAltitude().toString().equals( "104" ) ) {
9785                 return false;
9786             }
9787             if ( !d.getPoints().get( 0 ).getAltiudeUnit().equals( "m" ) ) {
9788                 return false;
9789             }
9790             if ( !d.getPoints().get( 0 ).getGeodeticDatum().equals( "WGS84" ) ) {
9791                 return false;
9792             }
9793             if ( !d.getPoints().get( 0 ).getLatitude().toString().equals( "32.880933" ) ) {
9794                 return false;
9795             }
9796             if ( !d.getPoints().get( 0 ).getLongitude().toString().equals( "-117.217543" ) ) {
9797                 return false;
9798             }
9799             n = t1.getNode( "node bb" );
9800             if ( !n.getNodeData().isHasDistribution() ) {
9801                 return false;
9802             }
9803             if ( n.getNodeData().getDistributions().size() != 1 ) {
9804                 return false;
9805             }
9806             d = n.getNodeData().getDistribution( 0 );
9807             if ( d.getPoints().size() != 3 ) {
9808                 return false;
9809             }
9810             if ( d.getPolygons().size() != 2 ) {
9811                 return false;
9812             }
9813             if ( !d.getPoints().get( 0 ).getLatitude().toString().equals( "1" ) ) {
9814                 return false;
9815             }
9816             if ( !d.getPoints().get( 0 ).getLongitude().toString().equals( "2" ) ) {
9817                 return false;
9818             }
9819             if ( !d.getPoints().get( 1 ).getLatitude().toString().equals( "3" ) ) {
9820                 return false;
9821             }
9822             if ( !d.getPoints().get( 1 ).getLongitude().toString().equals( "4" ) ) {
9823                 return false;
9824             }
9825             if ( !d.getPoints().get( 2 ).getLatitude().toString().equals( "5" ) ) {
9826                 return false;
9827             }
9828             if ( !d.getPoints().get( 2 ).getLongitude().toString().equals( "6" ) ) {
9829                 return false;
9830             }
9831             Polygon p = d.getPolygons().get( 0 );
9832             if ( p.getPoints().size() != 3 ) {
9833                 return false;
9834             }
9835             if ( !p.getPoints().get( 0 ).getLatitude().toString().equals( "0.1" ) ) {
9836                 return false;
9837             }
9838             if ( !p.getPoints().get( 0 ).getLongitude().toString().equals( "0.2" ) ) {
9839                 return false;
9840             }
9841             if ( !p.getPoints().get( 0 ).getAltitude().toString().equals( "10" ) ) {
9842                 return false;
9843             }
9844             if ( !p.getPoints().get( 2 ).getLatitude().toString().equals( "0.5" ) ) {
9845                 return false;
9846             }
9847             if ( !p.getPoints().get( 2 ).getLongitude().toString().equals( "0.6" ) ) {
9848                 return false;
9849             }
9850             if ( !p.getPoints().get( 2 ).getAltitude().toString().equals( "30" ) ) {
9851                 return false;
9852             }
9853             p = d.getPolygons().get( 1 );
9854             if ( p.getPoints().size() != 3 ) {
9855                 return false;
9856             }
9857             if ( !p.getPoints().get( 0 ).getLatitude().toString().equals( "1.49348902489947473" ) ) {
9858                 return false;
9859             }
9860             if ( !p.getPoints().get( 0 ).getLongitude().toString().equals( "2.567489393947847492" ) ) {
9861                 return false;
9862             }
9863             if ( !p.getPoints().get( 0 ).getAltitude().toString().equals( "10" ) ) {
9864                 return false;
9865             }
9866             // Roundtrip:
9867             final StringBuffer t1_sb = new StringBuffer( t1.toPhyloXML( 0 ) );
9868             final Phylogeny[] rt = factory.create( t1_sb, xml_parser );
9869             if ( rt.length != 1 ) {
9870                 return false;
9871             }
9872             final Phylogeny t1_rt = rt[ 0 ];
9873             n = t1_rt.getNode( "root node" );
9874             if ( !n.getNodeData().isHasDistribution() ) {
9875                 return false;
9876             }
9877             if ( n.getNodeData().getDistributions().size() != 1 ) {
9878                 return false;
9879             }
9880             d = n.getNodeData().getDistribution();
9881             if ( !d.getDesc().equals( "Hirschweg 38" ) ) {
9882                 return false;
9883             }
9884             if ( d.getPoints().size() != 1 ) {
9885                 return false;
9886             }
9887             if ( d.getPolygons() != null ) {
9888                 return false;
9889             }
9890             if ( !d.getPoints().get( 0 ).getAltitude().toString().equals( "472" ) ) {
9891                 return false;
9892             }
9893             if ( !d.getPoints().get( 0 ).getAltiudeUnit().equals( "m" ) ) {
9894                 return false;
9895             }
9896             if ( !d.getPoints().get( 0 ).getGeodeticDatum().equals( "WGS84" ) ) {
9897                 return false;
9898             }
9899             if ( !d.getPoints().get( 0 ).getLatitude().toString().equals( "47.48148427110029" ) ) {
9900                 return false;
9901             }
9902             if ( !d.getPoints().get( 0 ).getLongitude().toString().equals( "8.768951296806335" ) ) {
9903                 return false;
9904             }
9905             n = t1_rt.getNode( "node a" );
9906             if ( !n.getNodeData().isHasDistribution() ) {
9907                 return false;
9908             }
9909             if ( n.getNodeData().getDistributions().size() != 2 ) {
9910                 return false;
9911             }
9912             d = n.getNodeData().getDistribution( 1 );
9913             if ( !d.getDesc().equals( "San Diego" ) ) {
9914                 return false;
9915             }
9916             if ( d.getPoints().size() != 1 ) {
9917                 return false;
9918             }
9919             if ( d.getPolygons() != null ) {
9920                 return false;
9921             }
9922             if ( !d.getPoints().get( 0 ).getAltitude().toString().equals( "104" ) ) {
9923                 return false;
9924             }
9925             if ( !d.getPoints().get( 0 ).getAltiudeUnit().equals( "m" ) ) {
9926                 return false;
9927             }
9928             if ( !d.getPoints().get( 0 ).getGeodeticDatum().equals( "WGS84" ) ) {
9929                 return false;
9930             }
9931             if ( !d.getPoints().get( 0 ).getLatitude().toString().equals( "32.880933" ) ) {
9932                 return false;
9933             }
9934             if ( !d.getPoints().get( 0 ).getLongitude().toString().equals( "-117.217543" ) ) {
9935                 return false;
9936             }
9937             n = t1_rt.getNode( "node bb" );
9938             if ( !n.getNodeData().isHasDistribution() ) {
9939                 return false;
9940             }
9941             if ( n.getNodeData().getDistributions().size() != 1 ) {
9942                 return false;
9943             }
9944             d = n.getNodeData().getDistribution( 0 );
9945             if ( d.getPoints().size() != 3 ) {
9946                 return false;
9947             }
9948             if ( d.getPolygons().size() != 2 ) {
9949                 return false;
9950             }
9951             if ( !d.getPoints().get( 0 ).getLatitude().toString().equals( "1" ) ) {
9952                 return false;
9953             }
9954             if ( !d.getPoints().get( 0 ).getLongitude().toString().equals( "2" ) ) {
9955                 return false;
9956             }
9957             if ( !d.getPoints().get( 1 ).getLatitude().toString().equals( "3" ) ) {
9958                 return false;
9959             }
9960             if ( !d.getPoints().get( 1 ).getLongitude().toString().equals( "4" ) ) {
9961                 return false;
9962             }
9963             if ( !d.getPoints().get( 2 ).getLatitude().toString().equals( "5" ) ) {
9964                 return false;
9965             }
9966             if ( !d.getPoints().get( 2 ).getLongitude().toString().equals( "6" ) ) {
9967                 return false;
9968             }
9969             p = d.getPolygons().get( 0 );
9970             if ( p.getPoints().size() != 3 ) {
9971                 return false;
9972             }
9973             if ( !p.getPoints().get( 0 ).getLatitude().toString().equals( "0.1" ) ) {
9974                 return false;
9975             }
9976             if ( !p.getPoints().get( 0 ).getLongitude().toString().equals( "0.2" ) ) {
9977                 return false;
9978             }
9979             if ( !p.getPoints().get( 0 ).getAltitude().toString().equals( "10" ) ) {
9980                 return false;
9981             }
9982             if ( !p.getPoints().get( 2 ).getLatitude().toString().equals( "0.5" ) ) {
9983                 return false;
9984             }
9985             if ( !p.getPoints().get( 2 ).getLongitude().toString().equals( "0.6" ) ) {
9986                 return false;
9987             }
9988             if ( !p.getPoints().get( 2 ).getAltitude().toString().equals( "30" ) ) {
9989                 return false;
9990             }
9991             p = d.getPolygons().get( 1 );
9992             if ( p.getPoints().size() != 3 ) {
9993                 return false;
9994             }
9995             if ( !p.getPoints().get( 0 ).getLatitude().toString().equals( "1.49348902489947473" ) ) {
9996                 return false;
9997             }
9998             if ( !p.getPoints().get( 0 ).getLongitude().toString().equals( "2.567489393947847492" ) ) {
9999                 return false;
10000             }
10001             if ( !p.getPoints().get( 0 ).getAltitude().toString().equals( "10" ) ) {
10002                 return false;
10003             }
10004         }
10005         catch ( final Exception e ) {
10006             e.printStackTrace( System.out );
10007             return false;
10008         }
10009         return true;
10010     }
10011
10012     private static boolean testPostOrderIterator() {
10013         try {
10014             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
10015             final Phylogeny t0 = factory.create( "((A,B)ab,(C,D)cd)r", new NHXParser() )[ 0 ];
10016             PhylogenyNodeIterator it0;
10017             for( it0 = t0.iteratorPostorder(); it0.hasNext(); ) {
10018                 it0.next();
10019             }
10020             for( it0.reset(); it0.hasNext(); ) {
10021                 it0.next();
10022             }
10023             final Phylogeny t1 = factory.create( "(((A,B)ab,(C,D)cd)abcd,((E,F)ef,(G,H)gh)efgh)r", new NHXParser() )[ 0 ];
10024             final PhylogenyNodeIterator it = t1.iteratorPostorder();
10025             if ( !it.next().getName().equals( "A" ) ) {
10026                 return false;
10027             }
10028             if ( !it.next().getName().equals( "B" ) ) {
10029                 return false;
10030             }
10031             if ( !it.next().getName().equals( "ab" ) ) {
10032                 return false;
10033             }
10034             if ( !it.next().getName().equals( "C" ) ) {
10035                 return false;
10036             }
10037             if ( !it.next().getName().equals( "D" ) ) {
10038                 return false;
10039             }
10040             if ( !it.next().getName().equals( "cd" ) ) {
10041                 return false;
10042             }
10043             if ( !it.next().getName().equals( "abcd" ) ) {
10044                 return false;
10045             }
10046             if ( !it.next().getName().equals( "E" ) ) {
10047                 return false;
10048             }
10049             if ( !it.next().getName().equals( "F" ) ) {
10050                 return false;
10051             }
10052             if ( !it.next().getName().equals( "ef" ) ) {
10053                 return false;
10054             }
10055             if ( !it.next().getName().equals( "G" ) ) {
10056                 return false;
10057             }
10058             if ( !it.next().getName().equals( "H" ) ) {
10059                 return false;
10060             }
10061             if ( !it.next().getName().equals( "gh" ) ) {
10062                 return false;
10063             }
10064             if ( !it.next().getName().equals( "efgh" ) ) {
10065                 return false;
10066             }
10067             if ( !it.next().getName().equals( "r" ) ) {
10068                 return false;
10069             }
10070             if ( it.hasNext() ) {
10071                 return false;
10072             }
10073         }
10074         catch ( final Exception e ) {
10075             e.printStackTrace( System.out );
10076             return false;
10077         }
10078         return true;
10079     }
10080
10081     private static boolean testPreOrderIterator() {
10082         try {
10083             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
10084             final Phylogeny t0 = factory.create( "((A,B)ab,(C,D)cd)r", new NHXParser() )[ 0 ];
10085             PhylogenyNodeIterator it0;
10086             for( it0 = t0.iteratorPreorder(); it0.hasNext(); ) {
10087                 it0.next();
10088             }
10089             for( it0.reset(); it0.hasNext(); ) {
10090                 it0.next();
10091             }
10092             PhylogenyNodeIterator it = t0.iteratorPreorder();
10093             if ( !it.next().getName().equals( "r" ) ) {
10094                 return false;
10095             }
10096             if ( !it.next().getName().equals( "ab" ) ) {
10097                 return false;
10098             }
10099             if ( !it.next().getName().equals( "A" ) ) {
10100                 return false;
10101             }
10102             if ( !it.next().getName().equals( "B" ) ) {
10103                 return false;
10104             }
10105             if ( !it.next().getName().equals( "cd" ) ) {
10106                 return false;
10107             }
10108             if ( !it.next().getName().equals( "C" ) ) {
10109                 return false;
10110             }
10111             if ( !it.next().getName().equals( "D" ) ) {
10112                 return false;
10113             }
10114             if ( it.hasNext() ) {
10115                 return false;
10116             }
10117             final Phylogeny t1 = factory.create( "(((A,B)ab,(C,D)cd)abcd,((E,F)ef,(G,H)gh)efgh)r", new NHXParser() )[ 0 ];
10118             it = t1.iteratorPreorder();
10119             if ( !it.next().getName().equals( "r" ) ) {
10120                 return false;
10121             }
10122             if ( !it.next().getName().equals( "abcd" ) ) {
10123                 return false;
10124             }
10125             if ( !it.next().getName().equals( "ab" ) ) {
10126                 return false;
10127             }
10128             if ( !it.next().getName().equals( "A" ) ) {
10129                 return false;
10130             }
10131             if ( !it.next().getName().equals( "B" ) ) {
10132                 return false;
10133             }
10134             if ( !it.next().getName().equals( "cd" ) ) {
10135                 return false;
10136             }
10137             if ( !it.next().getName().equals( "C" ) ) {
10138                 return false;
10139             }
10140             if ( !it.next().getName().equals( "D" ) ) {
10141                 return false;
10142             }
10143             if ( !it.next().getName().equals( "efgh" ) ) {
10144                 return false;
10145             }
10146             if ( !it.next().getName().equals( "ef" ) ) {
10147                 return false;
10148             }
10149             if ( !it.next().getName().equals( "E" ) ) {
10150                 return false;
10151             }
10152             if ( !it.next().getName().equals( "F" ) ) {
10153                 return false;
10154             }
10155             if ( !it.next().getName().equals( "gh" ) ) {
10156                 return false;
10157             }
10158             if ( !it.next().getName().equals( "G" ) ) {
10159                 return false;
10160             }
10161             if ( !it.next().getName().equals( "H" ) ) {
10162                 return false;
10163             }
10164             if ( it.hasNext() ) {
10165                 return false;
10166             }
10167         }
10168         catch ( final Exception e ) {
10169             e.printStackTrace( System.out );
10170             return false;
10171         }
10172         return true;
10173     }
10174
10175     private static boolean testPropertiesMap() {
10176         try {
10177             final PropertiesMap pm = new PropertiesMap();
10178             final Property p0 = new Property( "dimensions:diameter", "1", "metric:mm", "xsd:decimal", AppliesTo.NODE );
10179             final Property p1 = new Property( "dimensions:length", "2", "metric:mm", "xsd:decimal", AppliesTo.NODE );
10180             final Property p2 = new Property( "something:else",
10181                                               "?",
10182                                               "improbable:research",
10183                                               "xsd:decimal",
10184                                               AppliesTo.NODE );
10185             pm.addProperty( p0 );
10186             pm.addProperty( p1 );
10187             pm.addProperty( p2 );
10188             if ( !pm.getProperty( "dimensions:diameter" ).getValue().equals( "1" ) ) {
10189                 return false;
10190             }
10191             if ( !pm.getProperty( "dimensions:length" ).getValue().equals( "2" ) ) {
10192                 return false;
10193             }
10194             if ( pm.getProperties().size() != 3 ) {
10195                 return false;
10196             }
10197             if ( pm.getPropertiesWithGivenReferencePrefix( "dimensions" ).size() != 2 ) {
10198                 return false;
10199             }
10200             if ( pm.getPropertiesWithGivenReferencePrefix( "something" ).size() != 1 ) {
10201                 return false;
10202             }
10203             if ( pm.getProperties().size() != 3 ) {
10204                 return false;
10205             }
10206             pm.removeProperty( "dimensions:diameter" );
10207             if ( pm.getProperties().size() != 2 ) {
10208                 return false;
10209             }
10210             if ( pm.getPropertiesWithGivenReferencePrefix( "dimensions" ).size() != 1 ) {
10211                 return false;
10212             }
10213             if ( pm.getPropertiesWithGivenReferencePrefix( "something" ).size() != 1 ) {
10214                 return false;
10215             }
10216         }
10217         catch ( final Exception e ) {
10218             e.printStackTrace( System.out );
10219             return false;
10220         }
10221         return true;
10222     }
10223
10224     private static boolean testProteinId() {
10225         try {
10226             final ProteinId id1 = new ProteinId( "a" );
10227             final ProteinId id2 = new ProteinId( "a" );
10228             final ProteinId id3 = new ProteinId( "A" );
10229             final ProteinId id4 = new ProteinId( "b" );
10230             if ( !id1.equals( id1 ) ) {
10231                 return false;
10232             }
10233             if ( id1.getId().equals( "x" ) ) {
10234                 return false;
10235             }
10236             if ( id1.getId().equals( null ) ) {
10237                 return false;
10238             }
10239             if ( !id1.equals( id2 ) ) {
10240                 return false;
10241             }
10242             if ( id1.equals( id3 ) ) {
10243                 return false;
10244             }
10245             if ( id1.hashCode() != id1.hashCode() ) {
10246                 return false;
10247             }
10248             if ( id1.hashCode() != id2.hashCode() ) {
10249                 return false;
10250             }
10251             if ( id1.hashCode() == id3.hashCode() ) {
10252                 return false;
10253             }
10254             if ( id1.compareTo( id1 ) != 0 ) {
10255                 return false;
10256             }
10257             if ( id1.compareTo( id2 ) != 0 ) {
10258                 return false;
10259             }
10260             if ( id1.compareTo( id3 ) != 0 ) {
10261                 return false;
10262             }
10263             if ( id1.compareTo( id4 ) >= 0 ) {
10264                 return false;
10265             }
10266             if ( id4.compareTo( id1 ) <= 0 ) {
10267                 return false;
10268             }
10269             if ( !id4.getId().equals( "b" ) ) {
10270                 return false;
10271             }
10272             final ProteinId id5 = new ProteinId( " C " );
10273             if ( !id5.getId().equals( "C" ) ) {
10274                 return false;
10275             }
10276             if ( id5.equals( id1 ) ) {
10277                 return false;
10278             }
10279         }
10280         catch ( final Exception e ) {
10281             e.printStackTrace( System.out );
10282             return false;
10283         }
10284         return true;
10285     }
10286
10287     private static boolean testReIdMethods() {
10288         try {
10289             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
10290             final Phylogeny p = factory.create( "((1,2)A,(((X,Y,Z)a,b)3)B,(4,5,6)C)r", new NHXParser() )[ 0 ];
10291             final long count = PhylogenyNode.getNodeCount();
10292             p.levelOrderReID();
10293             if ( p.getNode( "r" ).getId() != count ) {
10294                 return false;
10295             }
10296             if ( p.getNode( "A" ).getId() != ( count + 1 ) ) {
10297                 return false;
10298             }
10299             if ( p.getNode( "B" ).getId() != ( count + 1 ) ) {
10300                 return false;
10301             }
10302             if ( p.getNode( "C" ).getId() != ( count + 1 ) ) {
10303                 return false;
10304             }
10305             if ( p.getNode( "1" ).getId() != ( count + 2 ) ) {
10306                 return false;
10307             }
10308             if ( p.getNode( "2" ).getId() != ( count + 2 ) ) {
10309                 return false;
10310             }
10311             if ( p.getNode( "3" ).getId() != ( count + 2 ) ) {
10312                 return false;
10313             }
10314             if ( p.getNode( "4" ).getId() != ( count + 2 ) ) {
10315                 return false;
10316             }
10317             if ( p.getNode( "5" ).getId() != ( count + 2 ) ) {
10318                 return false;
10319             }
10320             if ( p.getNode( "6" ).getId() != ( count + 2 ) ) {
10321                 return false;
10322             }
10323             if ( p.getNode( "a" ).getId() != ( count + 3 ) ) {
10324                 return false;
10325             }
10326             if ( p.getNode( "b" ).getId() != ( count + 3 ) ) {
10327                 return false;
10328             }
10329             if ( p.getNode( "X" ).getId() != ( count + 4 ) ) {
10330                 return false;
10331             }
10332             if ( p.getNode( "Y" ).getId() != ( count + 4 ) ) {
10333                 return false;
10334             }
10335             if ( p.getNode( "Z" ).getId() != ( count + 4 ) ) {
10336                 return false;
10337             }
10338         }
10339         catch ( final Exception e ) {
10340             e.printStackTrace( System.out );
10341             return false;
10342         }
10343         return true;
10344     }
10345
10346     private static boolean testRerooting() {
10347         try {
10348             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
10349             final Phylogeny t1 = factory.create( "((A:1,B:2)AB:1[&&NHX:B=55],(C:3,D:5)CD:3[&&NHX:B=10])ABCD:0.5",
10350                                                  new NHXParser() )[ 0 ];
10351             if ( !t1.isRooted() ) {
10352                 return false;
10353             }
10354             t1.reRoot( t1.getNode( "D" ) );
10355             t1.reRoot( t1.getNode( "CD" ) );
10356             t1.reRoot( t1.getNode( "A" ) );
10357             t1.reRoot( t1.getNode( "B" ) );
10358             t1.reRoot( t1.getNode( "AB" ) );
10359             t1.reRoot( t1.getNode( "D" ) );
10360             t1.reRoot( t1.getNode( "C" ) );
10361             t1.reRoot( t1.getNode( "CD" ) );
10362             t1.reRoot( t1.getNode( "A" ) );
10363             t1.reRoot( t1.getNode( "B" ) );
10364             t1.reRoot( t1.getNode( "AB" ) );
10365             t1.reRoot( t1.getNode( "D" ) );
10366             t1.reRoot( t1.getNode( "D" ) );
10367             t1.reRoot( t1.getNode( "C" ) );
10368             t1.reRoot( t1.getNode( "A" ) );
10369             t1.reRoot( t1.getNode( "B" ) );
10370             t1.reRoot( t1.getNode( "AB" ) );
10371             t1.reRoot( t1.getNode( "C" ) );
10372             t1.reRoot( t1.getNode( "D" ) );
10373             t1.reRoot( t1.getNode( "CD" ) );
10374             t1.reRoot( t1.getNode( "D" ) );
10375             t1.reRoot( t1.getNode( "A" ) );
10376             t1.reRoot( t1.getNode( "B" ) );
10377             t1.reRoot( t1.getNode( "AB" ) );
10378             t1.reRoot( t1.getNode( "C" ) );
10379             t1.reRoot( t1.getNode( "D" ) );
10380             t1.reRoot( t1.getNode( "CD" ) );
10381             t1.reRoot( t1.getNode( "D" ) );
10382             if ( !isEqual( t1.getNode( "A" ).getDistanceToParent(), 1 ) ) {
10383                 return false;
10384             }
10385             if ( !isEqual( t1.getNode( "B" ).getDistanceToParent(), 2 ) ) {
10386                 return false;
10387             }
10388             if ( !isEqual( t1.getNode( "C" ).getDistanceToParent(), 3 ) ) {
10389                 return false;
10390             }
10391             if ( !isEqual( t1.getNode( "D" ).getDistanceToParent(), 2.5 ) ) {
10392                 return false;
10393             }
10394             if ( !isEqual( t1.getNode( "CD" ).getDistanceToParent(), 2.5 ) ) {
10395                 return false;
10396             }
10397             if ( !isEqual( t1.getNode( "AB" ).getDistanceToParent(), 4 ) ) {
10398                 return false;
10399             }
10400             final Phylogeny t2 = factory.create( "(((A:1,B:2)AB:10[&&NHX:B=55],C)ABC:3[&&NHX:B=33],D:5)ABCD:0.5",
10401                                                  new NHXParser() )[ 0 ];
10402             t2.reRoot( t2.getNode( "A" ) );
10403             t2.reRoot( t2.getNode( "D" ) );
10404             t2.reRoot( t2.getNode( "ABC" ) );
10405             t2.reRoot( t2.getNode( "A" ) );
10406             t2.reRoot( t2.getNode( "B" ) );
10407             t2.reRoot( t2.getNode( "D" ) );
10408             t2.reRoot( t2.getNode( "C" ) );
10409             t2.reRoot( t2.getNode( "ABC" ) );
10410             t2.reRoot( t2.getNode( "A" ) );
10411             t2.reRoot( t2.getNode( "B" ) );
10412             t2.reRoot( t2.getNode( "AB" ) );
10413             t2.reRoot( t2.getNode( "AB" ) );
10414             t2.reRoot( t2.getNode( "D" ) );
10415             t2.reRoot( t2.getNode( "C" ) );
10416             t2.reRoot( t2.getNode( "B" ) );
10417             t2.reRoot( t2.getNode( "AB" ) );
10418             t2.reRoot( t2.getNode( "D" ) );
10419             t2.reRoot( t2.getNode( "D" ) );
10420             t2.reRoot( t2.getNode( "ABC" ) );
10421             t2.reRoot( t2.getNode( "A" ) );
10422             t2.reRoot( t2.getNode( "B" ) );
10423             t2.reRoot( t2.getNode( "AB" ) );
10424             t2.reRoot( t2.getNode( "D" ) );
10425             t2.reRoot( t2.getNode( "C" ) );
10426             t2.reRoot( t2.getNode( "ABC" ) );
10427             t2.reRoot( t2.getNode( "A" ) );
10428             t2.reRoot( t2.getNode( "B" ) );
10429             t2.reRoot( t2.getNode( "AB" ) );
10430             t2.reRoot( t2.getNode( "D" ) );
10431             t2.reRoot( t2.getNode( "D" ) );
10432             t2.reRoot( t2.getNode( "C" ) );
10433             t2.reRoot( t2.getNode( "A" ) );
10434             t2.reRoot( t2.getNode( "B" ) );
10435             t2.reRoot( t2.getNode( "AB" ) );
10436             t2.reRoot( t2.getNode( "C" ) );
10437             t2.reRoot( t2.getNode( "D" ) );
10438             t2.reRoot( t2.getNode( "ABC" ) );
10439             t2.reRoot( t2.getNode( "D" ) );
10440             t2.reRoot( t2.getNode( "A" ) );
10441             t2.reRoot( t2.getNode( "B" ) );
10442             t2.reRoot( t2.getNode( "AB" ) );
10443             t2.reRoot( t2.getNode( "C" ) );
10444             t2.reRoot( t2.getNode( "D" ) );
10445             t2.reRoot( t2.getNode( "ABC" ) );
10446             t2.reRoot( t2.getNode( "D" ) );
10447             if ( !isEqual( t2.getNode( "AB" ).getBranchData().getConfidence( 0 ).getValue(), 55 ) ) {
10448                 return false;
10449             }
10450             if ( !isEqual( t2.getNode( "ABC" ).getBranchData().getConfidence( 0 ).getValue(), 33 ) ) {
10451                 return false;
10452             }
10453             t2.reRoot( t2.getNode( "ABC" ) );
10454             if ( !isEqual( t2.getNode( "AB" ).getBranchData().getConfidence( 0 ).getValue(), 55 ) ) {
10455                 return false;
10456             }
10457             if ( !isEqual( t2.getNode( "ABC" ).getBranchData().getConfidence( 0 ).getValue(), 33 ) ) {
10458                 return false;
10459             }
10460             t2.reRoot( t2.getNode( "AB" ) );
10461             if ( !isEqual( t2.getNode( "AB" ).getBranchData().getConfidence( 0 ).getValue(), 55 ) ) {
10462                 return false;
10463             }
10464             if ( !isEqual( t2.getNode( "ABC" ).getBranchData().getConfidence( 0 ).getValue(), 55 ) ) {
10465                 return false;
10466             }
10467             if ( !isEqual( t2.getNode( "D" ).getBranchData().getConfidence( 0 ).getValue(), 33 ) ) {
10468                 return false;
10469             }
10470             t2.reRoot( t2.getNode( "AB" ) );
10471             if ( !isEqual( t2.getNode( "AB" ).getBranchData().getConfidence( 0 ).getValue(), 55 ) ) {
10472                 return false;
10473             }
10474             if ( !isEqual( t2.getNode( "ABC" ).getBranchData().getConfidence( 0 ).getValue(), 55 ) ) {
10475                 return false;
10476             }
10477             if ( !isEqual( t2.getNode( "D" ).getBranchData().getConfidence( 0 ).getValue(), 33 ) ) {
10478                 return false;
10479             }
10480             t2.reRoot( t2.getNode( "D" ) );
10481             if ( !isEqual( t2.getNode( "AB" ).getBranchData().getConfidence( 0 ).getValue(), 55 ) ) {
10482                 return false;
10483             }
10484             if ( !isEqual( t2.getNode( "ABC" ).getBranchData().getConfidence( 0 ).getValue(), 33 ) ) {
10485                 return false;
10486             }
10487             t2.reRoot( t2.getNode( "ABC" ) );
10488             if ( !isEqual( t2.getNode( "AB" ).getBranchData().getConfidence( 0 ).getValue(), 55 ) ) {
10489                 return false;
10490             }
10491             if ( !isEqual( t2.getNode( "ABC" ).getBranchData().getConfidence( 0 ).getValue(), 33 ) ) {
10492                 return false;
10493             }
10494             final Phylogeny t3 = factory.create( "(A[&&NHX:B=10],B[&&NHX:B=20],C[&&NHX:B=30],D[&&NHX:B=40])",
10495                                                  new NHXParser() )[ 0 ];
10496             t3.reRoot( t3.getNode( "B" ) );
10497             if ( t3.getNode( "B" ).getBranchData().getConfidence( 0 ).getValue() != 20 ) {
10498                 return false;
10499             }
10500             if ( t3.getNode( "A" ).getParent().getBranchData().getConfidence( 0 ).getValue() != 20 ) {
10501                 return false;
10502             }
10503             if ( t3.getNode( "A" ).getParent().getNumberOfDescendants() != 3 ) {
10504                 return false;
10505             }
10506             t3.reRoot( t3.getNode( "B" ) );
10507             if ( t3.getNode( "B" ).getBranchData().getConfidence( 0 ).getValue() != 20 ) {
10508                 return false;
10509             }
10510             if ( t3.getNode( "A" ).getParent().getBranchData().getConfidence( 0 ).getValue() != 20 ) {
10511                 return false;
10512             }
10513             if ( t3.getNode( "A" ).getParent().getNumberOfDescendants() != 3 ) {
10514                 return false;
10515             }
10516             t3.reRoot( t3.getRoot() );
10517             if ( t3.getNode( "B" ).getBranchData().getConfidence( 0 ).getValue() != 20 ) {
10518                 return false;
10519             }
10520             if ( t3.getNode( "A" ).getParent().getBranchData().getConfidence( 0 ).getValue() != 20 ) {
10521                 return false;
10522             }
10523             if ( t3.getNode( "A" ).getParent().getNumberOfDescendants() != 3 ) {
10524                 return false;
10525             }
10526         }
10527         catch ( final Exception e ) {
10528             e.printStackTrace( System.out );
10529             return false;
10530         }
10531         return true;
10532     }
10533
10534     private static boolean testSDIse() {
10535         try {
10536             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
10537             final Phylogeny species1 = factory.create( "[&&NHX:S=yeast]", new NHXParser() )[ 0 ];
10538             final Phylogeny gene1 = factory.create( "(A1[&&NHX:S=yeast],A2[&&NHX:S=yeast])", new NHXParser() )[ 0 ];
10539             gene1.setRooted( true );
10540             species1.setRooted( true );
10541             final SDI sdi = new SDI( gene1, species1 );
10542             if ( !gene1.getRoot().isDuplication() ) {
10543                 return false;
10544             }
10545             final Phylogeny species2 = factory
10546                     .create( "(((([&&NHX:S=A],[&&NHX:S=B]),[&&NHX:S=C]),[&&NHX:S=D]),([&&NHX:S=E],[&&NHX:S=F]))",
10547                              new NHXParser() )[ 0 ];
10548             final Phylogeny gene2 = factory
10549                     .create( "(((([&&NHX:S=A],[&&NHX:S=B])ab,[&&NHX:S=C])abc,[&&NHX:S=D])abcd,([&&NHX:S=E],[&&NHX:S=F])ef)r",
10550                              new NHXParser() )[ 0 ];
10551             species2.setRooted( true );
10552             gene2.setRooted( true );
10553             final SDI sdi2 = new SDI( gene2, species2 );
10554             if ( sdi2.getDuplicationsSum() != 0 ) {
10555                 return false;
10556             }
10557             if ( !gene2.getNode( "ab" ).isSpeciation() ) {
10558                 return false;
10559             }
10560             if ( !gene2.getNode( "ab" ).isHasAssignedEvent() ) {
10561                 return false;
10562             }
10563             if ( !gene2.getNode( "abc" ).isSpeciation() ) {
10564                 return false;
10565             }
10566             if ( !gene2.getNode( "abc" ).isHasAssignedEvent() ) {
10567                 return false;
10568             }
10569             if ( !gene2.getNode( "r" ).isSpeciation() ) {
10570                 return false;
10571             }
10572             if ( !gene2.getNode( "r" ).isHasAssignedEvent() ) {
10573                 return false;
10574             }
10575             final Phylogeny species3 = factory
10576                     .create( "(((([&&NHX:S=A],[&&NHX:S=B]),[&&NHX:S=C]),[&&NHX:S=D]),([&&NHX:S=E],[&&NHX:S=F]))",
10577                              new NHXParser() )[ 0 ];
10578             final Phylogeny gene3 = factory
10579                     .create( "(((([&&NHX:S=A],[&&NHX:S=A])aa,[&&NHX:S=C])abc,[&&NHX:S=D])abcd,([&&NHX:S=E],[&&NHX:S=F])ef)r",
10580                              new NHXParser() )[ 0 ];
10581             species3.setRooted( true );
10582             gene3.setRooted( true );
10583             final SDI sdi3 = new SDI( gene3, species3 );
10584             if ( sdi3.getDuplicationsSum() != 1 ) {
10585                 return false;
10586             }
10587             if ( !gene3.getNode( "aa" ).isDuplication() ) {
10588                 return false;
10589             }
10590             if ( !gene3.getNode( "aa" ).isHasAssignedEvent() ) {
10591                 return false;
10592             }
10593             final Phylogeny species4 = factory
10594                     .create( "(((([&&NHX:S=A],[&&NHX:S=B]),[&&NHX:S=C]),[&&NHX:S=D]),([&&NHX:S=E],[&&NHX:S=F]))",
10595                              new NHXParser() )[ 0 ];
10596             final Phylogeny gene4 = factory
10597                     .create( "(((([&&NHX:S=A],[&&NHX:S=C])ac,[&&NHX:S=B])abc,[&&NHX:S=D])abcd,([&&NHX:S=E],[&&NHX:S=F])ef)r",
10598                              new NHXParser() )[ 0 ];
10599             species4.setRooted( true );
10600             gene4.setRooted( true );
10601             final SDI sdi4 = new SDI( gene4, species4 );
10602             if ( sdi4.getDuplicationsSum() != 1 ) {
10603                 return false;
10604             }
10605             if ( !gene4.getNode( "ac" ).isSpeciation() ) {
10606                 return false;
10607             }
10608             if ( !gene4.getNode( "abc" ).isDuplication() ) {
10609                 return false;
10610             }
10611             if ( gene4.getNode( "abcd" ).isDuplication() ) {
10612                 return false;
10613             }
10614             if ( species4.getNumberOfExternalNodes() != 6 ) {
10615                 return false;
10616             }
10617             if ( gene4.getNumberOfExternalNodes() != 6 ) {
10618                 return false;
10619             }
10620             final Phylogeny species5 = factory
10621                     .create( "(((([&&NHX:S=A],[&&NHX:S=B]),[&&NHX:S=C]),[&&NHX:S=D]),([&&NHX:S=E],[&&NHX:S=F]))",
10622                              new NHXParser() )[ 0 ];
10623             final Phylogeny gene5 = factory
10624                     .create( "(((([&&NHX:S=A],[&&NHX:S=D])ad,[&&NHX:S=C])adc,[&&NHX:S=B])abcd,([&&NHX:S=E],[&&NHX:S=F])ef)r",
10625                              new NHXParser() )[ 0 ];
10626             species5.setRooted( true );
10627             gene5.setRooted( true );
10628             final SDI sdi5 = new SDI( gene5, species5 );
10629             if ( sdi5.getDuplicationsSum() != 2 ) {
10630                 return false;
10631             }
10632             if ( !gene5.getNode( "ad" ).isSpeciation() ) {
10633                 return false;
10634             }
10635             if ( !gene5.getNode( "adc" ).isDuplication() ) {
10636                 return false;
10637             }
10638             if ( !gene5.getNode( "abcd" ).isDuplication() ) {
10639                 return false;
10640             }
10641             if ( species5.getNumberOfExternalNodes() != 6 ) {
10642                 return false;
10643             }
10644             if ( gene5.getNumberOfExternalNodes() != 6 ) {
10645                 return false;
10646             }
10647             // Trees from Louxin Zhang 1997 "On a Mirkin-Muchnik-Smith
10648             // Conjecture for Comparing Molecular Phylogenies"
10649             // J. of Comput Bio. Vol. 4, No 2, pp.177-187
10650             final Phylogeny species6 = factory
10651                     .create( "(((1:[&&NHX:S=1],5:[&&NHX:S=5])1-5,((4:[&&NHX:S=4],6:[&&NHX:S=6])4-6,2:[&&NHX:S=2])4-6-2)1-5-4-6-2,"
10652                             + "((9:[&&NHX:S=9],3:[&&NHX:S=3])9-3,(8:[&&NHX:S=8],7:[&&NHX:S=7])8-7)9-3-8-7)",
10653                             new NHXParser() )[ 0 ];
10654             final Phylogeny gene6 = factory
10655                     .create( "(((1:0.1[&&NHX:S=1],2:0.1[&&NHX:S=2])1-2:0.1,3:0.1[&&NHX:S=3])1-2-3:0.1,"
10656                             + "((4:0.1[&&NHX:S=4],(5:0.1[&&NHX:S=5],6:0.1[&&NHX:S=6])5-6:0.1)4-5-6:0.1,"
10657                             + "(7:0.1[&&NHX:S=7],(8:0.1[&&NHX:S=8],9:0.1[&&NHX:S=9])8-9:0.1)7-8-9:0.1)4-5-6-7-8-9:0.1)r;",
10658                             new NHXParser() )[ 0 ];
10659             species6.setRooted( true );
10660             gene6.setRooted( true );
10661             final SDI sdi6 = new SDI( gene6, species6 );
10662             if ( sdi6.getDuplicationsSum() != 3 ) {
10663                 return false;
10664             }
10665             if ( !gene6.getNode( "r" ).isDuplication() ) {
10666                 return false;
10667             }
10668             if ( !gene6.getNode( "4-5-6" ).isDuplication() ) {
10669                 return false;
10670             }
10671             if ( !gene6.getNode( "7-8-9" ).isDuplication() ) {
10672                 return false;
10673             }
10674             if ( !gene6.getNode( "1-2" ).isSpeciation() ) {
10675                 return false;
10676             }
10677             if ( !gene6.getNode( "1-2-3" ).isSpeciation() ) {
10678                 return false;
10679             }
10680             if ( !gene6.getNode( "5-6" ).isSpeciation() ) {
10681                 return false;
10682             }
10683             if ( !gene6.getNode( "8-9" ).isSpeciation() ) {
10684                 return false;
10685             }
10686             if ( !gene6.getNode( "4-5-6-7-8-9" ).isSpeciation() ) {
10687                 return false;
10688             }
10689             sdi6.computeMappingCostL();
10690             if ( sdi6.computeMappingCostL() != 17 ) {
10691                 return false;
10692             }
10693             if ( species6.getNumberOfExternalNodes() != 9 ) {
10694                 return false;
10695             }
10696             if ( gene6.getNumberOfExternalNodes() != 9 ) {
10697                 return false;
10698             }
10699             final Phylogeny species7 = Test.createPhylogeny( "(((((((" + "([&&NHX:S=a1],[&&NHX:S=a2]),"
10700                     + "([&&NHX:S=b1],[&&NHX:S=b2])" + "),[&&NHX:S=x]),(" + "([&&NHX:S=m1],[&&NHX:S=m2]),"
10701                     + "([&&NHX:S=n1],[&&NHX:S=n2])" + ")),(" + "([&&NHX:S=i1],[&&NHX:S=i2]),"
10702                     + "([&&NHX:S=j1],[&&NHX:S=j2])" + ")),(" + "([&&NHX:S=e1],[&&NHX:S=e2]),"
10703                     + "([&&NHX:S=f1],[&&NHX:S=f2])" + ")),[&&NHX:S=y]),[&&NHX:S=z])" );
10704             species7.setRooted( true );
10705             final Phylogeny gene7_1 = Test
10706                     .createPhylogeny( "((((((((a1[&&NHX:S=a1],a2[&&NHX:S=a2]),b1[&&NHX:S=b1]),x[&&NHX:S=x]),m1[&&NHX:S=m1]),i1[&&NHX:S=i1]),e1[&&NHX:S=e1]),y[&&NHX:S=y]),z[&&NHX:S=z])" );
10707             gene7_1.setRooted( true );
10708             final SDI sdi7 = new SDI( gene7_1, species7 );
10709             if ( sdi7.getDuplicationsSum() != 0 ) {
10710                 return false;
10711             }
10712             if ( !Test.getEvent( gene7_1, "a1", "a2" ).isSpeciation() ) {
10713                 return false;
10714             }
10715             if ( !Test.getEvent( gene7_1, "a1", "b1" ).isSpeciation() ) {
10716                 return false;
10717             }
10718             if ( !Test.getEvent( gene7_1, "a1", "x" ).isSpeciation() ) {
10719                 return false;
10720             }
10721             if ( !Test.getEvent( gene7_1, "a1", "m1" ).isSpeciation() ) {
10722                 return false;
10723             }
10724             if ( !Test.getEvent( gene7_1, "a1", "i1" ).isSpeciation() ) {
10725                 return false;
10726             }
10727             if ( !Test.getEvent( gene7_1, "a1", "e1" ).isSpeciation() ) {
10728                 return false;
10729             }
10730             if ( !Test.getEvent( gene7_1, "a1", "y" ).isSpeciation() ) {
10731                 return false;
10732             }
10733             if ( !Test.getEvent( gene7_1, "a1", "z" ).isSpeciation() ) {
10734                 return false;
10735             }
10736             final Phylogeny gene7_2 = Test
10737                     .createPhylogeny( "(((((((((a1[&&NHX:S=a1],a2[&&NHX:S=a2]),b1[&&NHX:S=b1]),x[&&NHX:S=x]),m1[&&NHX:S=m1]),i1[&&NHX:S=i1]),j2[&&NHX:S=j2]),e1[&&NHX:S=e1]),y[&&NHX:S=y]),z[&&NHX:S=z])" );
10738             gene7_2.setRooted( true );
10739             final SDI sdi7_2 = new SDI( gene7_2, species7 );
10740             if ( sdi7_2.getDuplicationsSum() != 1 ) {
10741                 return false;
10742             }
10743             if ( !Test.getEvent( gene7_2, "a1", "a2" ).isSpeciation() ) {
10744                 return false;
10745             }
10746             if ( !Test.getEvent( gene7_2, "a1", "b1" ).isSpeciation() ) {
10747                 return false;
10748             }
10749             if ( !Test.getEvent( gene7_2, "a1", "x" ).isSpeciation() ) {
10750                 return false;
10751             }
10752             if ( !Test.getEvent( gene7_2, "a1", "m1" ).isSpeciation() ) {
10753                 return false;
10754             }
10755             if ( !Test.getEvent( gene7_2, "a1", "i1" ).isSpeciation() ) {
10756                 return false;
10757             }
10758             if ( !Test.getEvent( gene7_2, "a1", "j2" ).isDuplication() ) {
10759                 return false;
10760             }
10761             if ( !Test.getEvent( gene7_2, "a1", "e1" ).isSpeciation() ) {
10762                 return false;
10763             }
10764             if ( !Test.getEvent( gene7_2, "a1", "y" ).isSpeciation() ) {
10765                 return false;
10766             }
10767             if ( !Test.getEvent( gene7_2, "a1", "z" ).isSpeciation() ) {
10768                 return false;
10769             }
10770         }
10771         catch ( final Exception e ) {
10772             return false;
10773         }
10774         return true;
10775     }
10776
10777     private static boolean testSDIunrooted() {
10778         try {
10779             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
10780             final Phylogeny p0 = factory.create( "((((A,B)ab,(C1,C2)cc)abc,D)abcd,(E,F)ef)abcdef", new NHXParser() )[ 0 ];
10781             final List<PhylogenyBranch> l = SDIR.getBranchesInPreorder( p0 );
10782             final Iterator<PhylogenyBranch> iter = l.iterator();
10783             PhylogenyBranch br = iter.next();
10784             if ( !br.getFirstNode().getName().equals( "abcd" ) && !br.getFirstNode().getName().equals( "ef" ) ) {
10785                 return false;
10786             }
10787             if ( !br.getSecondNode().getName().equals( "abcd" ) && !br.getSecondNode().getName().equals( "ef" ) ) {
10788                 return false;
10789             }
10790             br = iter.next();
10791             if ( !br.getFirstNode().getName().equals( "abcd" ) && !br.getFirstNode().getName().equals( "abc" ) ) {
10792                 return false;
10793             }
10794             if ( !br.getSecondNode().getName().equals( "abcd" ) && !br.getSecondNode().getName().equals( "abc" ) ) {
10795                 return false;
10796             }
10797             br = iter.next();
10798             if ( !br.getFirstNode().getName().equals( "abc" ) && !br.getFirstNode().getName().equals( "ab" ) ) {
10799                 return false;
10800             }
10801             if ( !br.getSecondNode().getName().equals( "abc" ) && !br.getSecondNode().getName().equals( "ab" ) ) {
10802                 return false;
10803             }
10804             br = iter.next();
10805             if ( !br.getFirstNode().getName().equals( "ab" ) && !br.getFirstNode().getName().equals( "A" ) ) {
10806                 return false;
10807             }
10808             if ( !br.getSecondNode().getName().equals( "ab" ) && !br.getSecondNode().getName().equals( "A" ) ) {
10809                 return false;
10810             }
10811             br = iter.next();
10812             if ( !br.getFirstNode().getName().equals( "ab" ) && !br.getFirstNode().getName().equals( "B" ) ) {
10813                 return false;
10814             }
10815             if ( !br.getSecondNode().getName().equals( "ab" ) && !br.getSecondNode().getName().equals( "B" ) ) {
10816                 return false;
10817             }
10818             br = iter.next();
10819             if ( !br.getFirstNode().getName().equals( "ab" ) && !br.getFirstNode().getName().equals( "abc" ) ) {
10820                 return false;
10821             }
10822             if ( !br.getSecondNode().getName().equals( "ab" ) && !br.getSecondNode().getName().equals( "abc" ) ) {
10823                 return false;
10824             }
10825             br = iter.next();
10826             if ( !br.getFirstNode().getName().equals( "abc" ) && !br.getFirstNode().getName().equals( "cc" ) ) {
10827                 return false;
10828             }
10829             if ( !br.getSecondNode().getName().equals( "abc" ) && !br.getSecondNode().getName().equals( "cc" ) ) {
10830                 return false;
10831             }
10832             br = iter.next();
10833             if ( !br.getFirstNode().getName().equals( "C1" ) && !br.getFirstNode().getName().equals( "cc" ) ) {
10834                 return false;
10835             }
10836             if ( !br.getSecondNode().getName().equals( "C1" ) && !br.getSecondNode().getName().equals( "cc" ) ) {
10837                 return false;
10838             }
10839             br = iter.next();
10840             if ( !br.getFirstNode().getName().equals( "C2" ) && !br.getFirstNode().getName().equals( "cc" ) ) {
10841                 return false;
10842             }
10843             if ( !br.getSecondNode().getName().equals( "C2" ) && !br.getSecondNode().getName().equals( "cc" ) ) {
10844                 return false;
10845             }
10846             br = iter.next();
10847             if ( !br.getFirstNode().getName().equals( "abc" ) && !br.getFirstNode().getName().equals( "cc" ) ) {
10848                 return false;
10849             }
10850             if ( !br.getSecondNode().getName().equals( "abc" ) && !br.getSecondNode().getName().equals( "cc" ) ) {
10851                 return false;
10852             }
10853             br = iter.next();
10854             if ( !br.getFirstNode().getName().equals( "abc" ) && !br.getFirstNode().getName().equals( "abcd" ) ) {
10855                 return false;
10856             }
10857             if ( !br.getSecondNode().getName().equals( "abc" ) && !br.getSecondNode().getName().equals( "abcd" ) ) {
10858                 return false;
10859             }
10860             br = iter.next();
10861             if ( !br.getFirstNode().getName().equals( "abcd" ) && !br.getFirstNode().getName().equals( "D" ) ) {
10862                 return false;
10863             }
10864             if ( !br.getSecondNode().getName().equals( "abcd" ) && !br.getSecondNode().getName().equals( "D" ) ) {
10865                 return false;
10866             }
10867             br = iter.next();
10868             if ( !br.getFirstNode().getName().equals( "ef" ) && !br.getFirstNode().getName().equals( "abcd" ) ) {
10869                 return false;
10870             }
10871             if ( !br.getSecondNode().getName().equals( "ef" ) && !br.getSecondNode().getName().equals( "abcd" ) ) {
10872                 return false;
10873             }
10874             br = iter.next();
10875             if ( !br.getFirstNode().getName().equals( "ef" ) && !br.getFirstNode().getName().equals( "E" ) ) {
10876                 return false;
10877             }
10878             if ( !br.getSecondNode().getName().equals( "ef" ) && !br.getSecondNode().getName().equals( "E" ) ) {
10879                 return false;
10880             }
10881             br = iter.next();
10882             if ( !br.getFirstNode().getName().equals( "ef" ) && !br.getFirstNode().getName().equals( "F" ) ) {
10883                 return false;
10884             }
10885             if ( !br.getSecondNode().getName().equals( "ef" ) && !br.getSecondNode().getName().equals( "F" ) ) {
10886                 return false;
10887             }
10888             if ( iter.hasNext() ) {
10889                 return false;
10890             }
10891             final Phylogeny p1 = factory.create( "(C,(A,B)ab)abc", new NHXParser() )[ 0 ];
10892             final List<PhylogenyBranch> l1 = SDIR.getBranchesInPreorder( p1 );
10893             final Iterator<PhylogenyBranch> iter1 = l1.iterator();
10894             br = iter1.next();
10895             if ( !br.getFirstNode().getName().equals( "ab" ) && !br.getFirstNode().getName().equals( "C" ) ) {
10896                 return false;
10897             }
10898             if ( !br.getSecondNode().getName().equals( "ab" ) && !br.getSecondNode().getName().equals( "C" ) ) {
10899                 return false;
10900             }
10901             br = iter1.next();
10902             if ( !br.getFirstNode().getName().equals( "ab" ) && !br.getFirstNode().getName().equals( "A" ) ) {
10903                 return false;
10904             }
10905             if ( !br.getSecondNode().getName().equals( "ab" ) && !br.getSecondNode().getName().equals( "A" ) ) {
10906                 return false;
10907             }
10908             br = iter1.next();
10909             if ( !br.getFirstNode().getName().equals( "ab" ) && !br.getFirstNode().getName().equals( "B" ) ) {
10910                 return false;
10911             }
10912             if ( !br.getSecondNode().getName().equals( "ab" ) && !br.getSecondNode().getName().equals( "B" ) ) {
10913                 return false;
10914             }
10915             if ( iter1.hasNext() ) {
10916                 return false;
10917             }
10918             final Phylogeny p2 = factory.create( "((A,B)ab,C)abc", new NHXParser() )[ 0 ];
10919             final List<PhylogenyBranch> l2 = SDIR.getBranchesInPreorder( p2 );
10920             final Iterator<PhylogenyBranch> iter2 = l2.iterator();
10921             br = iter2.next();
10922             if ( !br.getFirstNode().getName().equals( "ab" ) && !br.getFirstNode().getName().equals( "C" ) ) {
10923                 return false;
10924             }
10925             if ( !br.getSecondNode().getName().equals( "ab" ) && !br.getSecondNode().getName().equals( "C" ) ) {
10926                 return false;
10927             }
10928             br = iter2.next();
10929             if ( !br.getFirstNode().getName().equals( "ab" ) && !br.getFirstNode().getName().equals( "A" ) ) {
10930                 return false;
10931             }
10932             if ( !br.getSecondNode().getName().equals( "ab" ) && !br.getSecondNode().getName().equals( "A" ) ) {
10933                 return false;
10934             }
10935             br = iter2.next();
10936             if ( !br.getFirstNode().getName().equals( "ab" ) && !br.getFirstNode().getName().equals( "B" ) ) {
10937                 return false;
10938             }
10939             if ( !br.getSecondNode().getName().equals( "ab" ) && !br.getSecondNode().getName().equals( "B" ) ) {
10940                 return false;
10941             }
10942             if ( iter2.hasNext() ) {
10943                 return false;
10944             }
10945             final Phylogeny species0 = factory
10946                     .create( "(((([&&NHX:S=A],[&&NHX:S=B]),[&&NHX:S=C]),[&&NHX:S=D]),([&&NHX:S=E],[&&NHX:S=F]))",
10947                              new NHXParser() )[ 0 ];
10948             final Phylogeny gene1 = factory
10949                     .create( "(((((A:0.6[&&NHX:S=A],B:0.1[&&NHX:S=B])ab:0.1,C:0.1[&&NHX:S=C])abc:0.3,D:1.0[&&NHX:S=D])abcd:0.2,E:0.1[&&NHX:S=E])abcde:0.2,F:0.2[&&NHX:S=F])",
10950                              new NHXParser() )[ 0 ];
10951             species0.setRooted( true );
10952             gene1.setRooted( true );
10953             final SDIR sdi_unrooted = new SDIR();
10954             sdi_unrooted.infer( gene1, species0, false, true, true, true, 10 );
10955             if ( sdi_unrooted.getCount() != 1 ) {
10956                 return false;
10957             }
10958             if ( sdi_unrooted.getMinimalDuplications() != 0 ) {
10959                 return false;
10960             }
10961             if ( !Test.isEqual( sdi_unrooted.getMinimalDiffInSubTreeHeights(), 0.4 ) ) {
10962                 return false;
10963             }
10964             if ( !Test.isEqual( sdi_unrooted.getMinimalTreeHeight(), 1.0 ) ) {
10965                 return false;
10966             }
10967             if ( sdi_unrooted.getMinimalMappingCost() != Integer.MAX_VALUE ) {
10968                 return false;
10969             }
10970             final Phylogeny gene2 = factory
10971                     .create( "(((((A:2.6[&&NHX:S=A],B:0.1[&&NHX:S=B])ab:0.1,C:0.1[&&NHX:S=C])abc:0.3,D:1.0[&&NHX:S=D])abcd:0.2,E:0.1[&&NHX:S=E])abcde:0.2,F:0.2[&&NHX:S=F])",
10972                              new NHXParser() )[ 0 ];
10973             gene2.setRooted( true );
10974             sdi_unrooted.infer( gene2, species0, false, false, true, true, 10 );
10975             if ( sdi_unrooted.getCount() != 1 ) {
10976                 return false;
10977             }
10978             if ( sdi_unrooted.getMinimalDuplications() != 3 ) {
10979                 return false;
10980             }
10981             if ( !Test.isEqual( sdi_unrooted.getMinimalDiffInSubTreeHeights(), 0.0 ) ) {
10982                 return false;
10983             }
10984             if ( !Test.isEqual( sdi_unrooted.getMinimalTreeHeight(), 2.0 ) ) {
10985                 return false;
10986             }
10987             if ( sdi_unrooted.getMinimalMappingCost() != Integer.MAX_VALUE ) {
10988                 return false;
10989             }
10990             final Phylogeny species6 = factory
10991                     .create( "(((1:[&&NHX:S=1],5:[&&NHX:S=5])1-5,((4:[&&NHX:S=4],6:[&&NHX:S=6])4-6,2:[&&NHX:S=2])4-6-2)1-5-4-6-2,"
10992                             + "((9:[&&NHX:S=9],3:[&&NHX:S=3])9-3,(8:[&&NHX:S=8],7:[&&NHX:S=7])8-7)9-3-8-7)",
10993                             new NHXParser() )[ 0 ];
10994             final Phylogeny gene6 = factory
10995                     .create( "((5:0.1[&&NHX:S=5],6:0.1[&&NHX:S=6])5-6:0.05[&&NHX:S=6],(4:0.1[&&NHX:S=4],"
10996                             + "(((1:0.1[&&NHX:S=1],2:0.1[&&NHX:S=2])1-2:0.1[&&NHX:S=2],3:0.25[&&NHX:S=3])1-2-3:0.2[&&NHX:S=2],"
10997                             + "(7:0.1[&&NHX:S=7],(8:0.1[&&NHX:S=8],"
10998                             + "9:0.1[&&NHX:S=9])8-9:0.1[&&NHX:S=9])7-8-9:0.1[&&NHX:S=8])"
10999                             + "4-5-6-7-8-9:0.1[&&NHX:S=5])4-5-6:0.05[&&NHX:S=5])",
11000                             new NHXParser() )[ 0 ];
11001             species6.setRooted( true );
11002             gene6.setRooted( true );
11003             Phylogeny[] p6 = sdi_unrooted.infer( gene6, species6, false, true, true, true, 10 );
11004             if ( sdi_unrooted.getCount() != 1 ) {
11005                 return false;
11006             }
11007             if ( !Test.isEqual( sdi_unrooted.getMinimalDiffInSubTreeHeights(), 0.0 ) ) {
11008                 return false;
11009             }
11010             if ( !Test.isEqual( sdi_unrooted.getMinimalTreeHeight(), 0.375 ) ) {
11011                 return false;
11012             }
11013             if ( sdi_unrooted.getMinimalDuplications() != 3 ) {
11014                 return false;
11015             }
11016             if ( sdi_unrooted.getMinimalMappingCost() != Integer.MAX_VALUE ) {
11017                 return false;
11018             }
11019             if ( !p6[ 0 ].getRoot().isDuplication() ) {
11020                 return false;
11021             }
11022             if ( !p6[ 0 ].getNode( "4-5-6" ).isDuplication() ) {
11023                 return false;
11024             }
11025             if ( !p6[ 0 ].getNode( "7-8-9" ).isDuplication() ) {
11026                 return false;
11027             }
11028             if ( p6[ 0 ].getNode( "1-2" ).isDuplication() ) {
11029                 return false;
11030             }
11031             if ( p6[ 0 ].getNode( "1-2-3" ).isDuplication() ) {
11032                 return false;
11033             }
11034             if ( p6[ 0 ].getNode( "5-6" ).isDuplication() ) {
11035                 return false;
11036             }
11037             if ( p6[ 0 ].getNode( "8-9" ).isDuplication() ) {
11038                 return false;
11039             }
11040             if ( p6[ 0 ].getNode( "4-5-6-7-8-9" ).isDuplication() ) {
11041                 return false;
11042             }
11043             p6 = null;
11044             final Phylogeny species7 = factory
11045                     .create( "(((1:[&&NHX:S=1],5:[&&NHX:S=5])1-5,((4:[&&NHX:S=4],6:[&&NHX:S=6])4-6,2:[&&NHX:S=2])4-6-2)1-5-4-6-2,"
11046                             + "((9:[&&NHX:S=9],3:[&&NHX:S=3])9-3,(8:[&&NHX:S=8],7:[&&NHX:S=7])8-7)9-3-8-7)",
11047                             new NHXParser() )[ 0 ];
11048             final Phylogeny gene7 = factory
11049                     .create( "((5:0.1[&&NHX:S=5],6:0.1[&&NHX:S=6])5-6:0.05[&&NHX:S=6],(4:0.1[&&NHX:S=4],"
11050                             + "(((1:0.1[&&NHX:S=1],2:0.1[&&NHX:S=2])1-2:0.1[&&NHX:S=2],3:0.25[&&NHX:S=3])1-2-3:0.2[&&NHX:S=2],"
11051                             + "(7:0.1[&&NHX:S=7],(8:0.1[&&NHX:S=8],"
11052                             + "9:0.1[&&NHX:S=9])8-9:0.1[&&NHX:S=9])7-8-9:0.1[&&NHX:S=8])"
11053                             + "4-5-6-7-8-9:0.1[&&NHX:S=5])4-5-6:0.05[&&NHX:S=5])",
11054                             new NHXParser() )[ 0 ];
11055             species7.setRooted( true );
11056             gene7.setRooted( true );
11057             Phylogeny[] p7 = sdi_unrooted.infer( gene7, species7, true, true, true, true, 10 );
11058             if ( sdi_unrooted.getCount() != 1 ) {
11059                 return false;
11060             }
11061             if ( !Test.isEqual( sdi_unrooted.getMinimalDiffInSubTreeHeights(), 0.0 ) ) {
11062                 return false;
11063             }
11064             if ( !Test.isEqual( sdi_unrooted.getMinimalTreeHeight(), 0.375 ) ) {
11065                 return false;
11066             }
11067             if ( sdi_unrooted.getMinimalDuplications() != 3 ) {
11068                 return false;
11069             }
11070             if ( sdi_unrooted.getMinimalMappingCost() != 17 ) {
11071                 return false;
11072             }
11073             if ( !p7[ 0 ].getRoot().isDuplication() ) {
11074                 return false;
11075             }
11076             if ( !p7[ 0 ].getNode( "4-5-6" ).isDuplication() ) {
11077                 return false;
11078             }
11079             if ( !p7[ 0 ].getNode( "7-8-9" ).isDuplication() ) {
11080                 return false;
11081             }
11082             if ( p7[ 0 ].getNode( "1-2" ).isDuplication() ) {
11083                 return false;
11084             }
11085             if ( p7[ 0 ].getNode( "1-2-3" ).isDuplication() ) {
11086                 return false;
11087             }
11088             if ( p7[ 0 ].getNode( "5-6" ).isDuplication() ) {
11089                 return false;
11090             }
11091             if ( p7[ 0 ].getNode( "8-9" ).isDuplication() ) {
11092                 return false;
11093             }
11094             if ( p7[ 0 ].getNode( "4-5-6-7-8-9" ).isDuplication() ) {
11095                 return false;
11096             }
11097             p7 = null;
11098             final Phylogeny species8 = factory
11099                     .create( "(((1:[&&NHX:S=1],5:[&&NHX:S=5])1-5,((4:[&&NHX:S=4],6:[&&NHX:S=6])4-6,2:[&&NHX:S=2])4-6-2)1-5-4-6-2,"
11100                             + "((9:[&&NHX:S=9],3:[&&NHX:S=3])9-3,(8:[&&NHX:S=8],7:[&&NHX:S=7])8-7)9-3-8-7)",
11101                             new NHXParser() )[ 0 ];
11102             final Phylogeny gene8 = factory
11103                     .create( "((5:0.1[&&NHX:S=5],6:0.1[&&NHX:S=6])5-6:0.05[&&NHX:S=6],(4:0.1[&&NHX:S=4],"
11104                             + "(((1:0.1[&&NHX:S=1],2:0.1[&&NHX:S=2])1-2:0.1[&&NHX:S=2],3:0.25[&&NHX:S=3])1-2-3:0.2[&&NHX:S=2],"
11105                             + "(7:0.1[&&NHX:S=7],(8:0.1[&&NHX:S=8],"
11106                             + "9:0.1[&&NHX:S=9])8-9:0.1[&&NHX:S=9])7-8-9:0.1[&&NHX:S=8])"
11107                             + "4-5-6-7-8-9:0.1[&&NHX:S=5])4-5-6:0.05[&&NHX:S=5])",
11108                             new NHXParser() )[ 0 ];
11109             species8.setRooted( true );
11110             gene8.setRooted( true );
11111             Phylogeny[] p8 = sdi_unrooted.infer( gene8, species8, false, false, true, true, 10 );
11112             if ( sdi_unrooted.getCount() != 1 ) {
11113                 return false;
11114             }
11115             if ( !Test.isEqual( sdi_unrooted.getMinimalDiffInSubTreeHeights(), 0.0 ) ) {
11116                 return false;
11117             }
11118             if ( !Test.isEqual( sdi_unrooted.getMinimalTreeHeight(), 0.375 ) ) {
11119                 return false;
11120             }
11121             if ( sdi_unrooted.getMinimalDuplications() != 3 ) {
11122                 return false;
11123             }
11124             if ( sdi_unrooted.getMinimalMappingCost() != Integer.MAX_VALUE ) {
11125                 return false;
11126             }
11127             if ( !p8[ 0 ].getRoot().isDuplication() ) {
11128                 return false;
11129             }
11130             if ( !p8[ 0 ].getNode( "4-5-6" ).isDuplication() ) {
11131                 return false;
11132             }
11133             if ( !p8[ 0 ].getNode( "7-8-9" ).isDuplication() ) {
11134                 return false;
11135             }
11136             if ( p8[ 0 ].getNode( "1-2" ).isDuplication() ) {
11137                 return false;
11138             }
11139             if ( p8[ 0 ].getNode( "1-2-3" ).isDuplication() ) {
11140                 return false;
11141             }
11142             if ( p8[ 0 ].getNode( "5-6" ).isDuplication() ) {
11143                 return false;
11144             }
11145             if ( p8[ 0 ].getNode( "8-9" ).isDuplication() ) {
11146                 return false;
11147             }
11148             if ( p8[ 0 ].getNode( "4-5-6-7-8-9" ).isDuplication() ) {
11149                 return false;
11150             }
11151             p8 = null;
11152         }
11153         catch ( final Exception e ) {
11154             e.printStackTrace( System.out );
11155             return false;
11156         }
11157         return true;
11158     }
11159
11160     private static boolean testSequenceDbWsTools1() {
11161         try {
11162             final PhylogenyNode n = new PhylogenyNode();
11163             n.setName( "NP_001025424" );
11164             Accession acc = SequenceDbWsTools.obtainSeqAccession( n );
11165             if ( ( acc == null ) || !acc.getSource().equals( Source.REFSEQ.toString() )
11166                     || !acc.getValue().equals( "NP_001025424" ) ) {
11167                 return false;
11168             }
11169             n.setName( "340 0559 -- _NP_001025424_dsfdg15 05" );
11170             acc = SequenceDbWsTools.obtainSeqAccession( n );
11171             if ( ( acc == null ) || !acc.getSource().equals( Source.REFSEQ.toString() )
11172                     || !acc.getValue().equals( "NP_001025424" ) ) {
11173                 return false;
11174             }
11175             n.setName( "NP_001025424.1" );
11176             acc = SequenceDbWsTools.obtainSeqAccession( n );
11177             if ( ( acc == null ) || !acc.getSource().equals( Source.REFSEQ.toString() )
11178                     || !acc.getValue().equals( "NP_001025424" ) ) {
11179                 return false;
11180             }
11181             n.setName( "NM_001030253" );
11182             acc = SequenceDbWsTools.obtainSeqAccession( n );
11183             if ( ( acc == null ) || !acc.getSource().equals( Source.REFSEQ.toString() )
11184                     || !acc.getValue().equals( "NM_001030253" ) ) {
11185                 return false;
11186             }
11187             n.setName( "BCL2_HUMAN" );
11188             acc = SequenceDbWsTools.obtainSeqAccession( n );
11189             if ( ( acc == null ) || !acc.getSource().equals( Source.UNIPROT.toString() )
11190                     || !acc.getValue().equals( "BCL2_HUMAN" ) ) {
11191                 System.out.println( acc.toString() );
11192                 return false;
11193             }
11194             n.setName( "P10415" );
11195             acc = SequenceDbWsTools.obtainSeqAccession( n );
11196             if ( ( acc == null ) || !acc.getSource().equals( Source.UNIPROT.toString() )
11197                     || !acc.getValue().equals( "P10415" ) ) {
11198                 System.out.println( acc.toString() );
11199                 return false;
11200             }
11201             n.setName( " P10415 " );
11202             acc = SequenceDbWsTools.obtainSeqAccession( n );
11203             if ( ( acc == null ) || !acc.getSource().equals( Source.UNIPROT.toString() )
11204                     || !acc.getValue().equals( "P10415" ) ) {
11205                 System.out.println( acc.toString() );
11206                 return false;
11207             }
11208             n.setName( "_P10415|" );
11209             acc = SequenceDbWsTools.obtainSeqAccession( n );
11210             if ( ( acc == null ) || !acc.getSource().equals( Source.UNIPROT.toString() )
11211                     || !acc.getValue().equals( "P10415" ) ) {
11212                 System.out.println( acc.toString() );
11213                 return false;
11214             }
11215             n.setName( "AY695820" );
11216             acc = SequenceDbWsTools.obtainSeqAccession( n );
11217             if ( ( acc == null ) || !acc.getSource().equals( Source.NCBI.toString() )
11218                     || !acc.getValue().equals( "AY695820" ) ) {
11219                 System.out.println( acc.toString() );
11220                 return false;
11221             }
11222             n.setName( "_AY695820_" );
11223             acc = SequenceDbWsTools.obtainSeqAccession( n );
11224             if ( ( acc == null ) || !acc.getSource().equals( Source.NCBI.toString() )
11225                     || !acc.getValue().equals( "AY695820" ) ) {
11226                 System.out.println( acc.toString() );
11227                 return false;
11228             }
11229             n.setName( "AAA59452" );
11230             acc = SequenceDbWsTools.obtainSeqAccession( n );
11231             if ( ( acc == null ) || !acc.getSource().equals( Source.NCBI.toString() )
11232                     || !acc.getValue().equals( "AAA59452" ) ) {
11233                 System.out.println( acc.toString() );
11234                 return false;
11235             }
11236             n.setName( "_AAA59452_" );
11237             acc = SequenceDbWsTools.obtainSeqAccession( n );
11238             if ( ( acc == null ) || !acc.getSource().equals( Source.NCBI.toString() )
11239                     || !acc.getValue().equals( "AAA59452" ) ) {
11240                 System.out.println( acc.toString() );
11241                 return false;
11242             }
11243             n.setName( "AAA59452.1" );
11244             acc = SequenceDbWsTools.obtainSeqAccession( n );
11245             if ( ( acc == null ) || !acc.getSource().equals( Source.NCBI.toString() )
11246                     || !acc.getValue().equals( "AAA59452.1" ) ) {
11247                 System.out.println( acc.toString() );
11248                 return false;
11249             }
11250             n.setName( "_AAA59452.1_" );
11251             acc = SequenceDbWsTools.obtainSeqAccession( n );
11252             if ( ( acc == null ) || !acc.getSource().equals( Source.NCBI.toString() )
11253                     || !acc.getValue().equals( "AAA59452.1" ) ) {
11254                 System.out.println( acc.toString() );
11255                 return false;
11256             }
11257             n.setName( "GI:94894583" );
11258             acc = SequenceDbWsTools.obtainSeqAccession( n );
11259             if ( ( acc == null ) || !acc.getSource().equals( Source.GI.toString() )
11260                     || !acc.getValue().equals( "94894583" ) ) {
11261                 System.out.println( acc.toString() );
11262                 return false;
11263             }
11264             n.setName( "gi|71845847|1,4-alpha-glucan branching enzyme [Dechloromonas aromatica RCB]" );
11265             acc = SequenceDbWsTools.obtainSeqAccession( n );
11266             if ( ( acc == null ) || !acc.getSource().equals( Source.GI.toString() )
11267                     || !acc.getValue().equals( "71845847" ) ) {
11268                 System.out.println( acc.toString() );
11269                 return false;
11270             }
11271             n.setName( "gi|71845847|gb|AAZ45343.1| 1,4-alpha-glucan branching enzyme [Dechloromonas aromatica RCB]" );
11272             acc = SequenceDbWsTools.obtainSeqAccession( n );
11273             if ( ( acc == null ) || !acc.getSource().equals( Source.NCBI.toString() )
11274                     || !acc.getValue().equals( "AAZ45343.1" ) ) {
11275                 System.out.println( acc.toString() );
11276                 return false;
11277             }
11278         }
11279         catch ( final Exception e ) {
11280             return false;
11281         }
11282         return true;
11283     }
11284
11285     private static boolean testSequenceDbWsTools2() {
11286         try {
11287             final PhylogenyNode n1 = new PhylogenyNode( "NP_001025424" );
11288             SequenceDbWsTools.obtainSeqInformation( n1 );
11289             if ( !n1.getNodeData().getSequence().getName().equals( "Bcl2" ) ) {
11290                 return false;
11291             }
11292             if ( !n1.getNodeData().getTaxonomy().getScientificName().equals( "Danio rerio" ) ) {
11293                 return false;
11294             }
11295             if ( !n1.getNodeData().getSequence().getAccession().getSource().equals( Source.REFSEQ.toString() ) ) {
11296                 return false;
11297             }
11298             if ( !n1.getNodeData().getSequence().getAccession().getValue().equals( "NP_001025424" ) ) {
11299                 return false;
11300             }
11301             final PhylogenyNode n2 = new PhylogenyNode( "NM_001030253" );
11302             SequenceDbWsTools.obtainSeqInformation( n2 );
11303             if ( !n2.getNodeData().getSequence().getName().equals( "Danio rerio B-cell CLL/lymphoma 2a (bcl2a), mRNA" ) ) {
11304                 return false;
11305             }
11306             if ( !n2.getNodeData().getTaxonomy().getScientificName().equals( "Danio rerio" ) ) {
11307                 return false;
11308             }
11309             if ( !n2.getNodeData().getSequence().getAccession().getSource().equals( Source.REFSEQ.toString() ) ) {
11310                 return false;
11311             }
11312             if ( !n2.getNodeData().getSequence().getAccession().getValue().equals( "NM_001030253" ) ) {
11313                 return false;
11314             }
11315             final PhylogenyNode n3 = new PhylogenyNode( "NM_184234.2" );
11316             SequenceDbWsTools.obtainSeqInformation( n3 );
11317             if ( !n3.getNodeData().getSequence().getName()
11318                     .equals( "Homo sapiens RNA binding motif protein 39 (RBM39), transcript variant 1, mRNA" ) ) {
11319                 return false;
11320             }
11321             if ( !n3.getNodeData().getTaxonomy().getScientificName().equals( "Homo sapiens" ) ) {
11322                 return false;
11323             }
11324             if ( !n3.getNodeData().getSequence().getAccession().getSource().equals( Source.REFSEQ.toString() ) ) {
11325                 return false;
11326             }
11327             if ( !n3.getNodeData().getSequence().getAccession().getValue().equals( "NM_184234" ) ) {
11328                 return false;
11329             }
11330         }
11331         catch ( final IOException e ) {
11332             System.out.println();
11333             System.out.println( "the following might be due to absence internet connection:" );
11334             e.printStackTrace( System.out );
11335             return true;
11336         }
11337         catch ( final Exception e ) {
11338             e.printStackTrace();
11339             return false;
11340         }
11341         return true;
11342     }
11343
11344     private static boolean testSequenceIdParsing() {
11345         try {
11346             Accession id = SequenceAccessionTools.parseAccessorFromString( "gb_ADF31344_segmented_worms_" );
11347             if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() )
11348                     || !id.getValue().equals( "ADF31344" ) || !id.getSource().equals( "ncbi" ) ) {
11349                 if ( id != null ) {
11350                     System.out.println( "value   =" + id.getValue() );
11351                     System.out.println( "provider=" + id.getSource() );
11352                 }
11353                 return false;
11354             }
11355             id = SequenceAccessionTools.parseAccessorFromString( "segmented worms|gb_ADF31344" );
11356             if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() )
11357                     || !id.getValue().equals( "ADF31344" ) || !id.getSource().equals( "ncbi" ) ) {
11358                 if ( id != null ) {
11359                     System.out.println( "value   =" + id.getValue() );
11360                     System.out.println( "provider=" + id.getSource() );
11361                 }
11362                 return false;
11363             }
11364             id = SequenceAccessionTools.parseAccessorFromString( "segmented worms gb_ADF31344 and more" );
11365             if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() )
11366                     || !id.getValue().equals( "ADF31344" ) || !id.getSource().equals( "ncbi" ) ) {
11367                 if ( id != null ) {
11368                     System.out.println( "value   =" + id.getValue() );
11369                     System.out.println( "provider=" + id.getSource() );
11370                 }
11371                 return false;
11372             }
11373             id = SequenceAccessionTools.parseAccessorFromString( "gb_AAA96518_1" );
11374             if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() )
11375                     || !id.getValue().equals( "AAA96518" ) || !id.getSource().equals( "ncbi" ) ) {
11376                 if ( id != null ) {
11377                     System.out.println( "value   =" + id.getValue() );
11378                     System.out.println( "provider=" + id.getSource() );
11379                 }
11380                 return false;
11381             }
11382             id = SequenceAccessionTools.parseAccessorFromString( "gb_EHB07727_1_rodents_" );
11383             if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() )
11384                     || !id.getValue().equals( "EHB07727" ) || !id.getSource().equals( "ncbi" ) ) {
11385                 if ( id != null ) {
11386                     System.out.println( "value   =" + id.getValue() );
11387                     System.out.println( "provider=" + id.getSource() );
11388                 }
11389                 return false;
11390             }
11391             id = SequenceAccessionTools.parseAccessorFromString( "dbj_BAF37827_1_turtles_" );
11392             if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() )
11393                     || !id.getValue().equals( "BAF37827" ) || !id.getSource().equals( "ncbi" ) ) {
11394                 if ( id != null ) {
11395                     System.out.println( "value   =" + id.getValue() );
11396                     System.out.println( "provider=" + id.getSource() );
11397                 }
11398                 return false;
11399             }
11400             id = SequenceAccessionTools.parseAccessorFromString( "emb_CAA73223_1_primates_" );
11401             if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() )
11402                     || !id.getValue().equals( "CAA73223" ) || !id.getSource().equals( "ncbi" ) ) {
11403                 if ( id != null ) {
11404                     System.out.println( "value   =" + id.getValue() );
11405                     System.out.println( "provider=" + id.getSource() );
11406                 }
11407                 return false;
11408             }
11409             id = SequenceAccessionTools.parseAccessorFromString( "mites|ref_XP_002434188_1" );
11410             if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() )
11411                     || !id.getValue().equals( "XP_002434188" ) || !id.getSource().equals( "refseq" ) ) {
11412                 if ( id != null ) {
11413                     System.out.println( "value   =" + id.getValue() );
11414                     System.out.println( "provider=" + id.getSource() );
11415                 }
11416                 return false;
11417             }
11418             id = SequenceAccessionTools.parseAccessorFromString( "mites_ref_XP_002434188_1_bla_XP_12345" );
11419             if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() )
11420                     || !id.getValue().equals( "XP_002434188" ) || !id.getSource().equals( "refseq" ) ) {
11421                 if ( id != null ) {
11422                     System.out.println( "value   =" + id.getValue() );
11423                     System.out.println( "provider=" + id.getSource() );
11424                 }
11425                 return false;
11426             }
11427             id = SequenceAccessionTools.parseAccessorFromString( "P4A123" );
11428             if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() )
11429                     || !id.getValue().equals( "P4A123" ) || !id.getSource().equals( "uniprot" ) ) {
11430                 if ( id != null ) {
11431                     System.out.println( "value   =" + id.getValue() );
11432                     System.out.println( "provider=" + id.getSource() );
11433                 }
11434                 return false;
11435             }
11436             id = SequenceAccessionTools.parseAccessorFromString( "XP_12345" );
11437             if ( id != null ) {
11438                 System.out.println( "value   =" + id.getValue() );
11439                 System.out.println( "provider=" + id.getSource() );
11440                 return false;
11441             }
11442             id = SequenceAccessionTools.parseAccessorFromString( "N3B004Z009" );
11443             if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() )
11444                     || !id.getValue().equals( "N3B004Z009" ) || !id.getSource().equals( "uniprot" ) ) {
11445                 if ( id != null ) {
11446                     System.out.println( "value   =" + id.getValue() );
11447                     System.out.println( "provider=" + id.getSource() );
11448                 }
11449                 return false;
11450             }
11451             id = SequenceAccessionTools.parseAccessorFromString( "A4CAA4ZBB9" );
11452             if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() )
11453                     || !id.getValue().equals( "A4CAA4ZBB9" ) || !id.getSource().equals( "uniprot" ) ) {
11454                 if ( id != null ) {
11455                     System.out.println( "value   =" + id.getValue() );
11456                     System.out.println( "provider=" + id.getSource() );
11457                 }
11458                 return false;
11459             }
11460             id = SequenceAccessionTools.parseAccessorFromString( "ecoli_A4CAA4ZBB9_rt" );
11461             if ( ( id == null ) || ForesterUtil.isEmpty( id.getValue() ) || ForesterUtil.isEmpty( id.getSource() )
11462                     || !id.getValue().equals( "A4CAA4ZBB9" ) || !id.getSource().equals( "uniprot" ) ) {
11463                 if ( id != null ) {
11464                     System.out.println( "value   =" + id.getValue() );
11465                     System.out.println( "provider=" + id.getSource() );
11466                 }
11467                 return false;
11468             }
11469             id = SequenceAccessionTools.parseAccessorFromString( "Q4CAA4ZBB9" );
11470             if ( id != null ) {
11471                 System.out.println( "value   =" + id.getValue() );
11472                 System.out.println( "provider=" + id.getSource() );
11473                 return false;
11474             }
11475         }
11476         catch ( final Exception e ) {
11477             e.printStackTrace( System.out );
11478             return false;
11479         }
11480         return true;
11481     }
11482
11483     private static boolean testSequenceWriter() {
11484         try {
11485             final String n = ForesterUtil.LINE_SEPARATOR;
11486             if ( !SequenceWriter.toFasta( "name", "awes", 5 ).toString().equals( ">name" + n + "awes" ) ) {
11487                 return false;
11488             }
11489             if ( !SequenceWriter.toFasta( "name", "awes", 4 ).toString().equals( ">name" + n + "awes" ) ) {
11490                 return false;
11491             }
11492             if ( !SequenceWriter.toFasta( "name", "awes", 3 ).toString().equals( ">name" + n + "awe" + n + "s" ) ) {
11493                 return false;
11494             }
11495             if ( !SequenceWriter.toFasta( "name", "awes", 2 ).toString().equals( ">name" + n + "aw" + n + "es" ) ) {
11496                 return false;
11497             }
11498             if ( !SequenceWriter.toFasta( "name", "awes", 1 ).toString()
11499                     .equals( ">name" + n + "a" + n + "w" + n + "e" + n + "s" ) ) {
11500                 return false;
11501             }
11502             if ( !SequenceWriter.toFasta( "name", "abcdefghij", 3 ).toString()
11503                     .equals( ">name" + n + "abc" + n + "def" + n + "ghi" + n + "j" ) ) {
11504                 return false;
11505             }
11506         }
11507         catch ( final Exception e ) {
11508             e.printStackTrace();
11509             return false;
11510         }
11511         return true;
11512     }
11513
11514     private static boolean testSpecies() {
11515         try {
11516             final Species s1 = new BasicSpecies( "a" );
11517             final Species s2 = new BasicSpecies( "a" );
11518             final Species s3 = new BasicSpecies( "A" );
11519             final Species s4 = new BasicSpecies( "b" );
11520             if ( !s1.equals( s1 ) ) {
11521                 return false;
11522             }
11523             if ( s1.getSpeciesId().equals( "x" ) ) {
11524                 return false;
11525             }
11526             if ( s1.getSpeciesId().equals( null ) ) {
11527                 return false;
11528             }
11529             if ( !s1.equals( s2 ) ) {
11530                 return false;
11531             }
11532             if ( s1.equals( s3 ) ) {
11533                 return false;
11534             }
11535             if ( s1.hashCode() != s1.hashCode() ) {
11536                 return false;
11537             }
11538             if ( s1.hashCode() != s2.hashCode() ) {
11539                 return false;
11540             }
11541             if ( s1.hashCode() == s3.hashCode() ) {
11542                 return false;
11543             }
11544             if ( s1.compareTo( s1 ) != 0 ) {
11545                 return false;
11546             }
11547             if ( s1.compareTo( s2 ) != 0 ) {
11548                 return false;
11549             }
11550             if ( s1.compareTo( s3 ) != 0 ) {
11551                 return false;
11552             }
11553             if ( s1.compareTo( s4 ) >= 0 ) {
11554                 return false;
11555             }
11556             if ( s4.compareTo( s1 ) <= 0 ) {
11557                 return false;
11558             }
11559             if ( !s4.getSpeciesId().equals( "b" ) ) {
11560                 return false;
11561             }
11562             final Species s5 = new BasicSpecies( " C " );
11563             if ( !s5.getSpeciesId().equals( "C" ) ) {
11564                 return false;
11565             }
11566             if ( s5.equals( s1 ) ) {
11567                 return false;
11568             }
11569         }
11570         catch ( final Exception e ) {
11571             e.printStackTrace( System.out );
11572             return false;
11573         }
11574         return true;
11575     }
11576
11577     private static boolean testSplit() {
11578         try {
11579             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
11580             final Phylogeny p0 = factory.create( "(((A,B,C),D),(E,(F,G)))R", new NHXParser() )[ 0 ];
11581             //Archaeopteryx.createApplication( p0 );
11582             final Set<PhylogenyNode> ex = new HashSet<PhylogenyNode>();
11583             ex.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11584             ex.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
11585             ex.add( PhylogenyNode.createInstanceFromNhxString( "C" ) );
11586             ex.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
11587             ex.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
11588             ex.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
11589             ex.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
11590             ex.add( PhylogenyNode.createInstanceFromNhxString( "X" ) );
11591             ex.add( PhylogenyNode.createInstanceFromNhxString( "Y" ) );
11592             final TreeSplitMatrix s0 = new TreeSplitMatrix( p0, false, ex );
11593             // System.out.println( s0.toString() );
11594             //
11595             Set<PhylogenyNode> query_nodes = new HashSet<PhylogenyNode>();
11596             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11597             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
11598             if ( s0.match( query_nodes ) ) {
11599                 return false;
11600             }
11601             query_nodes = new HashSet<PhylogenyNode>();
11602             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11603             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
11604             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "C" ) );
11605             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
11606             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
11607             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
11608             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
11609             if ( !s0.match( query_nodes ) ) {
11610                 return false;
11611             }
11612             //
11613             query_nodes = new HashSet<PhylogenyNode>();
11614             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11615             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
11616             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "C" ) );
11617             if ( !s0.match( query_nodes ) ) {
11618                 return false;
11619             }
11620             //
11621             query_nodes = new HashSet<PhylogenyNode>();
11622             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
11623             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
11624             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
11625             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
11626             if ( !s0.match( query_nodes ) ) {
11627                 return false;
11628             }
11629             //
11630             query_nodes = new HashSet<PhylogenyNode>();
11631             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11632             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
11633             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "C" ) );
11634             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
11635             if ( !s0.match( query_nodes ) ) {
11636                 return false;
11637             }
11638             //
11639             query_nodes = new HashSet<PhylogenyNode>();
11640             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
11641             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
11642             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
11643             if ( !s0.match( query_nodes ) ) {
11644                 return false;
11645             }
11646             query_nodes = new HashSet<PhylogenyNode>();
11647             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
11648             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
11649             if ( !s0.match( query_nodes ) ) {
11650                 return false;
11651             }
11652             query_nodes = new HashSet<PhylogenyNode>();
11653             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
11654             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
11655             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "C" ) );
11656             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
11657             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11658             if ( !s0.match( query_nodes ) ) {
11659                 return false;
11660             }
11661             query_nodes = new HashSet<PhylogenyNode>();
11662             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
11663             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
11664             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
11665             if ( !s0.match( query_nodes ) ) {
11666                 return false;
11667             }
11668             query_nodes = new HashSet<PhylogenyNode>();
11669             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
11670             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
11671             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
11672             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
11673             if ( !s0.match( query_nodes ) ) {
11674                 return false;
11675             }
11676             query_nodes = new HashSet<PhylogenyNode>();
11677             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
11678             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11679             if ( s0.match( query_nodes ) ) {
11680                 return false;
11681             }
11682             query_nodes = new HashSet<PhylogenyNode>();
11683             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11684             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
11685             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
11686             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "C" ) );
11687             if ( s0.match( query_nodes ) ) {
11688                 return false;
11689             }
11690             query_nodes = new HashSet<PhylogenyNode>();
11691             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
11692             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
11693             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
11694             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
11695             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "C" ) );
11696             if ( s0.match( query_nodes ) ) {
11697                 return false;
11698             }
11699             query_nodes = new HashSet<PhylogenyNode>();
11700             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11701             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
11702             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
11703             if ( s0.match( query_nodes ) ) {
11704                 return false;
11705             }
11706             query_nodes = new HashSet<PhylogenyNode>();
11707             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11708             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
11709             if ( s0.match( query_nodes ) ) {
11710                 return false;
11711             }
11712             query_nodes = new HashSet<PhylogenyNode>();
11713             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11714             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
11715             if ( s0.match( query_nodes ) ) {
11716                 return false;
11717             }
11718             query_nodes = new HashSet<PhylogenyNode>();
11719             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11720             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "C" ) );
11721             if ( s0.match( query_nodes ) ) {
11722                 return false;
11723             }
11724             query_nodes = new HashSet<PhylogenyNode>();
11725             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11726             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
11727             if ( s0.match( query_nodes ) ) {
11728                 return false;
11729             }
11730             query_nodes = new HashSet<PhylogenyNode>();
11731             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11732             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
11733             if ( s0.match( query_nodes ) ) {
11734                 return false;
11735             }
11736             query_nodes = new HashSet<PhylogenyNode>();
11737             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11738             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
11739             if ( s0.match( query_nodes ) ) {
11740                 return false;
11741             }
11742             query_nodes = new HashSet<PhylogenyNode>();
11743             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11744             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
11745             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
11746             if ( s0.match( query_nodes ) ) {
11747                 return false;
11748             }
11749             query_nodes = new HashSet<PhylogenyNode>();
11750             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11751             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
11752             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
11753             if ( s0.match( query_nodes ) ) {
11754                 return false;
11755             }
11756             query_nodes = new HashSet<PhylogenyNode>();
11757             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
11758             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
11759             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11760             if ( s0.match( query_nodes ) ) {
11761                 return false;
11762             }
11763             query_nodes = new HashSet<PhylogenyNode>();
11764             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
11765             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
11766             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11767             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
11768             if ( s0.match( query_nodes ) ) {
11769                 return false;
11770             }
11771             /////////
11772             //            query_nodes = new HashSet<PhylogenyNode>();
11773             //            query_nodes.add( new PhylogenyNode( "X" ) );
11774             //            query_nodes.add( new PhylogenyNode( "Y" ) );
11775             //            query_nodes.add( new PhylogenyNode( "A" ) );
11776             //            query_nodes.add( new PhylogenyNode( "B" ) );
11777             //            query_nodes.add( new PhylogenyNode( "C" ) );
11778             //            query_nodes.add( new PhylogenyNode( "D" ) );
11779             //            query_nodes.add( new PhylogenyNode( "E" ) );
11780             //            query_nodes.add( new PhylogenyNode( "F" ) );
11781             //            query_nodes.add( new PhylogenyNode( "G" ) );
11782             //            if ( !s0.match( query_nodes ) ) {
11783             //                return false;
11784             //            }
11785             //            query_nodes = new HashSet<PhylogenyNode>();
11786             //            query_nodes.add( new PhylogenyNode( "X" ) );
11787             //            query_nodes.add( new PhylogenyNode( "Y" ) );
11788             //            query_nodes.add( new PhylogenyNode( "A" ) );
11789             //            query_nodes.add( new PhylogenyNode( "B" ) );
11790             //            query_nodes.add( new PhylogenyNode( "C" ) );
11791             //            if ( !s0.match( query_nodes ) ) {
11792             //                return false;
11793             //            }
11794             //            //
11795             //            query_nodes = new HashSet<PhylogenyNode>();
11796             //            query_nodes.add( new PhylogenyNode( "X" ) );
11797             //            query_nodes.add( new PhylogenyNode( "Y" ) );
11798             //            query_nodes.add( new PhylogenyNode( "D" ) );
11799             //            query_nodes.add( new PhylogenyNode( "E" ) );
11800             //            query_nodes.add( new PhylogenyNode( "F" ) );
11801             //            query_nodes.add( new PhylogenyNode( "G" ) );
11802             //            if ( !s0.match( query_nodes ) ) {
11803             //                return false;
11804             //            }
11805             //            //
11806             //            query_nodes = new HashSet<PhylogenyNode>();
11807             //            query_nodes.add( new PhylogenyNode( "X" ) );
11808             //            query_nodes.add( new PhylogenyNode( "Y" ) );
11809             //            query_nodes.add( new PhylogenyNode( "A" ) );
11810             //            query_nodes.add( new PhylogenyNode( "B" ) );
11811             //            query_nodes.add( new PhylogenyNode( "C" ) );
11812             //            query_nodes.add( new PhylogenyNode( "D" ) );
11813             //            if ( !s0.match( query_nodes ) ) {
11814             //                return false;
11815             //            }
11816             //            //
11817             //            query_nodes = new HashSet<PhylogenyNode>();
11818             //            query_nodes.add( new PhylogenyNode( "X" ) );
11819             //            query_nodes.add( new PhylogenyNode( "Y" ) );
11820             //            query_nodes.add( new PhylogenyNode( "E" ) );
11821             //            query_nodes.add( new PhylogenyNode( "F" ) );
11822             //            query_nodes.add( new PhylogenyNode( "G" ) );
11823             //            if ( !s0.match( query_nodes ) ) {
11824             //                return false;
11825             //            }
11826             //            //
11827             //            query_nodes = new HashSet<PhylogenyNode>();
11828             //            query_nodes.add( new PhylogenyNode( "X" ) );
11829             //            query_nodes.add( new PhylogenyNode( "Y" ) );
11830             //            query_nodes.add( new PhylogenyNode( "F" ) );
11831             //            query_nodes.add( new PhylogenyNode( "G" ) );
11832             //            if ( !s0.match( query_nodes ) ) {
11833             //                return false;
11834             //            }
11835             //
11836             query_nodes = new HashSet<PhylogenyNode>();
11837             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "X" ) );
11838             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "Y" ) );
11839             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
11840             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
11841             if ( s0.match( query_nodes ) ) {
11842                 return false;
11843             }
11844             //
11845             query_nodes = new HashSet<PhylogenyNode>();
11846             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "X" ) );
11847             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "Y" ) );
11848             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11849             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
11850             if ( s0.match( query_nodes ) ) {
11851                 return false;
11852             }
11853             ///////////////////////////
11854             //
11855             query_nodes = new HashSet<PhylogenyNode>();
11856             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "X" ) );
11857             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "Y" ) );
11858             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11859             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
11860             if ( s0.match( query_nodes ) ) {
11861                 return false;
11862             }
11863             //
11864             query_nodes = new HashSet<PhylogenyNode>();
11865             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "X" ) );
11866             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "Y" ) );
11867             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11868             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
11869             if ( s0.match( query_nodes ) ) {
11870                 return false;
11871             }
11872             //
11873             query_nodes = new HashSet<PhylogenyNode>();
11874             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "X" ) );
11875             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "Y" ) );
11876             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11877             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "C" ) );
11878             if ( s0.match( query_nodes ) ) {
11879                 return false;
11880             }
11881             //
11882             query_nodes = new HashSet<PhylogenyNode>();
11883             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "X" ) );
11884             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "Y" ) );
11885             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11886             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
11887             if ( s0.match( query_nodes ) ) {
11888                 return false;
11889             }
11890             //
11891             query_nodes = new HashSet<PhylogenyNode>();
11892             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "X" ) );
11893             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "Y" ) );
11894             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11895             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
11896             if ( s0.match( query_nodes ) ) {
11897                 return false;
11898             }
11899             //
11900             query_nodes = new HashSet<PhylogenyNode>();
11901             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "Y" ) );
11902             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11903             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
11904             if ( s0.match( query_nodes ) ) {
11905                 return false;
11906             }
11907             //
11908             query_nodes = new HashSet<PhylogenyNode>();
11909             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "X" ) );
11910             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "Y" ) );
11911             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11912             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
11913             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
11914             if ( s0.match( query_nodes ) ) {
11915                 return false;
11916             }
11917             //
11918             query_nodes = new HashSet<PhylogenyNode>();
11919             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "X" ) );
11920             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "Y" ) );
11921             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11922             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
11923             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
11924             if ( s0.match( query_nodes ) ) {
11925                 return false;
11926             }
11927             //
11928             query_nodes = new HashSet<PhylogenyNode>();
11929             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "X" ) );
11930             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "Y" ) );
11931             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
11932             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
11933             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11934             if ( s0.match( query_nodes ) ) {
11935                 return false;
11936             }
11937             //
11938             query_nodes = new HashSet<PhylogenyNode>();
11939             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "X" ) );
11940             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "Y" ) );
11941             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
11942             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
11943             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11944             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
11945             if ( s0.match( query_nodes ) ) {
11946                 return false;
11947             }
11948         }
11949         catch ( final Exception e ) {
11950             e.printStackTrace();
11951             return false;
11952         }
11953         return true;
11954     }
11955
11956     private static boolean testSplitStrict() {
11957         try {
11958             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
11959             final Phylogeny p0 = factory.create( "(((A,B,C),D),(E,(F,G)))R", new NHXParser() )[ 0 ];
11960             final Set<PhylogenyNode> ex = new HashSet<PhylogenyNode>();
11961             ex.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11962             ex.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
11963             ex.add( PhylogenyNode.createInstanceFromNhxString( "C" ) );
11964             ex.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
11965             ex.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
11966             ex.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
11967             ex.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
11968             final TreeSplitMatrix s0 = new TreeSplitMatrix( p0, true, ex );
11969             Set<PhylogenyNode> query_nodes = new HashSet<PhylogenyNode>();
11970             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11971             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
11972             if ( s0.match( query_nodes ) ) {
11973                 return false;
11974             }
11975             query_nodes = new HashSet<PhylogenyNode>();
11976             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11977             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
11978             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "C" ) );
11979             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
11980             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
11981             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
11982             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
11983             if ( !s0.match( query_nodes ) ) {
11984                 return false;
11985             }
11986             //
11987             query_nodes = new HashSet<PhylogenyNode>();
11988             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
11989             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
11990             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "C" ) );
11991             if ( !s0.match( query_nodes ) ) {
11992                 return false;
11993             }
11994             //
11995             query_nodes = new HashSet<PhylogenyNode>();
11996             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
11997             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
11998             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
11999             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
12000             if ( !s0.match( query_nodes ) ) {
12001                 return false;
12002             }
12003             //
12004             query_nodes = new HashSet<PhylogenyNode>();
12005             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12006             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
12007             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "C" ) );
12008             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
12009             if ( !s0.match( query_nodes ) ) {
12010                 return false;
12011             }
12012             //
12013             query_nodes = new HashSet<PhylogenyNode>();
12014             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
12015             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
12016             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
12017             if ( !s0.match( query_nodes ) ) {
12018                 return false;
12019             }
12020             //
12021             query_nodes = new HashSet<PhylogenyNode>();
12022             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
12023             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
12024             if ( !s0.match( query_nodes ) ) {
12025                 return false;
12026             }
12027             //
12028             query_nodes = new HashSet<PhylogenyNode>();
12029             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
12030             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
12031             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "C" ) );
12032             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
12033             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12034             if ( !s0.match( query_nodes ) ) {
12035                 return false;
12036             }
12037             //
12038             query_nodes = new HashSet<PhylogenyNode>();
12039             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
12040             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
12041             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
12042             if ( !s0.match( query_nodes ) ) {
12043                 return false;
12044             }
12045             //
12046             query_nodes = new HashSet<PhylogenyNode>();
12047             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
12048             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
12049             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
12050             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
12051             if ( !s0.match( query_nodes ) ) {
12052                 return false;
12053             }
12054             //
12055             query_nodes = new HashSet<PhylogenyNode>();
12056             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
12057             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12058             if ( s0.match( query_nodes ) ) {
12059                 return false;
12060             }
12061             //
12062             query_nodes = new HashSet<PhylogenyNode>();
12063             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12064             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
12065             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
12066             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "C" ) );
12067             if ( s0.match( query_nodes ) ) {
12068                 return false;
12069             }
12070             //
12071             query_nodes = new HashSet<PhylogenyNode>();
12072             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
12073             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
12074             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
12075             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
12076             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "C" ) );
12077             if ( s0.match( query_nodes ) ) {
12078                 return false;
12079             }
12080             //
12081             query_nodes = new HashSet<PhylogenyNode>();
12082             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12083             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
12084             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
12085             if ( s0.match( query_nodes ) ) {
12086                 return false;
12087             }
12088             //
12089             query_nodes = new HashSet<PhylogenyNode>();
12090             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12091             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
12092             if ( s0.match( query_nodes ) ) {
12093                 return false;
12094             }
12095             //
12096             query_nodes = new HashSet<PhylogenyNode>();
12097             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12098             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
12099             if ( s0.match( query_nodes ) ) {
12100                 return false;
12101             }
12102             //
12103             query_nodes = new HashSet<PhylogenyNode>();
12104             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12105             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "C" ) );
12106             if ( s0.match( query_nodes ) ) {
12107                 return false;
12108             }
12109             //
12110             query_nodes = new HashSet<PhylogenyNode>();
12111             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12112             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
12113             if ( s0.match( query_nodes ) ) {
12114                 return false;
12115             }
12116             //
12117             query_nodes = new HashSet<PhylogenyNode>();
12118             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12119             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
12120             if ( s0.match( query_nodes ) ) {
12121                 return false;
12122             }
12123             //
12124             query_nodes = new HashSet<PhylogenyNode>();
12125             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12126             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
12127             if ( s0.match( query_nodes ) ) {
12128                 return false;
12129             }
12130             //
12131             query_nodes = new HashSet<PhylogenyNode>();
12132             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12133             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "F" ) );
12134             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
12135             if ( s0.match( query_nodes ) ) {
12136                 return false;
12137             }
12138             //
12139             query_nodes = new HashSet<PhylogenyNode>();
12140             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12141             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "B" ) );
12142             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
12143             if ( s0.match( query_nodes ) ) {
12144                 return false;
12145             }
12146             //
12147             query_nodes = new HashSet<PhylogenyNode>();
12148             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
12149             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
12150             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12151             if ( s0.match( query_nodes ) ) {
12152                 return false;
12153             }
12154             //
12155             query_nodes = new HashSet<PhylogenyNode>();
12156             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "E" ) );
12157             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "D" ) );
12158             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "A" ) );
12159             query_nodes.add( PhylogenyNode.createInstanceFromNhxString( "G" ) );
12160             if ( s0.match( query_nodes ) ) {
12161                 return false;
12162             }
12163         }
12164         catch ( final Exception e ) {
12165             e.printStackTrace();
12166             return false;
12167         }
12168         return true;
12169     }
12170
12171     private static boolean testSubtreeDeletion() {
12172         try {
12173             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
12174             final Phylogeny t1 = factory.create( "((A,B,C)abc,(D,E,F)def)r", new NHXParser() )[ 0 ];
12175             t1.deleteSubtree( t1.getNode( "A" ), false );
12176             if ( t1.getNumberOfExternalNodes() != 5 ) {
12177                 return false;
12178             }
12179             t1.toNewHampshireX();
12180             t1.deleteSubtree( t1.getNode( "E" ), false );
12181             if ( t1.getNumberOfExternalNodes() != 4 ) {
12182                 return false;
12183             }
12184             t1.toNewHampshireX();
12185             t1.deleteSubtree( t1.getNode( "F" ), false );
12186             if ( t1.getNumberOfExternalNodes() != 3 ) {
12187                 return false;
12188             }
12189             t1.toNewHampshireX();
12190             t1.deleteSubtree( t1.getNode( "D" ), false );
12191             t1.toNewHampshireX();
12192             if ( t1.getNumberOfExternalNodes() != 3 ) {
12193                 return false;
12194             }
12195             t1.deleteSubtree( t1.getNode( "def" ), false );
12196             t1.toNewHampshireX();
12197             if ( t1.getNumberOfExternalNodes() != 2 ) {
12198                 return false;
12199             }
12200             t1.deleteSubtree( t1.getNode( "B" ), false );
12201             t1.toNewHampshireX();
12202             if ( t1.getNumberOfExternalNodes() != 1 ) {
12203                 return false;
12204             }
12205             t1.deleteSubtree( t1.getNode( "C" ), false );
12206             t1.toNewHampshireX();
12207             if ( t1.getNumberOfExternalNodes() != 1 ) {
12208                 return false;
12209             }
12210             t1.deleteSubtree( t1.getNode( "abc" ), false );
12211             t1.toNewHampshireX();
12212             if ( t1.getNumberOfExternalNodes() != 1 ) {
12213                 return false;
12214             }
12215             t1.deleteSubtree( t1.getNode( "r" ), false );
12216             if ( t1.getNumberOfExternalNodes() != 0 ) {
12217                 return false;
12218             }
12219             if ( !t1.isEmpty() ) {
12220                 return false;
12221             }
12222             final Phylogeny t2 = factory.create( "(((1,2,3)A,B,C)abc,(D,E,F)def)r", new NHXParser() )[ 0 ];
12223             t2.deleteSubtree( t2.getNode( "A" ), false );
12224             t2.toNewHampshireX();
12225             if ( t2.getNumberOfExternalNodes() != 5 ) {
12226                 return false;
12227             }
12228             t2.deleteSubtree( t2.getNode( "abc" ), false );
12229             t2.toNewHampshireX();
12230             if ( t2.getNumberOfExternalNodes() != 3 ) {
12231                 return false;
12232             }
12233             t2.deleteSubtree( t2.getNode( "def" ), false );
12234             t2.toNewHampshireX();
12235             if ( t2.getNumberOfExternalNodes() != 1 ) {
12236                 return false;
12237             }
12238         }
12239         catch ( final Exception e ) {
12240             e.printStackTrace( System.out );
12241             return false;
12242         }
12243         return true;
12244     }
12245
12246     private static boolean testSupportCount() {
12247         try {
12248             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
12249             final Phylogeny t0_1 = factory.create( "(((A,B),C),(D,E))", new NHXParser() )[ 0 ];
12250             final Phylogeny[] phylogenies_1 = factory.create( "(((A,B),C),(D,E)) " + "(((C,B),A),(D,E))"
12251                     + "(((A,B),C),(D,E)) " + "(((A,B),C),(D,E))"
12252                     + "(((A,B),C),(D,E))" + "(((C,B),A),(D,E))"
12253                     + "(((E,B),D),(C,A))" + "(((C,B),A),(D,E))"
12254                     + "(((A,B),C),(D,E))" + "(((A,B),C),(D,E))",
12255                     new NHXParser() );
12256             SupportCount.count( t0_1, phylogenies_1, true, false );
12257             final Phylogeny t0_2 = factory.create( "(((((A,B),C),D),E),(F,G))", new NHXParser() )[ 0 ];
12258             final Phylogeny[] phylogenies_2 = factory.create( "(((((A,B),C),D),E),(F,G))"
12259                     + "(((((A,B),C),D),E),((F,G),X))"
12260                     + "(((((A,Y),B),C),D),((F,G),E))"
12261                     + "(((((A,B),C),D),E),(F,G))"
12262                     + "(((((A,B),C),D),E),(F,G))"
12263                     + "(((((A,B),C),D),E),(F,G))"
12264                     + "(((((A,B),C),D),E),(F,G),Z)"
12265                     + "(((((A,B),C),D),E),(F,G))"
12266                     + "((((((A,B),C),D),E),F),G)"
12267                     + "(((((X,Y),F,G),E),((A,B),C)),D)",
12268                     new NHXParser() );
12269             SupportCount.count( t0_2, phylogenies_2, true, false );
12270             final PhylogenyNodeIterator it = t0_2.iteratorPostorder();
12271             while ( it.hasNext() ) {
12272                 final PhylogenyNode n = it.next();
12273                 if ( !n.isExternal() && ( PhylogenyMethods.getConfidenceValue( n ) != 10 ) ) {
12274                     return false;
12275                 }
12276             }
12277             final Phylogeny t0_3 = factory.create( "(((A,B)ab,C)abc,((D,E)de,F)def)", new NHXParser() )[ 0 ];
12278             final Phylogeny[] phylogenies_3 = factory.create( "(((A,B),C),((D,E),F))" + "(((A,C),B),((D,F),E))"
12279                     + "(((C,A),B),((F,D),E))" + "(((A,B),F),((D,E),C))" + "(((((A,B),C),D),E),F)", new NHXParser() );
12280             SupportCount.count( t0_3, phylogenies_3, true, false );
12281             t0_3.reRoot( t0_3.getNode( "def" ).getId() );
12282             if ( PhylogenyMethods.getConfidenceValue( t0_3.getNode( "ab" ) ) != 3 ) {
12283                 return false;
12284             }
12285             if ( PhylogenyMethods.getConfidenceValue( t0_3.getNode( "abc" ) ) != 4 ) {
12286                 return false;
12287             }
12288             if ( PhylogenyMethods.getConfidenceValue( t0_3.getNode( "def" ) ) != 4 ) {
12289                 return false;
12290             }
12291             if ( PhylogenyMethods.getConfidenceValue( t0_3.getNode( "de" ) ) != 2 ) {
12292                 return false;
12293             }
12294             if ( PhylogenyMethods.getConfidenceValue( t0_3.getNode( "A" ) ) != 5 ) {
12295                 return false;
12296             }
12297             if ( PhylogenyMethods.getConfidenceValue( t0_3.getNode( "B" ) ) != 5 ) {
12298                 return false;
12299             }
12300             if ( PhylogenyMethods.getConfidenceValue( t0_3.getNode( "C" ) ) != 5 ) {
12301                 return false;
12302             }
12303             if ( PhylogenyMethods.getConfidenceValue( t0_3.getNode( "D" ) ) != 5 ) {
12304                 return false;
12305             }
12306             if ( PhylogenyMethods.getConfidenceValue( t0_3.getNode( "E" ) ) != 5 ) {
12307                 return false;
12308             }
12309             if ( PhylogenyMethods.getConfidenceValue( t0_3.getNode( "F" ) ) != 5 ) {
12310                 return false;
12311             }
12312             final Phylogeny t0_4 = factory.create( "(((((A,B)1,C)2,D)3,E)4,F)", new NHXParser() )[ 0 ];
12313             final Phylogeny[] phylogenies_4 = factory.create( "((((((A,X),C),B),D),E),F) "
12314                     + "(((A,B,Z),C,Q),(((D,Y),E),F))", new NHXParser() );
12315             SupportCount.count( t0_4, phylogenies_4, true, false );
12316             t0_4.reRoot( t0_4.getNode( "F" ).getId() );
12317             if ( PhylogenyMethods.getConfidenceValue( t0_4.getNode( "1" ) ) != 1 ) {
12318                 return false;
12319             }
12320             if ( PhylogenyMethods.getConfidenceValue( t0_4.getNode( "2" ) ) != 2 ) {
12321                 return false;
12322             }
12323             if ( PhylogenyMethods.getConfidenceValue( t0_4.getNode( "3" ) ) != 1 ) {
12324                 return false;
12325             }
12326             if ( PhylogenyMethods.getConfidenceValue( t0_4.getNode( "4" ) ) != 2 ) {
12327                 return false;
12328             }
12329             if ( PhylogenyMethods.getConfidenceValue( t0_4.getNode( "A" ) ) != 2 ) {
12330                 return false;
12331             }
12332             if ( PhylogenyMethods.getConfidenceValue( t0_4.getNode( "B" ) ) != 2 ) {
12333                 return false;
12334             }
12335             if ( PhylogenyMethods.getConfidenceValue( t0_4.getNode( "C" ) ) != 2 ) {
12336                 return false;
12337             }
12338             if ( PhylogenyMethods.getConfidenceValue( t0_4.getNode( "D" ) ) != 2 ) {
12339                 return false;
12340             }
12341             if ( PhylogenyMethods.getConfidenceValue( t0_4.getNode( "E" ) ) != 2 ) {
12342                 return false;
12343             }
12344             if ( PhylogenyMethods.getConfidenceValue( t0_4.getNode( "F" ) ) != 2 ) {
12345                 return false;
12346             }
12347             Phylogeny a = factory.create( "(((((A,B)1,C)2,D)3,E)4,F)", new NHXParser() )[ 0 ];
12348             final Phylogeny b1 = factory.create( "(((((B,A)1,C)2,D)3,E)4,F)", new NHXParser() )[ 0 ];
12349             double d = SupportCount.compare( b1, a, true, true, true );
12350             if ( !Test.isEqual( d, 5.0 / 5.0 ) ) {
12351                 return false;
12352             }
12353             a = factory.create( "(((((A,B)1,C)2,D)3,E)4,F)", new NHXParser() )[ 0 ];
12354             final Phylogeny b2 = factory.create( "(((((C,B)1,A)2,D)3,E)4,F)", new NHXParser() )[ 0 ];
12355             d = SupportCount.compare( b2, a, true, true, true );
12356             if ( !Test.isEqual( d, 4.0 / 5.0 ) ) {
12357                 return false;
12358             }
12359             a = factory.create( "(((((A,B)1,C)2,D)3,E)4,F)", new NHXParser() )[ 0 ];
12360             final Phylogeny b3 = factory.create( "(((((F,C)1,A)2,B)3,D)4,E)", new NHXParser() )[ 0 ];
12361             d = SupportCount.compare( b3, a, true, true, true );
12362             if ( !Test.isEqual( d, 2.0 / 5.0 ) ) {
12363                 return false;
12364             }
12365             a = factory.create( "(((((A,B)1,C)2,D)3,E)4,F)r", new NHXParser() )[ 0 ];
12366             final Phylogeny b4 = factory.create( "(((((F,C)1,A)2,B)3,D)4,E)r", new NHXParser() )[ 0 ];
12367             d = SupportCount.compare( b4, a, true, true, false );
12368             if ( !Test.isEqual( d, 1.0 / 5.0 ) ) {
12369                 return false;
12370             }
12371         }
12372         catch ( final Exception e ) {
12373             e.printStackTrace( System.out );
12374             return false;
12375         }
12376         return true;
12377     }
12378
12379     private static boolean testSupportTransfer() {
12380         try {
12381             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
12382             final Phylogeny p1 = factory.create( "(((A,B)ab:97,C)abc:57,((D,E)de:10,(F,G)fg:50,(H,I)hi:64)defghi)",
12383                                                  new NHXParser() )[ 0 ];
12384             final Phylogeny p2 = factory
12385                     .create( "(((A:0.1,B:0.3)ab:0.4,C)abc:0.5,((D,E)de,(F,G)fg,(H,I)hi:0.59)defghi)", new NHXParser() )[ 0 ];
12386             if ( PhylogenyMethods.getConfidenceValue( p2.getNode( "ab" ) ) >= 0.0 ) {
12387                 return false;
12388             }
12389             if ( PhylogenyMethods.getConfidenceValue( p2.getNode( "abc" ) ) >= 0.0 ) {
12390                 return false;
12391             }
12392             support_transfer.moveBranchLengthsToBootstrap( p1 );
12393             support_transfer.transferSupportValues( p1, p2 );
12394             if ( p2.getNode( "ab" ).getDistanceToParent() != 0.4 ) {
12395                 return false;
12396             }
12397             if ( p2.getNode( "abc" ).getDistanceToParent() != 0.5 ) {
12398                 return false;
12399             }
12400             if ( p2.getNode( "hi" ).getDistanceToParent() != 0.59 ) {
12401                 return false;
12402             }
12403             if ( PhylogenyMethods.getConfidenceValue( p2.getNode( "ab" ) ) != 97 ) {
12404                 return false;
12405             }
12406             if ( PhylogenyMethods.getConfidenceValue( p2.getNode( "abc" ) ) != 57 ) {
12407                 return false;
12408             }
12409             if ( PhylogenyMethods.getConfidenceValue( p2.getNode( "de" ) ) != 10 ) {
12410                 return false;
12411             }
12412             if ( PhylogenyMethods.getConfidenceValue( p2.getNode( "fg" ) ) != 50 ) {
12413                 return false;
12414             }
12415             if ( PhylogenyMethods.getConfidenceValue( p2.getNode( "hi" ) ) != 64 ) {
12416                 return false;
12417             }
12418         }
12419         catch ( final Exception e ) {
12420             e.printStackTrace( System.out );
12421             return false;
12422         }
12423         return true;
12424     }
12425
12426     private static boolean testTaxonomyExtraction() {
12427         try {
12428             final PhylogenyNode n0 = PhylogenyNode
12429                     .createInstanceFromNhxString( "sd_12345678", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
12430             if ( n0.getNodeData().isHasTaxonomy() ) {
12431                 return false;
12432             }
12433             final PhylogenyNode n1 = PhylogenyNode
12434                     .createInstanceFromNhxString( "sd_12345x", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
12435             if ( n1.getNodeData().isHasTaxonomy() ) {
12436                 System.out.println( n1.toString() );
12437                 return false;
12438             }
12439             final PhylogenyNode n2x = PhylogenyNode
12440                     .createInstanceFromNhxString( "12345", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
12441             if ( n2x.getNodeData().isHasTaxonomy() ) {
12442                 return false;
12443             }
12444             final PhylogenyNode n3 = PhylogenyNode
12445                     .createInstanceFromNhxString( "BLAG_12345", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
12446             if ( !n3.getNodeData().getTaxonomy().getIdentifier().getValue().equals( "12345" ) ) {
12447                 System.out.println( n3.toString() );
12448                 return false;
12449             }
12450             final PhylogenyNode n4 = PhylogenyNode
12451                     .createInstanceFromNhxString( "blag-12345", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
12452             if ( n4.getNodeData().isHasTaxonomy() ) {
12453                 System.out.println( n4.toString() );
12454                 return false;
12455             }
12456             final PhylogenyNode n5 = PhylogenyNode
12457                     .createInstanceFromNhxString( "12345-blag", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
12458             if ( n5.getNodeData().isHasTaxonomy() ) {
12459                 System.out.println( n5.toString() );
12460                 return false;
12461             }
12462             final PhylogenyNode n6 = PhylogenyNode
12463                     .createInstanceFromNhxString( "BLAG-12345-blag", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
12464             if ( n6.getNodeData().isHasTaxonomy() ) {
12465                 System.out.println( n6.toString() );
12466                 return false;
12467             }
12468             final PhylogenyNode n7 = PhylogenyNode
12469                     .createInstanceFromNhxString( "BLAG-12345_blag", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
12470             if ( n7.getNodeData().isHasTaxonomy() ) {
12471                 System.out.println( n7.toString() );
12472                 return false;
12473             }
12474             final PhylogenyNode n8 = PhylogenyNode
12475                     .createInstanceFromNhxString( "BLAG_12345-blag", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
12476             if ( !n8.getNodeData().getTaxonomy().getIdentifier().getValue().equals( "12345" ) ) {
12477                 System.out.println( n8.toString() );
12478                 return false;
12479             }
12480             final PhylogenyNode n9 = PhylogenyNode
12481                     .createInstanceFromNhxString( "BLAG_12345/blag", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
12482             if ( !n9.getNodeData().getTaxonomy().getIdentifier().getValue().equals( "12345" ) ) {
12483                 System.out.println( n9.toString() );
12484                 return false;
12485             }
12486             final PhylogenyNode n10x = PhylogenyNode
12487                     .createInstanceFromNhxString( "BLAG_12X45-blag", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
12488             if ( n10x.getNodeData().isHasTaxonomy() ) {
12489                 System.out.println( n10x.toString() );
12490                 return false;
12491             }
12492             final PhylogenyNode n10xx = PhylogenyNode
12493                     .createInstanceFromNhxString( "BLAG_1YX45-blag", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
12494             if ( n10xx.getNodeData().isHasTaxonomy() ) {
12495                 System.out.println( n10xx.toString() );
12496                 return false;
12497             }
12498             final PhylogenyNode n10 = PhylogenyNode
12499                     .createInstanceFromNhxString( "BLAG_9YX45-blag", NHXParser.TAXONOMY_EXTRACTION.PFAM_STYLE_RELAXED );
12500             if ( !n10.getNodeData().getTaxonomy().getTaxonomyCode().equals( "9YX45" ) ) {
12501                 System.out.println( n10.toString() );
12502                 return false;
12503             }
12504             final PhylogenyNode n11 = PhylogenyNode
12505                     .createInstanceFromNhxString( "BLAG_Mus_musculus", NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
12506             if ( !n11.getNodeData().getTaxonomy().getScientificName().equals( "Mus musculus" ) ) {
12507                 System.out.println( n11.toString() );
12508                 return false;
12509             }
12510             final PhylogenyNode n12 = PhylogenyNode
12511                     .createInstanceFromNhxString( "BLAG_Mus_musculus_musculus",
12512                                                   NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
12513             if ( !n12.getNodeData().getTaxonomy().getScientificName().equals( "Mus musculus musculus" ) ) {
12514                 System.out.println( n12.toString() );
12515                 return false;
12516             }
12517             final PhylogenyNode n13 = PhylogenyNode
12518                     .createInstanceFromNhxString( "BLAG_Mus_musculus1", NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
12519             if ( n13.getNodeData().isHasTaxonomy() ) {
12520                 System.out.println( n13.toString() );
12521                 return false;
12522             }
12523             final PhylogenyNode n14 = PhylogenyNode
12524                     .createInstanceFromNhxString( "Mus_musculus_392", NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
12525             if ( !n14.getNodeData().getTaxonomy().getScientificName().equals( "Mus musculus" ) ) {
12526                 System.out.println( n14.toString() );
12527                 return false;
12528             }
12529             final PhylogenyNode n15 = PhylogenyNode
12530                     .createInstanceFromNhxString( "Mus_musculus_K392", NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
12531             if ( !n15.getNodeData().getTaxonomy().getScientificName().equals( "Mus musculus" ) ) {
12532                 System.out.println( n15.toString() );
12533                 return false;
12534             }
12535             final PhylogenyNode n16 = PhylogenyNode
12536                     .createInstanceFromNhxString( "Mus musculus 392", NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
12537             if ( !n16.getNodeData().getTaxonomy().getScientificName().equals( "Mus musculus" ) ) {
12538                 System.out.println( n16.toString() );
12539                 return false;
12540             }
12541             final PhylogenyNode n17 = PhylogenyNode
12542                     .createInstanceFromNhxString( "Mus musculus K392", NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
12543             if ( !n17.getNodeData().getTaxonomy().getScientificName().equals( "Mus musculus" ) ) {
12544                 System.out.println( n17.toString() );
12545                 return false;
12546             }
12547             final PhylogenyNode n18 = PhylogenyNode
12548                     .createInstanceFromNhxString( "Mus_musculus_musculus_392", NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
12549             if ( !n18.getNodeData().getTaxonomy().getScientificName().equals( "Mus musculus musculus" ) ) {
12550                 System.out.println( n18.toString() );
12551                 return false;
12552             }
12553             final PhylogenyNode n19 = PhylogenyNode
12554                     .createInstanceFromNhxString( "Mus_musculus_musculus_K392",
12555                                                   NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
12556             if ( !n19.getNodeData().getTaxonomy().getScientificName().equals( "Mus musculus musculus" ) ) {
12557                 System.out.println( n19.toString() );
12558                 return false;
12559             }
12560             final PhylogenyNode n20 = PhylogenyNode
12561                     .createInstanceFromNhxString( "Mus musculus musculus 392", NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
12562             if ( !n20.getNodeData().getTaxonomy().getScientificName().equals( "Mus musculus musculus" ) ) {
12563                 System.out.println( n20.toString() );
12564                 return false;
12565             }
12566             final PhylogenyNode n21 = PhylogenyNode
12567                     .createInstanceFromNhxString( "Mus musculus musculus K392",
12568                                                   NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
12569             if ( !n21.getNodeData().getTaxonomy().getScientificName().equals( "Mus musculus musculus" ) ) {
12570                 System.out.println( n21.toString() );
12571                 return false;
12572             }
12573             final PhylogenyNode n23 = PhylogenyNode
12574                     .createInstanceFromNhxString( "9EMVE_Nematostella_vectensis",
12575                                                   NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
12576             if ( !n23.getNodeData().getTaxonomy().getScientificName().equals( "Nematostella vectensis" ) ) {
12577                 System.out.println( n23.toString() );
12578                 return false;
12579             }
12580             final PhylogenyNode n24 = PhylogenyNode
12581                     .createInstanceFromNhxString( "9EMVE_Nematostella", NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
12582             if ( !n24.getNodeData().getTaxonomy().getTaxonomyCode().equals( "9EMVE" ) ) {
12583                 System.out.println( n24.toString() );
12584                 return false;
12585             }
12586             //
12587             final PhylogenyNode n25 = PhylogenyNode
12588                     .createInstanceFromNhxString( "Nematostella_vectensis_NEMVE",
12589                                                   NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
12590             if ( !n25.getNodeData().getTaxonomy().getTaxonomyCode().equals( "NEMVE" ) ) {
12591                 System.out.println( n25.toString() );
12592                 return false;
12593             }
12594             final PhylogenyNode n26 = PhylogenyNode
12595                     .createInstanceFromNhxString( "Nematostella_vectensis_9EMVE",
12596                                                   NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
12597             if ( !n26.getNodeData().getTaxonomy().getScientificName().equals( "Nematostella vectensis" ) ) {
12598                 System.out.println( n26.toString() );
12599                 return false;
12600             }
12601             final PhylogenyNode n27 = PhylogenyNode
12602                     .createInstanceFromNhxString( "Nematostella_9EMVE", NHXParser.TAXONOMY_EXTRACTION.AGGRESSIVE );
12603             if ( !n27.getNodeData().getTaxonomy().getTaxonomyCode().equals( "9EMVE" ) ) {
12604                 System.out.println( n27.toString() );
12605                 return false;
12606             }
12607         }
12608         catch ( final Exception e ) {
12609             e.printStackTrace( System.out );
12610             return false;
12611         }
12612         return true;
12613     }
12614
12615     private static boolean testTreeCopy() {
12616         try {
12617             final String str_0 = "((((a,b),c),d)[&&NHX:S=lizards],e[&&NHX:S=reptiles])r[&&NHX:S=animals]";
12618             final Phylogeny t0 = Phylogeny.createInstanceFromNhxString( str_0 );
12619             final Phylogeny t1 = t0.copy();
12620             if ( !t1.toNewHampshireX().equals( t0.toNewHampshireX() ) ) {
12621                 return false;
12622             }
12623             if ( !t1.toNewHampshireX().equals( str_0 ) ) {
12624                 return false;
12625             }
12626             t0.deleteSubtree( t0.getNode( "c" ), true );
12627             t0.deleteSubtree( t0.getNode( "a" ), true );
12628             t0.getRoot().getNodeData().getTaxonomy().setScientificName( "metazoa" );
12629             t0.getNode( "b" ).setName( "Bee" );
12630             if ( !t0.toNewHampshireX().equals( "((Bee,d)[&&NHX:S=lizards],e[&&NHX:S=reptiles])r[&&NHX:S=metazoa]" ) ) {
12631                 return false;
12632             }
12633             if ( !t1.toNewHampshireX().equals( str_0 ) ) {
12634                 return false;
12635             }
12636             t0.deleteSubtree( t0.getNode( "e" ), true );
12637             t0.deleteSubtree( t0.getNode( "Bee" ), true );
12638             t0.deleteSubtree( t0.getNode( "d" ), true );
12639             if ( !t1.toNewHampshireX().equals( str_0 ) ) {
12640                 return false;
12641             }
12642         }
12643         catch ( final Exception e ) {
12644             e.printStackTrace();
12645             return false;
12646         }
12647         return true;
12648     }
12649
12650     private static boolean testTreeMethods() {
12651         try {
12652             final PhylogenyFactory factory = ParserBasedPhylogenyFactory.getInstance();
12653             final Phylogeny t0 = factory.create( "((((A,B)ab,C)abc,D)abcd,E)", new NHXParser() )[ 0 ];
12654             PhylogenyMethods.collapseSubtreeStructure( t0.getNode( "abcd" ) );
12655             if ( !t0.toNewHampshireX().equals( "((A,B,C,D)abcd,E)" ) ) {
12656                 System.out.println( t0.toNewHampshireX() );
12657                 return false;
12658             }
12659             final Phylogeny t1 = factory.create( "((((A:0.1,B)ab:0.2,C)abc:0.3,D)abcd:0.4,E)", new NHXParser() )[ 0 ];
12660             PhylogenyMethods.collapseSubtreeStructure( t1.getNode( "abcd" ) );
12661             if ( !isEqual( t1.getNode( "A" ).getDistanceToParent(), 0.6 ) ) {
12662                 return false;
12663             }
12664             if ( !isEqual( t1.getNode( "B" ).getDistanceToParent(), 0.5 ) ) {
12665                 return false;
12666             }
12667             if ( !isEqual( t1.getNode( "C" ).getDistanceToParent(), 0.3 ) ) {
12668                 return false;
12669             }
12670         }
12671         catch ( final Exception e ) {
12672             e.printStackTrace( System.out );
12673             return false;
12674         }
12675         return true;
12676     }
12677
12678     private static boolean testUniprotEntryRetrieval() {
12679         try {
12680             final SequenceDatabaseEntry entry = SequenceDbWsTools.obtainUniProtEntry( "P12345", 5000 );
12681             if ( !entry.getAccession().equals( "P12345" ) ) {
12682                 return false;
12683             }
12684             if ( !entry.getTaxonomyScientificName().equals( "Oryctolagus cuniculus" ) ) {
12685                 return false;
12686             }
12687             if ( !entry.getSequenceName().equals( "Aspartate aminotransferase, mitochondrial" ) ) {
12688                 return false;
12689             }
12690             if ( !entry.getSequenceSymbol().equals( "mAspAT" ) ) {
12691                 return false;
12692             }
12693             if ( !entry.getGeneName().equals( "GOT2" ) ) {
12694                 return false;
12695             }
12696             if ( !entry.getTaxonomyIdentifier().equals( "9986" ) ) {
12697                 return false;
12698             }
12699             if ( entry.getMolecularSequence() == null ) {
12700                 return false;
12701             }
12702             if ( !entry
12703                     .getMolecularSequence()
12704                     .getMolecularSequenceAsString()
12705                     .startsWith( "MALLHSARVLSGVASAFHPGLAAAASARASSWWAHVEMGPPDPILGVTEAYKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKGLDKEYLPIGGLAEFCRASAELALGENSEV" )
12706                     || !entry.getMolecularSequence().getMolecularSequenceAsString().endsWith( "LAHAIHQVTK" ) ) {
12707                 System.out.println( "got: " + entry.getMolecularSequence().getMolecularSequenceAsString() );
12708                 System.out.println( "expected something else." );
12709                 return false;
12710             }
12711         }
12712         catch ( final IOException e ) {
12713             System.out.println();
12714             System.out.println( "the following might be due to absence internet connection:" );
12715             e.printStackTrace( System.out );
12716             return true;
12717         }
12718         catch ( final NullPointerException f ) {
12719             f.printStackTrace( System.out );
12720             return false;
12721         }
12722         catch ( final Exception e ) {
12723             return false;
12724         }
12725         return true;
12726     }
12727
12728     private static boolean testUniprotTaxonomySearch() {
12729         try {
12730             List<UniProtTaxonomy> results = SequenceDbWsTools.getTaxonomiesFromCommonNameStrict( "starlet sea anemone",
12731                                                                                                  10 );
12732             if ( results.size() != 1 ) {
12733                 return false;
12734             }
12735             if ( !results.get( 0 ).getCode().equals( "NEMVE" ) ) {
12736                 return false;
12737             }
12738             if ( !results.get( 0 ).getCommonName().equalsIgnoreCase( "starlet sea anemone" ) ) {
12739                 return false;
12740             }
12741             if ( !results.get( 0 ).getId().equalsIgnoreCase( "45351" ) ) {
12742                 return false;
12743             }
12744             if ( !results.get( 0 ).getRank().equalsIgnoreCase( "species" ) ) {
12745                 return false;
12746             }
12747             if ( !results.get( 0 ).getScientificName().equals( "Nematostella vectensis" ) ) {
12748                 return false;
12749             }
12750             results = null;
12751             results = SequenceDbWsTools.getTaxonomiesFromScientificNameStrict( "Nematostella vectensis", 10 );
12752             if ( results.size() != 1 ) {
12753                 return false;
12754             }
12755             if ( !results.get( 0 ).getCode().equals( "NEMVE" ) ) {
12756                 return false;
12757             }
12758             if ( !results.get( 0 ).getCommonName().equalsIgnoreCase( "starlet sea anemone" ) ) {
12759                 return false;
12760             }
12761             if ( !results.get( 0 ).getId().equalsIgnoreCase( "45351" ) ) {
12762                 return false;
12763             }
12764             if ( !results.get( 0 ).getRank().equalsIgnoreCase( "species" ) ) {
12765                 return false;
12766             }
12767             if ( !results.get( 0 ).getScientificName().equals( "Nematostella vectensis" ) ) {
12768                 return false;
12769             }
12770             results = null;
12771             results = SequenceDbWsTools.getTaxonomiesFromId( "45351", 10 );
12772             if ( results.size() != 1 ) {
12773                 return false;
12774             }
12775             if ( !results.get( 0 ).getCode().equals( "NEMVE" ) ) {
12776                 return false;
12777             }
12778             if ( !results.get( 0 ).getCommonName().equalsIgnoreCase( "starlet sea anemone" ) ) {
12779                 return false;
12780             }
12781             if ( !results.get( 0 ).getId().equalsIgnoreCase( "45351" ) ) {
12782                 return false;
12783             }
12784             if ( !results.get( 0 ).getRank().equalsIgnoreCase( "species" ) ) {
12785                 return false;
12786             }
12787             if ( !results.get( 0 ).getScientificName().equals( "Nematostella vectensis" ) ) {
12788                 return false;
12789             }
12790             results = null;
12791             results = SequenceDbWsTools.getTaxonomiesFromTaxonomyCode( "NEMVE", 10 );
12792             if ( results.size() != 1 ) {
12793                 return false;
12794             }
12795             if ( !results.get( 0 ).getCode().equals( "NEMVE" ) ) {
12796                 return false;
12797             }
12798             if ( !results.get( 0 ).getCommonName().equalsIgnoreCase( "starlet sea anemone" ) ) {
12799                 return false;
12800             }
12801             if ( !results.get( 0 ).getId().equalsIgnoreCase( "45351" ) ) {
12802                 return false;
12803             }
12804             if ( !results.get( 0 ).getRank().equalsIgnoreCase( "species" ) ) {
12805                 return false;
12806             }
12807             if ( !results.get( 0 ).getScientificName().equals( "Nematostella vectensis" ) ) {
12808                 return false;
12809             }
12810             if ( !results.get( 0 ).getLineage().get( 1 ).equals( "Eukaryota" ) ) {
12811                 return false;
12812             }
12813             if ( !results.get( 0 ).getLineage().get( 2 ).equals( "Metazoa" ) ) {
12814                 return false;
12815             }
12816             if ( !results.get( 0 ).getLineage().get( results.get( 0 ).getLineage().size() - 1 )
12817                     .equals( "Nematostella vectensis" ) ) {
12818                 System.out.println( results.get( 0 ).getLineage() );
12819                 return false;
12820             }
12821             //
12822             results = null;
12823             results = SequenceDbWsTools.getTaxonomiesFromScientificNameStrict( "Xenopus tropicalis", 10 );
12824             if ( results.size() != 1 ) {
12825                 return false;
12826             }
12827             if ( !results.get( 0 ).getCode().equals( "XENTR" ) ) {
12828                 return false;
12829             }
12830             if ( !results.get( 0 ).getCommonName().equalsIgnoreCase( "Western clawed frog" ) ) {
12831                 return false;
12832             }
12833             if ( !results.get( 0 ).getId().equalsIgnoreCase( "8364" ) ) {
12834                 return false;
12835             }
12836             if ( !results.get( 0 ).getRank().equalsIgnoreCase( "species" ) ) {
12837                 return false;
12838             }
12839             if ( !results.get( 0 ).getScientificName().equals( "Xenopus tropicalis" ) ) {
12840                 return false;
12841             }
12842             if ( !results.get( 0 ).getLineage().get( results.get( 0 ).getLineage().size() - 1 )
12843                     .equals( "Xenopus tropicalis" ) ) {
12844                 System.out.println( results.get( 0 ).getLineage() );
12845                 return false;
12846             }
12847             //
12848             results = null;
12849             results = SequenceDbWsTools.getTaxonomiesFromId( "8364", 10 );
12850             if ( results.size() != 1 ) {
12851                 return false;
12852             }
12853             if ( !results.get( 0 ).getCode().equals( "XENTR" ) ) {
12854                 return false;
12855             }
12856             if ( !results.get( 0 ).getCommonName().equalsIgnoreCase( "Western clawed frog" ) ) {
12857                 return false;
12858             }
12859             if ( !results.get( 0 ).getId().equalsIgnoreCase( "8364" ) ) {
12860                 return false;
12861             }
12862             if ( !results.get( 0 ).getRank().equalsIgnoreCase( "species" ) ) {
12863                 return false;
12864             }
12865             if ( !results.get( 0 ).getScientificName().equals( "Xenopus tropicalis" ) ) {
12866                 return false;
12867             }
12868             if ( !results.get( 0 ).getLineage().get( results.get( 0 ).getLineage().size() - 1 )
12869                     .equals( "Xenopus tropicalis" ) ) {
12870                 System.out.println( results.get( 0 ).getLineage() );
12871                 return false;
12872             }
12873             //
12874             results = null;
12875             results = SequenceDbWsTools.getTaxonomiesFromTaxonomyCode( "XENTR", 10 );
12876             if ( results.size() != 1 ) {
12877                 return false;
12878             }
12879             if ( !results.get( 0 ).getCode().equals( "XENTR" ) ) {
12880                 return false;
12881             }
12882             if ( !results.get( 0 ).getCommonName().equalsIgnoreCase( "Western clawed frog" ) ) {
12883                 return false;
12884             }
12885             if ( !results.get( 0 ).getId().equalsIgnoreCase( "8364" ) ) {
12886                 return false;
12887             }
12888             if ( !results.get( 0 ).getRank().equalsIgnoreCase( "species" ) ) {
12889                 return false;
12890             }
12891             if ( !results.get( 0 ).getScientificName().equals( "Xenopus tropicalis" ) ) {
12892                 return false;
12893             }
12894             if ( !results.get( 0 ).getLineage().get( results.get( 0 ).getLineage().size() - 1 )
12895                     .equals( "Xenopus tropicalis" ) ) {
12896                 System.out.println( results.get( 0 ).getLineage() );
12897                 return false;
12898             }
12899         }
12900         catch ( final IOException e ) {
12901             System.out.println();
12902             System.out.println( "the following might be due to absence internet connection:" );
12903             e.printStackTrace( System.out );
12904             return true;
12905         }
12906         catch ( final Exception e ) {
12907             return false;
12908         }
12909         return true;
12910     }
12911
12912     private static boolean testWabiTxSearch() {
12913         try {
12914             String result = "";
12915             result = TxSearch.searchSimple( "nematostella" );
12916             result = TxSearch.getTxId( "nematostella" );
12917             if ( !result.equals( "45350" ) ) {
12918                 return false;
12919             }
12920             result = TxSearch.getTxName( "45350" );
12921             if ( !result.equals( "Nematostella" ) ) {
12922                 return false;
12923             }
12924             result = TxSearch.getTxId( "nematostella vectensis" );
12925             if ( !result.equals( "45351" ) ) {
12926                 return false;
12927             }
12928             result = TxSearch.getTxName( "45351" );
12929             if ( !result.equals( "Nematostella vectensis" ) ) {
12930                 return false;
12931             }
12932             result = TxSearch.getTxId( "Bacillus subtilis subsp. subtilis str. N170" );
12933             if ( !result.equals( "536089" ) ) {
12934                 return false;
12935             }
12936             result = TxSearch.getTxName( "536089" );
12937             if ( !result.equals( "Bacillus subtilis subsp. subtilis str. N170" ) ) {
12938                 return false;
12939             }
12940             final List<String> queries = new ArrayList<String>();
12941             queries.add( "Campylobacter coli" );
12942             queries.add( "Escherichia coli" );
12943             queries.add( "Arabidopsis" );
12944             queries.add( "Trichoplax" );
12945             queries.add( "Samanea saman" );
12946             queries.add( "Kluyveromyces marxianus" );
12947             queries.add( "Bacillus subtilis subsp. subtilis str. N170" );
12948             queries.add( "Bornavirus parrot/PDD/2008" );
12949             final List<RANKS> ranks = new ArrayList<RANKS>();
12950             ranks.add( RANKS.SUPERKINGDOM );
12951             ranks.add( RANKS.KINGDOM );
12952             ranks.add( RANKS.FAMILY );
12953             ranks.add( RANKS.GENUS );
12954             ranks.add( RANKS.TRIBE );
12955             result = TxSearch.searchLineage( queries, ranks );
12956             result = TxSearch.searchParam( "Homo sapiens", TAX_NAME_CLASS.ALL, TAX_RANK.SPECIES, 10, true );
12957             result = TxSearch.searchParam( "Samanea saman", TAX_NAME_CLASS.SCIENTIFIC_NAME, TAX_RANK.ALL, 10, true );
12958         }
12959         catch ( final Exception e ) {
12960             System.out.println();
12961             System.out.println( "the following might be due to absence internet connection:" );
12962             e.printStackTrace( System.out );
12963             return false;
12964         }
12965         return true;
12966     }
12967 }